kCACAby nameby nameppsbldd kn-PBm7u>9CA9CA9CA >./lpp_names/msgm4 R S csm.core { csm.core 1.3.3.5 01 N B en_US Cluster Systems Management Core [ *ifreq csm.client (1.3.0.0) 1.3.3.2 *ifreq csm.dsh (1.3.0.0) 1.3.3.3 *ifreq csm.gui.dcem (1.3.0.0) 1.3.3.1 *ifreq csm.server (1.3.0.0) 1.3.3.4 *prereq csm.core 1.3.3.0 % /usr/lpp/csm.core/csm.core/1.3.3.5/inst_root/etc/opt/csm 8 /usr/lpp/SAVESPACE 4896 /opt/csm/bin 296 /usr/lib/objrepos 32 /opt/csm/codebase 32 /opt/csm/csmbin 872 /opt/csm/csmbin/diagnostics 1056 /opt/csm/install 40 /opt/csm/install/defs 56 /opt/csm/install/pkgdefs 568 /opt/csm/lib 96 /opt/csm/man/man1 8 /opt/csm/msgmaps 200 /opt/csm/pm 1352 /opt/csm/pm/Rpm 88 /usr/lib/nls/msg/C 208 /usr/sbin/rsct/trctmplts 8 /usr/websm/config/factory_defaults 8 INSTWORK 144 80 /lpp/csm.core 32 /etc/opt/csm 8 /lpp/SAVESPACE 8 /etc/objrepos 8 % % % IY55834 3 FIXES AND UPDATES FOR CSM 1.3.3.0 IY47873 3 Service support required for CSM 1.3.2 IY50991 2 Required Maintenance Upgrade for CSM 1.3.2. IY56212 2 FIXES AND UPDATES FOR CSM 1.3.3.1 IY58665 5 Support of several fixes for CSM 1.3.3.2 for AIX IY58282 2 UPDATENODE REMOVES ENTRIES FROM /ETC/XTAB IY60036 1 LX: Provide a way to not set up dhcpd.conf from csmsetupks/yast IY60039 1 need env to skip isrv sync IY62825 1 IF DU -S ON CDROM MOUNT POINT RETURNS 0 CSMSETUPYAST EXITS IY64638 1 CANNOT REJECT OR COMMIT CSM 1.3.3.4 ] }  k-PBm7uyAAAAAA y./usr/lpp/csm.core/csm.core/1.3.3.5/liblpp.a172m 30658 0 68 28942 0 20 188 0 1100298298 30007 1 644 9 productid` csm.core 5765-E88AP 268 564 68 1100298298 30007 1 644 18 csm.core.copyright` Licensed Materials - Property of IBM 5765E88AP (C) Copyright International Business Machines Corp. 1985, 2004. All rights reserved. US Government Users Restricted Rights - Use, duplication or disclosure restricted by GSA ADP Schedule Contract with IBM Corp. 351 1028 188 1100298299 30007 1 755 20 csm.core.1330.odmdel` if [ "$INUSAVE" = "1" ] ; then odmget -q " text = 'Install the Management Server' AND id_seq_num = '010' AND id = 'csm_inst' " sm_menu_opt >> $SAVEDIR/csm.core.1330.rodmadd chmod a+x $SAVEDIR/csm.core.1330.rodmadd fi odmdelete -o sm_menu_opt -q " text = 'Install the Management Server' AND id_seq_num = '010' AND id = 'csm_inst' " > /dev/null 1251 2390 564 1100298299 30007 1 755 17 csm.core.config_u` #!/usr/bin/ksh ODMDIR=/usr/lib/objrepos /usr/bin/odmget -q "lpp_name='csm.core' AND ver='1' AND rel='3' AND mod='3' AND fix='4'" product > /tmp/csm.core.odm1 if [[ -s /tmp/csm.core.odm1 ]] then if (/bin/grep "*prereq csm.core 1.3.3. " /tmp/csm.core.odm1 > /dev/null 2>&1) then /bin/ed -s /tmp/csm.core.odm1 - < /tmp/csm.core.odm1 if [[ -s /tmp/csm.core.odm1 ]] then if (/bin/grep "*prereq csm.core 1.3.3. " /tmp/csm.core.odm1 > /dev/null 2>&1) then /bin/ed -s /tmp/csm.core.odm1 - < /dev/null odmdelete -o sm_menu_opt -q "id = 'csm' AND id_seq_num = '010' AND next_id = 'csm_inst'" > /dev/null odmdelete -o sm_menu_opt -q "id = 'csm_inst' AND id_seq_num = '080' AND next_id = 'csm_uninstallms'" > /dev/null odmdelete -o sm_cmd_hdr -q "id = 'csm_uninstallms'" > /dev/null odmdelete -o sm_cmd_opt -q "id = 'csm_uninstms_dialog' AND id_seq_num = '020'" > /dev/null odmdelete -o sm_cmd_opt -q "id = 'csm_uninstms_dialog' AND id_seq_num = '030'" > /dev/null odmdelete -o sm_cmd_opt -q "id = 'csm_uninstms_dialog' AND id_seq_num = '040'" > /dev/null 1629 7910 5368 1097076598 30007 1 755 37 csm.core.csm_smit_core_stanzas.odmdel` if [ "$INUSAVE" = "1" ] ; then odmget -q "id = 'top_menu' AND id_seq_num = '710' AND next_id = 'csm'" sm_menu_opt >> $SAVEDIR/csm.core.csm_smit_core_stanzas.rodmadd odmget -q "id = 'csm' AND id_seq_num = '010' AND next_id = 'csm_inst'" sm_menu_opt >> $SAVEDIR/csm.core.csm_smit_core_stanzas.rodmadd odmget -q "id = 'csm_inst' AND id_seq_num = '080' AND next_id = 'csm_uninstallms'" sm_menu_opt >> $SAVEDIR/csm.core.csm_smit_core_stanzas.rodmadd odmget -q "id = 'csm_uninstallms'" sm_cmd_hdr >> $SAVEDIR/csm.core.csm_smit_core_stanzas.rodmadd odmget -q "id = 'csm_uninstms_dialog' AND id_seq_num = '020'" sm_cmd_opt >> $SAVEDIR/csm.core.csm_smit_core_stanzas.rodmadd odmget -q "id = 'csm_uninstms_dialog' AND id_seq_num = '030'" sm_cmd_opt >> $SAVEDIR/csm.core.csm_smit_core_stanzas.rodmadd odmget -q "id = 'csm_uninstms_dialog' AND id_seq_num = '040'" sm_cmd_opt >> $SAVEDIR/csm.core.csm_smit_core_stanzas.rodmadd chmod a+x $SAVEDIR/csm.core.csm_smit_core_stanzas.rodmadd fi odmdelete -o sm_menu_opt -q "id = 'top_menu' AND id_seq_num = '710' AND next_id = 'csm'" > /dev/null odmdelete -o sm_menu_opt -q "id = 'csm' AND id_seq_num = '010' AND next_id = 'csm_inst'" > /dev/null odmdelete -o sm_menu_opt -q "id = 'csm_inst' AND id_seq_num = '080' AND next_id = 'csm_uninstallms'" > /dev/null odmdelete -o sm_cmd_hdr -q "id = 'csm_uninstallms'" > /dev/null odmdelete -o sm_cmd_opt -q "id = 'csm_uninstms_dialog' AND id_seq_num = '020'" > /dev/null odmdelete -o sm_cmd_opt -q "id = 'csm_uninstms_dialog' AND id_seq_num = '030'" > /dev/null odmdelete -o sm_cmd_opt -q "id = 'csm_uninstms_dialog' AND id_seq_num = '040'" > /dev/null 17381 25402 6150 1100300728 30007 1 644 18 csm.core.inventory` /opt/csm/bin/copycsmpkgs: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 21345 checksum = "43433 21 " /opt/csm/bin/csmcorecfg: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 422 checksum = "22740 1 " /opt/csm/bin/csmcoreuncfg: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 434 checksum = "05520 1 " /opt/csm/bin/installms: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 58645 checksum = "09733 58 " /opt/csm/bin/lscmtms: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 4919 checksum = "41964 5 " /opt/csm/bin/mgmtsvr: owner = bin group = bin mode = 555 type = FILE class = apply,inventory,csm.core size = 10485 checksum = "45501 11 " /opt/csm/bin/sprc: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 14833 checksum = "35095 15 " /opt/csm/bin/uninstallms: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 18804 checksum = "48086 19 " /opt/csm/codebase/WebSMCSMcore.jar: owner = bin group = bin mode = 744 type = FILE class = apply,inventory,csm.core size = 13441 checksum = "43218 14 " /opt/csm/csmbin/add_KRB5principals: owner = bin group = bin mode = 700 type = FILE class = apply,inventory,csm.core size = 55018 checksum = "34120 54 " /opt/csm/csmbin/checkrpmprereqs: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 4209 checksum = "22969 5 " /opt/csm/csmbin/clogger: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 12538 checksum = "27553 13 " /opt/csm/csmbin/diagnostics/DiagnoseHMC: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 531016 checksum = "40789 519 " /opt/csm/csmbin/diagnostics/USAGE_and_README: owner = bin group = bin mode = 444 type = FILE class = apply,inventory,csm.core size = 4445 checksum = "44094 5 " /opt/csm/csmbin/getSourceIP2Target: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 209101 checksum = "55122 205 " /opt/csm/csmbin/popk5login: owner = bin group = bin mode = 700 type = FILE class = apply,inventory,csm.core size = 49392 checksum = "48261 49 " /opt/csm/csmbin/rmnode_client: owner = bin group = bin mode = 555 type = FILE class = apply,inventory,csm.core size = 10453 checksum = "63498 11 " /opt/csm/csmbin/rmstanza: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 85798 checksum = "47776 84 " /opt/csm/install/CSM_CLIENT.bnd: owner = bin group = bin mode = 644 type = FILE class = apply,inventory,csm.core size = 68 checksum = "60661 1 " /opt/csm/install/CSM_SERVER.bnd: owner = bin group = bin mode = 644 type = FILE class = apply,inventory,csm.core size = 174 checksum = "30232 1 " /opt/csm/install/csmfilelist_aixV51: owner = bin group = bin mode = 444 type = FILE class = apply,inventory,csm.core size = 42 checksum = "40802 1 " /opt/csm/install/csmfilelist_aixV52: owner = bin group = bin mode = 444 type = FILE class = apply,inventory,csm.core size = 128 checksum = "53404 1 " /opt/csm/install/csmrpms_aixV52: owner = bin group = bin mode = 444 type = FILE class = apply,inventory,csm.core size = 92 checksum = "60469 1 " /opt/csm/install/defs/AIX.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 2702 checksum = "62965 3 " /opt/csm/install/defs/Linux-SLES.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 974 checksum = "54088 1 " /opt/csm/install/defs/Linux-SLES8.1.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 1081 checksum = "27135 2 " /opt/csm/install/defs/Linux-SuSE.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 966 checksum = "58153 1 " /opt/csm/install/defs/Linux-SuSE8.1.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 1079 checksum = "59424 2 " /opt/csm/install/defs/Linux-SuSE8.2.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 975 checksum = "00673 1 " /opt/csm/install/defs/Linux.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 2229 checksum = "21683 3 " /opt/csm/install/pkgdefs/AIX-5.1.0.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 3996 checksum = "41677 4 " /opt/csm/install/pkgdefs/AIX-5.2.0.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 4819 checksum = "62174 5 " /opt/csm/install/pkgdefs/AIX.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 2520 checksum = "05801 3 " /opt/csm/install/pkgdefs/Linux-RedHat7.2.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 8808 checksum = "01438 9 " /opt/csm/install/pkgdefs/Linux-RedHat7.3.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 9430 checksum = "61395 10 " /opt/csm/install/pkgdefs/Linux-RedHat8.0.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 9302 checksum = "43465 10 " /opt/csm/install/pkgdefs/Linux-RedHat9.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 9324 checksum = "20584 10 " /opt/csm/install/pkgdefs/Linux-RedHatAS2.1.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 11897 checksum = "18472 12 " /opt/csm/install/pkgdefs/Linux-RedHatEL-AS3-ppc64.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 17778 checksum = "29515 18 " /opt/csm/install/pkgdefs/Linux-RedHatEL-AS3-x86_64.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 13476 checksum = "42593 14 " /opt/csm/install/pkgdefs/Linux-RedHatEL-AS3.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 13230 checksum = "56043 13 " /opt/csm/install/pkgdefs/Linux-RedHatEL-ES2.1.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 11147 checksum = "19859 11 " /opt/csm/install/pkgdefs/Linux-RedHatEL-ES3.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 13593 checksum = "44338 14 " /opt/csm/install/pkgdefs/Linux-RedHatEL-WS2.1.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 11139 checksum = "20366 11 " /opt/csm/install/pkgdefs/Linux-RedHatEL-WS3-x86_64.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 12002 checksum = "17977 12 " /opt/csm/install/pkgdefs/Linux-RedHatEL-WS3.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 11929 checksum = "61543 12 " /opt/csm/install/pkgdefs/Linux-SLES7.2.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 8014 checksum = "02287 8 " /opt/csm/install/pkgdefs/Linux-SLES8.1-ppc64.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 19187 checksum = "12262 19 " /opt/csm/install/pkgdefs/Linux-SLES8.1-x86_64.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 10234 checksum = "34224 10 " /opt/csm/install/pkgdefs/Linux-SLES8.1.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 10030 checksum = "09881 10 " /opt/csm/install/pkgdefs/Linux-SuSE8.0.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 9744 checksum = "37564 10 " /opt/csm/install/pkgdefs/Linux-SuSE8.1.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 10340 checksum = "39505 11 " /opt/csm/install/pkgdefs/Linux-SuSE8.2.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 9663 checksum = "58856 10 " /opt/csm/install/pkgdefs/Linux.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 3877 checksum = "43058 4 " /opt/csm/lib/libcsm_clog.a: owner = bin group = bin mode = 444 type = FILE class = apply,inventory,csm.core size = 46277 checksum = "06915 46 " /opt/csm/man/man1/mgmtsvr.1: owner = bin group = bin mode = 444 type = FILE class = apply,inventory,csm.core size = 3671 checksum = "49217 4 " /opt/csm/msgmaps/IBM.CLOG.Perl.map: owner = bin group = bin mode = 444 type = FILE class = apply,inventory,csm.core size = 270 checksum = "52175 1 " /opt/csm/msgmaps/csmInstall.csminstall.map: owner = bin group = bin mode = 444 type = FILE class = apply,inventory,csm.core size = 85829 checksum = "65013 84 " /opt/csm/msgmaps/csmKRB5p.csmKRB5p_msg.map: owner = bin group = bin mode = 444 type = FILE class = apply,inventory,csm.core size = 3719 checksum = "64587 4 " /opt/csm/msgmaps/nodecmds.NodeUtils.map: owner = bin group = bin mode = 444 type = FILE class = apply,inventory,csm.core size = 1065 checksum = "00086 2 " /opt/csm/msgmaps/nodecmds.mgmtsvr.map: owner = bin group = bin mode = 444 type = FILE class = apply,inventory,csm.core size = 3268 checksum = "15221 4 " /opt/csm/pm/ArchiveUtils.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 180977 checksum = "33476 177 " /opt/csm/pm/CLOG.pm: owner = bin group = bin mode = 444 type = FILE class = apply,inventory,csm.core size = 35509 checksum = "01576 35 " /opt/csm/pm/CSMDefs.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 8094 checksum = "17225 8 " /opt/csm/pm/InstallDefs.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 376 checksum = "32655 1 " /opt/csm/pm/InstallKRB5Utils.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 49526 checksum = "05697 49 " /opt/csm/pm/InstallUtils.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 28196 checksum = "60834 28 " /opt/csm/pm/MessageUtils.pm: owner = bin group = bin mode = 555 type = FILE class = apply,inventory,csm.core size = 34984 checksum = "54114 35 " /opt/csm/pm/NetworkUtils.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 124232 checksum = "08869 122 " /opt/csm/pm/NodeUtils.pm: owner = bin group = bin mode = 555 type = FILE class = apply,inventory,csm.core size = 110963 checksum = "56463 109 " /opt/csm/pm/Rpm/RpmIndex.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 41719 checksum = "52021 41 " /opt/csm/pm/ServerUtils.pm: owner = bin group = bin mode = 755 type = FILE class = apply,inventory,csm.core size = 96384 checksum = "24299 95 " /usr/lib/nls/msg/C/IBM.CLOG.cat: owner = bin group = bin mode = 444 type = FILE class = apply,inventory,csm.core size = 735 checksum = "35117 1 " /usr/lib/nls/msg/C/csmKRB5.cat: owner = bin group = bin mode = 444 type = FILE class = apply,inventory,csm.core size = 5473 checksum = "40939 6 " /usr/lib/nls/msg/C/csmSMIT.cat: owner = bin group = bin mode = 444 type = FILE class = apply,inventory,csm.core size = 92383 checksum = "44194 91 " /usr/sbin/rsct/trctmplts/_CLG.tpl: owner = bin group = bin mode = 444 type = FILE class = apply,inventory,csm.core size = 605 checksum = "24882 1 " /usr/websm/config/factory_defaults/AppClusterCore.db: owner = bin group = bin mode = 744 type = FILE class = apply,inventory,csm.core size = 331 checksum = "11075 1 " 449 25958 7910 1100300728 30007 1 644 13 csm.core.size` /usr/lpp/csm.core/csm.core/1.3.3.5/inst_root/etc/opt/csm 8 /usr/lpp/SAVESPACE 4896 /opt/csm/bin 296 /usr/lib/objrepos 32 /opt/csm/codebase 32 /opt/csm/csmbin 872 /opt/csm/csmbin/diagnostics 1056 /opt/csm/install 40 /opt/csm/install/defs 56 /opt/csm/install/pkgdefs 568 /opt/csm/lib 96 /opt/csm/man/man1 8 /opt/csm/msgmaps 200 /opt/csm/pm 1352 /opt/csm/pm/Rpm 88 /usr/lib/nls/msg/C 208 /usr/sbin/rsct/trctmplts 8 /usr/websm/config/factory_defaults 8 2882 28942 25402 1100300728 30007 1 644 11 csm.core.al` ./usr/lpp/csm.core/csm.core/1.3.3.5/inst_root/etc/opt/csm/csmkrb5.conf.default ./opt/csm/bin/copycsmpkgs ./opt/csm/bin/csmcorecfg ./opt/csm/bin/csmcoreuncfg ./opt/csm/bin/installms ./opt/csm/bin/lscmtms ./opt/csm/bin/mgmtsvr ./opt/csm/bin/sprc ./opt/csm/bin/uninstallms ./opt/csm/codebase/WebSMCSMcore.jar ./opt/csm/csmbin/add_KRB5principals ./opt/csm/csmbin/checkrpmprereqs ./opt/csm/csmbin/clogger ./opt/csm/csmbin/diagnostics/DiagnoseHMC ./opt/csm/csmbin/diagnostics/USAGE_and_README ./opt/csm/csmbin/getSourceIP2Target ./opt/csm/csmbin/popk5login ./opt/csm/csmbin/rmnode_client ./opt/csm/csmbin/rmstanza ./opt/csm/install/CSM_CLIENT.bnd ./opt/csm/install/CSM_SERVER.bnd ./opt/csm/install/csmfilelist_aixV51 ./opt/csm/install/csmfilelist_aixV52 ./opt/csm/install/csmrpms_aixV52 ./opt/csm/install/defs/AIX.pm ./opt/csm/install/defs/Linux-SLES.pm ./opt/csm/install/defs/Linux-SLES8.1.pm ./opt/csm/install/defs/Linux-SuSE.pm ./opt/csm/install/defs/Linux-SuSE8.1.pm ./opt/csm/install/defs/Linux-SuSE8.2.pm ./opt/csm/install/defs/Linux.pm ./opt/csm/install/pkgdefs/AIX-5.1.0.pm ./opt/csm/install/pkgdefs/AIX-5.2.0.pm ./opt/csm/install/pkgdefs/AIX.pm ./opt/csm/install/pkgdefs/Linux-RedHat7.2.pm ./opt/csm/install/pkgdefs/Linux-RedHat7.3.pm ./opt/csm/install/pkgdefs/Linux-RedHat8.0.pm ./opt/csm/install/pkgdefs/Linux-RedHat9.pm ./opt/csm/install/pkgdefs/Linux-RedHatAS2.1.pm ./opt/csm/install/pkgdefs/Linux-RedHatEL-AS3-ppc64.pm ./opt/csm/install/pkgdefs/Linux-RedHatEL-AS3-x86_64.pm ./opt/csm/install/pkgdefs/Linux-RedHatEL-AS3.pm ./opt/csm/install/pkgdefs/Linux-RedHatEL-ES2.1.pm ./opt/csm/install/pkgdefs/Linux-RedHatEL-ES3.pm ./opt/csm/install/pkgdefs/Linux-RedHatEL-WS2.1.pm ./opt/csm/install/pkgdefs/Linux-RedHatEL-WS3-x86_64.pm ./opt/csm/install/pkgdefs/Linux-RedHatEL-WS3.pm ./opt/csm/install/pkgdefs/Linux-SLES7.2.pm ./opt/csm/install/pkgdefs/Linux-SLES8.1-ppc64.pm ./opt/csm/install/pkgdefs/Linux-SLES8.1-x86_64.pm ./opt/csm/install/pkgdefs/Linux-SLES8.1.pm ./opt/csm/install/pkgdefs/Linux-SuSE8.0.pm ./opt/csm/install/pkgdefs/Linux-SuSE8.1.pm ./opt/csm/install/pkgdefs/Linux-SuSE8.2.pm ./opt/csm/install/pkgdefs/Linux.pm ./opt/csm/lib/libcsm_clog.a ./opt/csm/man/man1/mgmtsvr.1 ./opt/csm/msgmaps/IBM.CLOG.Perl.map ./opt/csm/msgmaps/csmInstall.csminstall.map ./opt/csm/msgmaps/csmKRB5p.csmKRB5p_msg.map ./opt/csm/msgmaps/nodecmds.NodeUtils.map ./opt/csm/msgmaps/nodecmds.mgmtsvr.map ./opt/csm/pm/ArchiveUtils.pm ./opt/csm/pm/CLOG.pm ./opt/csm/pm/CSMDefs.pm ./opt/csm/pm/InstallDefs.pm ./opt/csm/pm/InstallKRB5Utils.pm ./opt/csm/pm/InstallUtils.pm ./opt/csm/pm/MessageUtils.pm ./opt/csm/pm/NetworkUtils.pm ./opt/csm/pm/NodeUtils.pm ./opt/csm/pm/Rpm/RpmIndex.pm ./opt/csm/pm/ServerUtils.pm ./usr/lib/nls/msg/C/IBM.CLOG.cat ./usr/lib/nls/msg/C/csmKRB5.cat ./usr/lib/nls/msg/C/csmSMIT.cat ./usr/sbin/rsct/trctmplts/_CLG.tpl ./usr/websm/config/factory_defaults/AppClusterCore.db 1607 30658 25958 1100300725 30007 1 644 16 csm.core.fixdata` fix: name = IY55834 abstract = FIXES AND UPDATES FOR CSM 1.3.3.0 type = f filesets = "csm.core:1.3.3.2\n\ csm.dsh:1.3.3.2\n\ csm.server:1.3.3.2\n\ " symptom = "" fix: name = IY47873 abstract = Service support required for CSM 1.3.2 type = f filesets = "csm.core:1.3.3.2\n\ csm.dsh:1.3.3.2\n\ csm.server:1.3.3.2\n\ " symptom = "" fix: name = IY50991 abstract = Required Maintenance Upgrade for CSM 1.3.2. type = f filesets = "csm.core:1.3.3.2\n\ csm.server:1.3.3.2\n\ " symptom = "" fix: name = IY56212 abstract = FIXES AND UPDATES FOR CSM 1.3.3.1 type = f filesets = "csm.core:1.3.3.2\n\ csm.server:1.3.3.2\n\ " symptom = "" fix: name = IY58665 abstract = Support of several fixes for CSM 1.3.3.2 for AIX type = f filesets = "csm.client:1.3.3.2\n\ csm.core:1.3.3.2\n\ csm.dsh:1.3.3.2\n\ csm.server:1.3.3.3\n\ pssp.pssp_to_csm:1.1.0.2\n\ " symptom = "" fix: name = IY58282 abstract = UPDATENODE REMOVES ENTRIES FROM /ETC/XTAB type = f filesets = "csm.core:1.3.3.3\n\ csm.dsh:1.3.3.3\n\ " symptom = "" fix: name = IY60036 abstract = LX: Provide a way to not set up dhcpd.conf from csmsetupks/yast type = f filesets = "csm.core:1.3.3.3\n\ " symptom = "" fix: name = IY60039 abstract = need env to skip isrv sync type = f filesets = "csm.core:1.3.3.3\n\ " symptom = "" fix: name = IY62825 abstract = IF DU -S ON CDROM MOUNT POINT RETURNS 0 CSMSETUPYAST EXITS type = f filesets = "csm.core:1.3.3.4\n\ " symptom = "" fix: name = IY64638 abstract = CANNOT REJECT OR COMMIT CSM 1.3.3.4 type = f filesets = "csm.core:1.3.3.5\n\ " symptom = "" 390 0 28942 0 0 0 0 0 ` 11 68 188 564 1028 2390 5368 6150 7910 25402 25958 28942 productidcsm.core.copyrightcsm.core.1330.odmdelcsm.core.config_ucsm.core.csm_smit_core_stanzas.odmaddcsm.core.csm_smit_core_stanzas.unodmaddcsm.core.csm_smit_core_stanzas.odmdelcsm.core.inventorycsm.core.sizecsm.core.alcsm.core.fixdata/defs/ k[f0PBm7uAAAAAA ./usr/lpp/csm.core/csm.core/1.3.3.5/inst_root/liblpp.arm 538 0 68 400 0 224 400 0 1100300729 30007 1 644 18 csm.core.inventory` /etc/opt/csm/csmkrb5.conf.default: owner = bin group = bin mode = 744 type = FILE class = apply,inventory,csm.core size = 2117 checksum = "07650 3 " 35 538 68 1100300729 30007 1 644 11 csm.core.al` ./etc/opt/csm/csmkrb5.conf.default 67 0 400 0 0 0 0 0 ` 2 68 400 csm.core.inventorycsm.core.al kDj0PB7uEq@q@q@ E./usr/lpp/csm.core/csm.core/1.3.3.5/inst_root/etc/opt/csm/csmkrb5.conf.defaulta# @(#)34 1.6 src/csm/krb5/cfg/csmkrb5.conf.default, setup, csm_rveg, rveg0414a 10/27/03 10:02:34 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # # This default configuration file provides paths that will be searched # for the location of the installed Kerberos API libraries. # Due to the many distributions of Kerberos supported on Linux, this # configuration file allows the administrator to customize # where the Linux Kerberos API libraries are installed and supply that # information to the CSM Kerberos configuration scripts and executables. # For AIX, only the NAS ( Network Authentication Service) version # of Kerberos, shipped on the AIX Expansion Pack, # is supported and this file is not used to determine location # of the libraries. # For Linux, only the Kerberos distributed with the Linux OS # is supported. For SuSE/SLES this is Heimdal Linux in the heimdal-* packages # distributed by SLES. For RedHat this is the krb5-* packages distributed # with RedHat. # # If this file needs to change, then the new configuration file should be # stored in /etc/opt/csm/csmkrb5.conf. The routines will check for # /etc/opt/csm/csmkrb5.conf first and use it, if it exists. # This will prevent changes being removed on a new installation. # The administrator must distribute changes to the nodes using CFM. # #[libs] # # We must have a path to the libkrb5.* and the libkadm5clnt.* libraries # # Only one path per line is allowed. # Lines beginning with "#" are considered comments # [libs] /usr/kerberos/lib/libkrb5.so /usr/kerberos/lib/libkrb5.so.3.1 /usr/kerberos/lib/libkrb5.so.3.0 /usr/lib/libkrb5.so.17 /usr/kerberos/lib/libkadm5clnt.so /usr/kerberos/lib/libkadm5clnt.so.5.0 /usr/lib/libkadm5clnt.so.4 k]1PB$7uq@q@q@ ./usr/lib/nls/msg/C/IBM.CLOG.cat.5/inst$ISO8859-1 ) %&"<N_   )   / 3<-p 2653-800 Internal library error %1$d.%2$s2653-801 Memory allocation error2653-802 Unable to start RMC session.2653-803 IBM.AuditRM connection error.2653-804 Unable to fetch nodes ID.This subsystem is defined by CLOG for recording significant event information.Component IDComponent IDComponent ID of system logging this entryMessage textMessage textMessage text from the system logging this entry2653-975 Bad, missing, or unusable clogger command.%1$s 2653-976 Internal error %2$s in CLOG.pm.2653-977 Invalid parameter %1$s.2653-978 Missing parameter%1$s.m k1PB$7uaQq@Qq@Qq@ a./usr/lib/nls/msg/C/csmKRB5.cat$ISO8859-1Jp2 #) 'M .u 2 - (.[GN#1H6e%-7;(-d-H/ 498n8 0!<"&N#$u$E%C&5 $'; Z(0 )5 *T +I R,% -0 .% /% 0 ?1' `2: 3n 4 25x 6- 77 8# 9Y:il;V<3-=na>?ZQ@RAYB1YC7D0E3FA(GjHIJUsage: k5rcmdtgt [-h] %1$d Adding: %1$s to file:%2$s. Did not add:%1$s to file:%2$s. It already exists. %1$s Invoked. Usage: popk5login [-h | -v] Usage: add_KRB5principals [-h] Enter the KRB5 administrator name: Enter the KRB5 administrator password: Please enter a valid KRB5 administrator name: Please enter a valid KRB5 administrator password: Creating %1$s principal with default policy. Creating %1$s principal with no policy. %1$s principal created. The %1$s library does not support policies. The principals will be created with no policy. The %1$s principal could not be created. Review the log for more information. The %1$s principal already exists. There is no CSMKRB5Principal attribute in %1$s . Usage: sendkeytab [-h | -n] Transfer of the KRB5 keytab completed with no errors. Transfering the KRB5 keytab to %1$s. 2657-001 This command invoked as: %1$s %2$s 2657-002 The argument is not valid : %1$s was entered. 2657-003 Could not read the krb5 configuration file: %1$s. 2657-004 Could not create backup log: %1$s. 2657-005 %1$s exiting with Return Code %2$d. 2657-006 Could not find default_realm in krb5 configuration file: %1$s. 2657-007 Call to %1$s had error return: %2$i. 2657-008 The CSM keytab file: %1$s does not exist. 2657-009 Error on dlopen of library: %1$s errno= %2$d. 2657-010 Could not establish address for %1$s in %2$s. 2657-011 Could not create the directory: %1$s. 2657-012 KRB5CCNAME credential cache: %1$s does not exist. 2657-013 Call to %1$s had error: %2$s 2657-014 Could not open file: %1$s. 2657-015 The keytab file: %1$s does not exist. Cannot send to node. 2657-016 The keytab file: %1$s is not valid. Cannot send to node. 2657-017 Memory allocation did not succeed in %1$s. 2657-018 Error reading public key for %1$s from THL file. 2657-019 Error reading KRB5 keytab file: %1$s. 2657-020 Error returned from %1$s return code=%2$d. 2657-021 Error preparing the KRB5 keytab file: %1$s. Can not transfer to the node. 2657-022 Error adding the KRB5 key to the krb5.keytab file on the node. 2657-023 Error reading private key. 2657-024 Error writing KRB5 keytab file: %1$s. 2657-025 Call to %1$s returned: %2$s 2657-026 Call to %1$s returned: %2$d 2657-027 Unable to remove %1$s. 2657-028 The %1$s file does not exist. 2657-029 Could not get CSM KRB5 principal name from %1$s. 2657-030 Could not create CSM KRB5 principal in .k5login file. The name was not available from the %1$s file. 2657-031 Could not find the %1$s shared library. For Linux, check path to library named configured in /etc/opt/csm/csmkrb5.conf.default. For AIX, check /usr/krb5/lib directory. If missing, install the KRB5 api library. 2657-032 The %1$s and the %2$s configuration files do not exist. Cannot determine the path to the KRB5 api libraries. 2657-033 Memory Allocation did not succeed. 2657-034 chmod command on file %1$s did not succeed . 2657-035 The file %1$s is empty . 2657-036 The file %1$s line $2$s has syntax error. Full path to library not provided . 2657-037 Could not create the %1$s KRB5 principal and keytab. Review this log for further information. 2657-038 Could not establish a writable operations routine for krb5_kt_add function. 2657-039 Node name missing on call to sendkeytab. 2657-040 Transfer of KRB5 keytab completed with errors. Check /var/log/csm/process_krb5_key.log on the node. 2657-041 An error occurred while preparing the keytab for node:%1$s. Check /var/log/csm/prepare_krb5_key.%1$s.log for details. 2657-042 Could not create log:%1$s for sendkeytab. Keyfile transfer will not take place. 2657-043 Input keydata not valid or null. Keyfile transfer will not take place. 2657-044 Unable to start session with host: %1$s. Keyfile transfer will not take place. 2657-045 Unable to end session with host: %1$s. 2657-046 Error code from RMC : %1$d, message is : %2$s2657-047 Invalid data received in updatekeytab 2657-048 %1$s received length=%1$d, version = %2$x 2657-049 %1$s The principal name or password may not be correct. 2657-050 The contents of the %1$s file are not in the correct format. Rerun csmconfig -K with your option to regenerate the file. 2657-051 The keytab file %1$s for the %2$s principal is missing. You must delete the principal from the KRB5 database and run definenode or csmconfig -K with your option to recreate the principal and keytab file. 2657-052 The keytab file %1$s for the %2$s principal is empty. You must remove the empty keytab file, delete the principal from the KRB5 database and run definenode or csmconfig -K with your option to recreate the principal and keytab file. 2657-053 Automatic keyfile update is not supported using Heimdal Kerberos Libraries. You can used the transferred keytab in %1$s and update the krb5.keytab file manually. n] Tra k1PB$7uh@@@ h./usr/lib/nls/msg/C/csmSMIT.cat$ISO8859-1Q ! X"` ," b"M#IY##$w)$,$#$%1%$/%V'%)%#%1% `&.!2&")&#c&$p'P%)'&7''?(#(<(c)<(*8(+)),#)@-.)d.+)/G)02*1"*:2K*]3#*4-*5R*6)+N77+x8<+9?+:<,-;8,j<,,=,><,?:-'@4-bA(-B)-CP-D).;EH.eF@.GF.H8/6I1/oJW/KU/L0OMn0N)1AOG1kP,1Q11R52X2HYS2]ZX2[Y3 \`3d].3a?3b244c64gd14e*4f-4g5)j^5Gk/5l(5m(5n>6(o+6gp)6q(6r(6s:7tC7Ju)7vH7w,8x)8.y%8X8~88X8Y9%`9.9?:2:O6:):*:7;;F#;d0;);$;L<:;(>e7>V>)??G7?]<?)??)@@9@WEA IAS)AAtBC7&C_CeD\sDsE6gEUFTFhAF3FTG3fGgGHWyHOI]aI,JLJ<RJ?JUK&Kr5KmK;L=LyFMLMTN&'N{NpNrO1^OP%P4P*4P_PPpQS;SCS8T)*Tb2T'TTsUUAVAWkX2GXXhY=Z [G\/]!Q]Q^]c^:^f"6^,6^6v_7f_8d_9E`R:z`;aa<yau=8b>Vc(?Oc@tcA|dDBdCeDcfFE5fFciG<jDHUjIHjJgk K kLlMwmNpn On~PovQDpfRpSQqgTbqU1rV>rNW9rXFrY+sZ!s:[t\\Ot]6w;^ wr_w`xaey-byczdze{fy|g|h?}i~jFkClm%nkor3pqrsot>fuZvwxklyzzr{|/}:~v %/11,9^9;7NF/Ji wtVrK99)j < cJdh8|iB)tuK6JO$h>h1'3Lh]y"@c72!j 61 !Rn^db&|#SP)4zBU-B}}>\PsO836lhOw0Qh`%*/!J"lAď&9/2b!ŁPţ:,/\5|5Ʋ>-'5U^Nj0CO_ȯP nɏɩ#$#;'U} ʚ ʻ   \<aC@)фeѮ/7D}|hBpdֳAOZ<תN 6!>""#'=$Re%Xٸ&]'oo(A)!* ޭ+Z,1-KH.2/0O]1v2u$34&5B67|P89;O:;<=>?+@,A*B4'C\D:E(@F3iGH)oI(JKELz.MHNhO+[PQR,SYT-$UcRVNWZX`YZ)[,&\#S]2w^/_(`)a,-bbZcod=-eHkfLgRh=Ti8jAk lHmXn1oGFp9q9r>sAtUuv^wd (xn yM z  J{t k|4 }$ ~5 :A p n 5:B7")Z<6[WTdl1~#D+#Ei=:bMpZ%D "6F";#7#s$R%$''(Y)9U))**u*+,l.+/r/0!_011 #1% 1I 1j1x 11 1 #1 1 1 226,2H'2u2,22-23*3E:3]/333344)4O4y4 4!'4".4#5$5(%5<&5Y'5w(5)5*5+ 5,6-*6. 6H/6i0 6x1(62#6364656677(7-87V9"7t:-7;57<87=F84>8{?8@ 8A8B8C8D8E9F(9/G 9XH 9bI,9nJ9K&9L9M"9N:O :P :$Q:0R:?S:VT :^U:kV :W:X:Y :Z :[:\:](:^';_';-`;Ua,;pb;c;d;e';f%<gK<:hJ<i<j%<k=l'="m&=Jn=qx*=w2= =(=(>0>H>y%>#>!>>*? ?=?^*?b+??,?#@@*+@H&@t@ @@@@@AA A" A0A>AVAqAAAAAA BBB!B(B9 B>BJ BiMBu-B(BC C.(C<CeCC%C#C.DD32DOD#DD>D#EE5ER%EqEE2E EF FF!F5 FJ FWFaFqF%F-F6F#G$7GH/GG G G!H ,H,%HY$H"H/H'H I .I7 #If #I !I'IIJJ2JGJ_JvJ*J%J)JK"-K=/Kk K4K%KL L! L=" LJ#LV$ Lh%Ls&Lz' L(L)L*L+)L,0M-'M5.&M]/M0M1M2M3M44N5"N56"NX7,N{8N9N:N;N<O=O>O4?ON@OgAOBOC)OD4OEPFP1G PNHPYIPpJPK%PL(PM'PN#QOQ;PQVQ%QoR0QS&QTQU4RVR8W"RMXRpYRZ2R[R\.R]S^S0_SI`S^aSpb!Sc"SdSeSf6SgT%h8T8iTqj9Tk%TlTmUnUo"U-p.UPq4UrHUsUt,Vu0V@v4VqwVx!VyVz V{W|W}W5~WH WeWoW W WWWWX X$XC XaXXX*XYYY:YZYqYYY"Y"YZ Z#ZDZ_Zy Z$ZZZZZZ![,[11[^9[L['\&\?&\f\*\\\]2]]J ][ ]g]u"]0]/]7^4^L,^ ^#^"^ _$_7#_\ _____`%`&`A'`h `$``````Ha aa*aHahaaa a a a b b$b>bXbrbbbbb bcc c2#cLcpc%c6cd 2d!/dO""d#d$d%d&d'd(e)e(*eC+e^,ey-e.e/e0e1e2f3f/4fB5fY6(fv7f80f94f:2g;6gQ<8g=9g>g?h@h+AhABh[ChrDhEhFhGhHhTop level panel for all CSM cluster interfaces. This leads to menus for 'CSM Install', 'Manage Cluster Data', and 'CSM Hardware Control'.Perform the tasks that are necessary to configure the system as a CSM Management ServerUninstall the CSM management server softwareUpdate (or install) CSM software packages and CFM configuration files on the nodes of the clusterCreate NIM machine definitions corresponding to CSM cluster node definitionsCreate NIM machine group definitions corresponding to CSM cluster node group definitionsSet up the CSM customization scripts so that they may be run by NIM on the cluster node during a base operating system installationTop level NIM panelDefine a node that will be managed by CSMChange a node definition in the CSM databaseRemove a node from the CSM databaseDisplay CSM node definitions.Manage node group definitions in the CSM databaseDefine a node group that will be managed by CSMChange a node group in the CSM databaseRemove a node group from the CSM databaseDisplay CSM node group definitions.Specify whether or not to copy software packages.Specify one or more directories, separated by colons, where installation packages can be found.Use the force option when installing the software.Display verbose messages to standard out.Remove the nodes before uninstalling the management server. (Issues 'rmnode' before uninstalling.)Remove and clean up nodes before uninstalling the management server. (Issues 'rmnode -u' before uninstalling.)Display verbose messages to standard out.Set up CSM customization scripts for all the CSM nodes.Setup is performed for all nodes that are in "PreManaged" mode.Setup is performed for all nodes that are in "Managed" mode.Comma separated list of cluster node host names to be setup.Comma separated list of cluster group names to be setup.Display verbose messages to standard out.Updates are performed on all nodes.Updates are performed on all PreManaged nodes.Updates are performed on all Managed nodes.A list of node hostnames (or IP addresses) on which to run the command.Update the nodes that are members of these groups.Force the updates of CSM filesets.Only report what would be done by the command. Do not perform any updates.Installs/updates the CSM code sets.Update the configuration files from /cfmroot.List of options to forward to CFM. Options must be enclosed within double quotes.Display verbose messages to standard out.Set up CSM customization scripts for all the CSM nodes.Setup is performed for all nodes that are in "Managed" mode.Setup is performed for all nodes that are in "PreManaged" mode.Comma separated list of cluster node host names to be setup.Comma separated list of cluster group names to be setup.Specifies the type of machine being defined.Specify NIM network name.Specifies the ring speed of the client's token-ring adapter.Specifies the cable type of the client's ethernet adapter.Specifies the platform of the machine being defined.Specifies the kernel type of the client.Display verbose messages to standard out.Specifies one or more CSM node groups to be used to create or update NIM groups.Display verbose messages to standard out.Either create the node definitions or just display them to standard out.The name of the file which contains node definition information.Specifies the IP address or host name for the first node to be added.Specifies how many nodes to define. The default is one.Specifies the list of console server definitions.Specifies the list of hardware control points and their associated service processors.Specifies the name of a hostname mapping file that may be used to define the node(s).The list of node definitions that would be created is displayed to standard out and is re-directed to a this node defintion file.After the nodes are defined, run the 'updatenode' command to install the nodes that were successfully defined.Display verbose messages to standard out.Hostname of the management server machine as known by the managed node.The CSM version to be installed on the node.The name of the operating system to be installed.The name of the distribution version to be installed.Installation method.Machine address of the nodes network adapter that will be used to install the node.The type of the adapter which will be used during the network installation of the node.The speed of the adapter which will be used during the network installation of the node.The duplex value of the adapter which will be used during the network installation of the node.Power method used to perform hardware control.Hostname of the network adapter for the hardware control point.Identifier associated with the node power control.Number associated with the console port for this node.The console method used to open the node console.Number associated with the console server.Hostname or IP address of the console server.Logical partition Identifier.Allow a a node to request to be managed. (Normally it is not necessary to set this attribute.)A node is either in PreManaged or Managed mode.Comma separated list of nodes to remove.Comma separated list of CSM node groups.Full path name of file containing list of nodes to be removed.Perform cleanup on the nodes being removed.Display verbose messages to standard out.Comma separated list of nodes to change.Comma separated list of CSM node groups.Full path name of file containing list of nodes to change.Changes the nodes that match the "where" part of the select string.Display verbose messages to standard out.Hostname of the management server machine as known by the managed node.The CSM version to be installed on the node.Name of operating system to be installed.Distribution version to be installed.Installation method.Machine address of the network adapter used for install.The type of the adapter which will be used during the network installation of the node.The speed of the adapter which will be used during the network installation of the node.The duplex value of the adapter which will be used during the network installation of the node.Power method used to perform hardware control.Hostname of the network adapter for the hardware control point.Identifier associated with the node power control.Number associated with the console port for this node.Console method used to open node console.Number associated with the console server.Hostname of the network adapter for the console server.Logical partition Identifier.Allow a request to manage the node.Change nodes in the PreManaged or Managed table.Comma separated list of nodes to display.Comma separated list of node groups.Display node definitions that match the "where" part of the select string.Full path name of file containing list of nodes to displayDisplay all attributes.Display the specified attributes. (Comma separated list of attributes).Display IP address.Display output in long format.Display the ping status of nodes.Display the short host name.Specify whether or not to display the name of the node at the beginning of each row of data that is returned.Specifies the delimiter that should be used to separate items within a row. The default is a comma (,).Display verbose messages to standard out.Specify a name to use for the new group.A comma separated list of node names to add to a group.Specifies the "where" clause of a select string to be used to search the nodes table.Display verbose messages to standard out.Node Group to modify.A comma separated list of node names to add to a group.A comma separated list of node names to remove from a group.Display verbose messages to standard out.Remove node group.Display verbose messages to standard out.List all defined node groups.List the definition of all groups. Each line of output will represent 1 group and will display its name, the validation setting, the type, and the definiton of the group contents.Search for this node. Display all the groups that contain this node.Display the "where" clause of the select string set for this node group.Display verbose messages to standard out.Selecting this menu option leads to menus for installing and uninstalling the management server, updating CSM on the cluster nodes, converting CSM to NIM nodes/groups, defining CSM nodes, the CSM setup of NIM, and the network installation manager.Selecting this menu option leads to menus for defining, modifying, removing, and displaying CSM nodes/node groups.Options for power control, network booting, hardware and network adapter information. This is the top level panel for all CSM hardware control interfaces.One more way to get to the NIM panels.Selecting this menu leads to options to define, modify, remove, or display a CSM Cluster Node.Selecting this menu leads to options to define, modify, remove, or display a CSM Cluster Node Group.Option to obtain network adapter information and optionally write network adapter information to the CSM Database.Causes one or more nodes to boot over the network using the adapter information for each node in the CSM Database.Option to query one or more hardware control points to obtain information about the nodes they manage.Specifies the power method which will be used to contact the hardware control point.Specifies one or more hardware control point hostnames on which to run the command.Optionally allows to write the information to a file for editing.Specifies the type of adapter which will be listed.Option to return the first adapter of a given type to successfully ping the server.For the adapter discovery option, the network speed must be given. Valid for Ethernet networks only.For the adapter discovery option, the network duplex must be given. Valid for Ethernet networks only.For the adapter discovery option, provide the Server IP address to ping to. Defaults to the Management Server IP address if not provided.For the adapter discovery option, provide the Gateway IP address to ping through. Defaults to "0.0.0.0" if not provided.Option to return all adapters of a given type to successfully ping the server.Specifies a file which will be used as input instead of acquiring the information from the nodes.Perform the adapter collection on all nodes.Enter a comma-separated list of nodes to perform the adapter collection on.Enter a comma-separated list of node groups to perform the adapter collection on.Writes the available adapter information into the CSM database.Output file. If given, command output is written to this file instead of the screen.Perform the network boot on all nodes.Perform the network boot on a specific list of nodes.Specifies one or more nodegroups which will be expanded to a list of nodes which will perform a network boot.Controls remote power for Cluster Systems Management nodes.Choose an Action: on -- power the node(s) on off -- power the node(s) off reboot -- reboot the node(s) resetsp_hcp -- reset the service processor for the Hardware Control Point(s) resetsp_host -- reset the service processor for the node(s) Enter a comma-separated list of nodes to perform the Power Action on.Enter a comma-separated list of node groups to perform the Power Action on.Adds all managed nodes defined in Cluster System Management (CSM) to the node list.Display verbose messages to the screen. Press Enter to continue.This command is used to store the user id and password used by internal programs to access the remote hardware.Enter the host name or IP address of the Hardware Control Point, or the name of the Management Processor Text ID.Enter the user ID associated with the Hardware Control Point or Management Processor Text ID.Enter a comment. (Must be in quotes.)NIM groups are created or updated for all CSM groupsSpecify whether or not to update existing NIM groupsChange all the nodes.Prints a group. If no options are given, and a group is specified, this is the default option. If this option is specified and no group is given (or the 1st group is "*"), then the membership of all the groups is displayed.Specifies a file that contains a list of groups to be defined. Each line of the file should contain the group name followed by a colon, then the following three fields separated by commas: type (static or dynamic), the validation setting (validated or not validated), and the definition of the group contents (either a select string or the unexpanded member list).The names in the group will represent generic names, they do not have to be actual node names in the CSM cluster. This option can only be used when creating a group.The name of the distribution to be installed. (Linux only.)The machine architecture of the node to be installed. (Linux only.)The version of the kernel to be installed. (Linux only.)The disk to be used for node installation.The type of disk to be used for node installation.Display the member list for all groups.Specifies a file that contains a list of node names. The file can contain multiple lines and each line can have one or more node names, separated by spaces.Installs/updates the Linux RPMS stored under the /csminstall subdirectory corresponding to the target Linux node.Forwards options to the SMS command. The following are the allowed flags: [--noinsdeps] [-i | --install packagename(s)] [-e | --erase [[--deps] | [--nodeps]] packagename(s)] Exchange RSCT public keys between the node and management server. Only use this option if the RSCT public key of either of the machines has changed. When this option is used you must trust your network at the time to be sure that a rogue machine is not going to insert their public key in place of the real node.Returns LCD values for nodes with the csp and hmc power methods.Specify the name of the PowerMethod that will be associated with the user ID and password that are entered.Get information about all the adapters associated with the given nodes.Creates or updates the specified stanza file. This file is in the correct format to be used with the Network Installation Manager(NIM) utility to configure additional network adapters.This option will add a node to the CSM cluster and do certain updates as described in CSM documentation.This option is used to force the netboot command to perform a Broadcast Boot, overriding the InstallAdapterGateway managed node attribute, if defined. Unless the network routers are configured to route broadcast packets, the install server must be located on the local network segment when this option is used.This field specifies the hostname or IP address of the Install Server, and is only used during a Directed Boot operation. If not supplied for a Directed Boot, the hostname of the Management Server is used.This address specifies the IP address of the network gateway used to reach the Install Server, and is used during a Directed Boot operation. Specify an address when the Install Server and target node to be installed are located on different network segments.Uninstalls Management Server without prompting.This option updates definitions for nodes that are have previously been defined.This option specified to not prompt for the node password, even if rsh/ssh is not configured.This option forces the updates of CSM filesets and performs a binary check on configuration files.This option displays output in definenode (stanza) format.This option displays output sorted by first attribute.This option displays the common members of two groups.This option displays the the members of the first group specified that are not members of the second group specified.Selecting this menu leads to additional CSM commands dsh, dcp, probes, backup and restore of CSM data.Select this option to accept CSM license and perform additional configuration of Management Server.Select this option to Accept CSM License, display the configuration.Select this option to Perform Additional configuration of Management Server like setting of remote shell, cluster ID etc.Select yes to display the current CSM version on the Management Server, default selection is no.Input the attribute to display or select all to display all the attributes . The default is none. The valid attributes are AddUnrecognizedNodes, ClusterSNum, ClusterTM, DeviceStatusFrequency, DeviceStatusSensitivity, ExpDate, HAMode, HeartbeatFrequency, HeartbeatSensitivity, MaxNumNodesInDomain, PowerStatusMode, RegSyncDelay, RemoteShell SetupKRB5 and SetupRemoteShell.Select yes to Accept try and Buy license. Default is no.Please input the location (pathname) of the Full license file, to accept Full License.Sets the Cluster serial number to this string. This value is used for service.Sets the cluster type and model to this string. This value is used for service, and should be in the form ####-###.Specify the path of the remote shell command that CSM should use to run commands on the nodes. The default is /usr/bin/rsh.Indicates whether CSM should try to automatically set up security for the remote shell specified in the RemoteShell cluster attribute. The default is yes. Remote shell setup will occur only if the current setup fails for dsh.Specify if the DMS resource manager should accept unexpected requests from systems, to manage them and allow them to join the CSM cluster. The default is no.Delay in seconds between the time the cluster data is updated in memory and written onto the disk.Indicates the level of Kerberos setup that should be done automatically by CSM. The default is 0 (None). This attribute is valid for Red Hat Linux only. The valid values are 0-15 0 None 1 Set up a Kerberos Version 5 server. 2 Set up a Kerberos Version 5 client on all Managed nodes. 4 Generate the CSM Kerberos Version 5 principal and keytab, and update the .k5login file on all Managed nodes. 8 Generate host Kerberos Version 5 principal and keytab for each Managed node, and automatically update the krb5.keytab file on the node. To combine any of the above setups, simply add the SetupKRB5 values together. For example, to set up Kerberos V5 clients and generate the CSM Kerberos V5 principal and keytab, then use 6 (2 + 4). For complete Kerberos setup, use SetupKRB5=15.Sets the mode for retrieving node power status. Valid values are mixed, polling, events, and none.Number of seconds between heartbeat messages sent to a node.Number of missed heartbeat messages sent to a node to declare that node unreachable.Writes the command's verbose messages to standard output. Default is no.To Verify if the Management Server is installed and configured properly, using CSM diagnostics,probes.The probe checks for problems resulting from installing the management server. It checks the required packages and directory structures , daemons and resource classes . It checks the following probes rmc, dmsrm, errm, ibm.csm.predefined_conditions and ibm.csm.predefined_nodegroups.Modifies existing node definitions with the changed attributes definition if the node has been already defined. If there are no existing node definitions, then definenode will create the node definitions specified.The default is no.Bypasses Kerberos Version 5 setup. None of the setup indicated by a nonzero value for the SetupKRB5 attribute is done.Applies to Linux nodes only. Forces the updates of packages and performs a binary check on configuration files.Specifies to not prompt for the node password even if rsh or OpenSSH is not configured. If you do not set this option and the remote shell is not configured , the updatenode command prompts for the node root password and attempts configuration.The console method used to open a node console. This attribute can be edited. Valid values are: csp, hmc, mrv, esp, els, computone and cps. Note: CSM supports the ESP console server on Red Hat 7.2, 7.3, and 8.0 management servers only.Specifies to update existing NIM client definitions. Default is yes.Copies CSM packages and prerequisites on the Management Servers. This Menu is used when the attributes of the nodes to be installed do not match the attributes of the management server.Specify one or more colon-separated directories containing CSM and RPM packages.The CSM version for the nodes. If not specified, the CSM version is same as on Management Server.The operating system. This attribute is required.The operating system distribution. This attribute is required.The operating system version. This attribute is required.The operating system package architecture. This attribute is required.Writes verbose messages to standard output.Distributes configuration files across a CSM cluster. This section provides the major function of the Configuration File Manager (CFM) application. CFM provides a file repository on the management server in /cfmroot to contain all configuration files that are shared by CFM Managed nodes.Updates open source RPM packages on CSM Linux nodes. This section updates, installs or deletes open source RPM packages across a CSM cluster.Manages device definitions in/from CSM database. This panel will manages the device definitions in the CSM database. The devices you manage are not managed nodes, they are optional devices included in your cluster infrastructure that require hardware control. Cluster devices include the HMC (Hardware Management Console) and RSA (Remote Supervisor Adapter cards) hardware control points, remote console and terminal servers, and SP Expansion I/O units. Managing devices in the cluster provides power control and remote console access to the devices from a central point of control.Manages device group definitions in/from CSM database.To list the names of all nodess.Displays output in a format suitable for redirecting into a nodedef file, which can then be used as input to the definenode -f command. This flag can be used to save the definition of one or more nodes so that they can be restored at a later time.Sorts the output by the first attribute displayed in each row. To determine which node the attributes apply to, include the Hostname attribute in the list.Specifies to take the intersection of two groups and display the results. Neither group is modified.Subtracts the membership of the second group from the first group and displays the resulting members. Neither group is modified.Distributes files to all nodes in the cluster. Use this option with caution in mixed clusters. Make sure the /cfmroot directory is set up to work with -a, since the nightly cron job pushes files out to all nodes.Specify a file that contains a list of node names. The file can contain multiple lines and each line can have one or more node names, separated by spaces.Specify a comma or space-separated list of node host names, IP addresses, or node ranges on which to run the command. Space-separated lists must be inside double quotes. For information about specifying node ranges, see the noderange man page.Resolves one or more node groups, separated by spaces or commas, and sends the resulting nodes their configuration files.Sends a query to determine the CFM files that are out of date across the cluster. These files will be updated by the next normal run of the this (cfmupdatenode) command. If all files are current, nothing is reported.Backs up existing configuration files on nodes as filename.OLD.Specifies younger mode. Files are normally updated if their modification times and sizes disagree with those of the master copy (located in /cfmroot). This flag causes the command to not update files that are younger than the master copy. This flag should be used only if the administrator is confident that the time clocks on the client nodes are in sync with the time clock on the management server. A warning message is printed for files that are newer than the master copy.Performs binary comparison on files and transfers them if they differ.Updates only the given file name. The file name should contain the absolute path name of the file and the file must reside in the /cfmroot directory.Specify the distfile location. This generates a distfile but does not call rdist, the open source utility used for file transfer. This allows the administrator to run Rdist with flexible options.Specify the path to use for remote commands. This flag can point to either an rshell or a secure remote command executable. If not specified with flags, the remote shell defaults first to the value of the DSH_REMOTE_CMD environment variable and then to the CSM RemoteShell attribute value.Sets the number of nodes to update concurrently. The default is 32 or the value specified by the CSM_FANOUT environment variable. Depending on the number of files to be transferred, cfmupdatenode can take time to update a node, so this number should be set accordingly. If all files are not being transferred to the target nodes, reduce the CSM_FANOUT value.Sets the timeout period (in seconds) for waiting for responses from a remote process. The default is 900 seconds.Specifies verbose mode.Targets all nodes.Specify a file that contains a list of nodes names. The file can contain multiple lines and each line can have one or more node names, separated by spaces.Specify a comma or space-separated list of node host names, IP addresses, or node ranges on which to run the command. Space-separated lists must be inside double quotes. For information about specifying node ranges, see the noderange man page.Specify a node group or a comma-separated list of node groups.Reports what would be done by the command without making any changes to the target nodes.Queries all RPM packages installed on the target machines and returns the installed RPM packages that are unique to each target node.Specifies to also return the common set of RPM packages installed on all target nodes.Plus Queries all RPM packages installed on the target machines and returns the installed RPM packages that are unique to each target node.Updates only the specified packages. The absolute path is determined by searching the directory structure.If the RPM update has additional dependencies on RPM packages not installed, this command(smsupdatenode) will automatically install these dependencies.Installs the specified RPM packages. The absolute path is determined automatically by searching the directory structure.Removes the given RPM packages. Either the --deps or --nodeps flag must be provided before the list of packages to be removed (The option "Remove dependent RPMs" should be set --deps or --nodeps).Removes the dependent RPMS on the target nodes.Specify the path to use for remote commands. This can either point to rsh or to a secure shell executable. If not specified with flags, the remote shell defaults first to the value of the DSH_REMOTE_CMD environment variable, and then to the CSM RemoteShell attribute value (see the csmconfig command man page).Copy the distribution CD-ROMs corresponding to the given attributes or hostname to the correct /csminstall directory.Specify one or more directories, separated by colons, that contain copies of the distribution CD-ROMs. The default on a Linux Red Hat system is /mnt/cdrom. On a SuSE system, the default is /cdrom. On an AIX system, the default is /dev/cd0.Specify Attr=value pairs. The valid attributes are: InstallDistributionName, InstallDistributionVersion, and InstallPkgArchitecture.If a hostname is specified, the distribution CD-ROMs, and destination directory are determined by the node's attributes.Specifies verbose mode.Defines the devices in a CSM cluster.Changes device definitions in the CSM database.Removes device definitions from the CSM database.Lists the device definitions in the CSM database.Defines the device group definitions in the CSM database.Changes the device group definitions in the CSM database.Removes the device group definitions from the CSM database.Lists the device group definitions in the CSM database.Performs just a report instead of defining the devices into the CSM database.Creates device definitions in the CSM database.Forces updates to the existing definitions in CSM database. Modifies existing device definitions or creates new device definitions.Specify the device definition file name from which the device definitions will be created in the CSM database. A sample device definition file is supplied in /opt/csm/install/devicedef.sample.Specify the hostname mapping file from which the device definitions will be created in the CSM database.Specify the first or starting devices to be defined.When starting_device is supplied, this flag specifies the name of the first device to be added. A list of devices is generated by incrementing IP addresses up to the value specified by the the SMIT stanza 'Number of devices to define' value. When device_list is supplied, this specifies a comma or space -seperated list of device hostnames or IP addresses on which to run the command. Note: Multiple devices cannot be specified when using the csp PowerMethod.Specify how many devices to define.The IP addresses are determined by incrementing the starting device IP address by one.To use this flag devices must be defined with consecutive IP addresses and entered into the nameserver consecutively. The starting device name must be a resolvable host name and the StatusMethod attribute must be set to ping when using this flag.Specify the list of Console Servers. Multiple console server are separated by commas.Specify the list of hardware control points. Multiple hardware control point definitions are separated by commas.Writes the command's verbose messages to standard output.The StatusMethod is used to obtain the status of the device. The valid values are ping and NONE. If this attribute is set to NONE or is left undefined, no status checking will be performed, and the Status attribute will be set to 128 (UNCONFIGURED).The power method used to perform hardware control. The valid values for AIX are csp and hmc. The valid values for Linux are hmc, xseries, apc, blade and bmc. This attribute can be edited. This attribute must be defined to enable hardware control.The host name of the network adapter for the hardware control point. This attribute can be edited. This attribute must be defined to enable hardware control. For SP Nodes and p660 servers, it is the device specification of the tty port on the management server where the SP frame or p660 server is connected.Identifier associated with the device power control. This attribute can be edited. This attribute must be defined to enable hardware control. The value is dependent on the PowerMethod in use, and can be one of the following: * Text ID of the service processor for devices on xSeries servers. * LPAR name for devices on IBM HMC-attached pSeries servers. * APC MasterSwitch outlet port number. * APC MasterSwitch outlet port number.Optional device type information provided by the administrator to group devices. Can be used to create dynamic device groups by device type.The console method used to open a device console. This attribute can be edited. Valid values are: csp, hmc, mrv, els, computone, cps, blade, cyclades and esp.The host name of the network interface for the console server. It is optional when defining a resource. For SP Nodes and p660 servers, it is the device specification of the tty port on the management server where the SP frame or p660 server is connected.The number associated with the console port for this device.HWType is the optional hardware information provided by the administrator to identify this device.HWModel is the optional hardware information provided by the administrator to identify this device.HWSerialNum is the optional hardware information provided by the administrator to identify this device.Comments provided by the administrator about the device.Changes all the devices.Specify a comma or space-separated list of device names or IP addresses on which to run the command. Space-separated lists must be inside double quotes.Changes the devices that are in the device groups specified. The device group is evaluated by the hwdevgrp command. Multiple device groups can be specified within quotation marks and separated by commas or spaces.Specify a file that contains a list of device names. The file can contain multiple lines and each line can have one or more device names separated by spaces, commas, or both.Changes the devices that match the 'where' part of the select string. It is easiest to put the whole string in double quotation marks, especially if you need to put attribute values in single quotation marks (when they are strings). To specify all devices use a * instead of a selectstr value.Specify a comma or space-separated list of device names or IP addresses on which to run the command. Space-separated lists must be enclosed within double quotes.Removes the devices that are members of the device groups specified. The device group is evaluated by the hwdevgrp command. Multiple device groups can be specified using commas or spaces. A space-separated list requires quotation marks surrounding the string.Specify a file that contains a list of device names. The file can contain multiple lines, and each line can have one or more device names separated using commas or spaces.Displays the devices that are in the specified device group. The device group is evaluated by the hwdevgrp command.Displays the devices that match the where specification of the select string. Include the entire string within double quotation marks when single quotation marks are used to specify attribute values as strings. Specifying a where string of * indicates that all devices should be listed, as if a where string was not specified.Displays all attributes.Displays the specified attribute. Attributes must be separated by commas.Displays IP addresses.Displays the ping status of devices.Displays the short host name if the devices StatusMethod attribute is set to ping. Otherwise just displays the name as entered in the database.Displays output in long format.Displays output in a format suitable for redirecting into a devicedef file, which can then be used as input to the definehwdev -f command. This flag can be used to save the definition of one or more devices so that they can be restored at a later time.Sorts the output by the first attribute displayed in each row.Specify whether or not to display the name of the device at the beginning of each row that is returned.Specify the delimiter used to separate items within a row. The default is a comma-space. Rows should be separated by blank lines.Name of the device group to be created.List of devices which are going to be in the group.Displays the 'where' clause of the select string set for this device group.Specify a file that contains a list of groups to be defined. Each line of the file should contain the group name followed by a colon, then the following three fields separated by commas: type - static or dynamic, the validation setting - validated or not validated, and the definition of the group contents - a select string or the unexpanded member list.Specify if the names in the group represent generic names that do not have to be actual device names in the CSM cluster.Specify a device group to modify .Adds device names to a group specified . A device list consists of one or more comma-separated device names. To specify an existing device group to add to the group, use the + sign before the group name.List of devices to be removed from the specified group.Specify a device group to delete.Lists all defined device groups.Displays the expanded group member list of all groups.Displays the member list for the specified group.List the definition of all groups. Each line of output will represent one group and will display its name, the type (static or dynamic), the validation setting (-g), and the definition of the group contents (either a select string or the unexpanded member list).Displays all the static and dynamic group names that contain the device represented by the specified device name or IP address.Specifies to take the intersection of two groups entered and display the results.Subtracts the membership of the second group from the first group entered and displays the resulting members.Provides a snapshot of cluster node reachability, power status, and network interface status.Additional Hardware control commands like conserver, blade/xSeries, SP/Attached pSeries commands.Retrieves all adapter information from the specified node. While adapter discovery tests will still be limited to the nodes of the given type, all other adapters of any supported type will also be returned.Specify the type of MAC method to use to collect a MAC address. The supported methods are dsh, pxeboot, openfirmware, and hwstat. You can also specify your own MAC method.Creates or updates a stanza file listing adapter information. If a stanza file is found, the existing file will be updated.Turns verbose mode on. When you specify this option, tracing is turned on for the duration of the command. After the command is run, tracing is returned to its previous state.Sets the password on the specified node service processor, hardware control point.Restores the default user ID and password originally shipped with the hardware.Displays attribute Status information for all nodes.Specify a comma or space-separated list of node names to display attribute information. Space-separated node names must be inside double quotes.Specify a comma or space-separated list of node groups to display attribute information. Space-separated node groups must be inside double quotes.Returns LCD values for for SP Nodes, p660 servers, and HMC-attached pSeries servers.Specify, by column headers, which columns to display. Hostname is displayed by default. Other values include HWControlPoint, LCDS, Network-Interfaces, Status, PowerStatus and all.Specify delimiter-formatted output using the specified delimiter - colons, for example. Use this flag to specify a delimiter of one or more characters.Sorts output first by hardware control point and then by hostname.Commands to configure the Conserver Configuration File and refresh the Conserver Daemon(chrconsolecfg and rconsolerefresh).Commands to collect environmental/VPD and service processor log information from nodes (lshwstat and reventlog). Commands to collect and setting SNMP Agent configuration information for nodes (chsnmp and lssnmp).Configuring, Monitoring, Displaying, Collecting and Controling the SP frames/node commandsRemoves, adds, or rewrites console entries in the Conserver configuration file.The panel control will send a signal to the Conserver daemon, causing it to reread its configuration file and update its internal list of consoles. If the Conserver daemon is not running, it is started. The panel control will stop the current Conserver process and starts a new one.Rewrites the Conserver configuration file using all nodes in the CSM database.Rewrites the interfaces entry of the configuration file.Removes entries from the Conserver configuration file.Specify a comma or space-separated list of node host names, IP addresses, or node ranges on which to run the command. Space-separated lists must be inside double quotes.Specify the node groups to resolve the nodes to add to or remove from the Conserver configuration file.Reinitializes the rconsole daemon.When this option is set it stops the current Conserver process and starts a new one. Collects environmental and Vital Product Data (VPD) information from nodes on xSeries and BladeCenter servers. The panel will collect environmental and VPD information for the specified nodes on xSeries and BladeCenter servers. This uses the CSM database to determine the nodes and their service processor information. The host name used must be the name specified when defining the nodes in the CSM database. Collects service processor log information from nodes on xSeries and BladeCenter servers. This uses the CSM database to determine the nodes and their service processor information.The host name used must be the name specified when defining the nodes in the CSM database. Sets the SNMP agent configuration information for nodes on xSeries and BladeCenter servers. This uses the CSM database to determine the nodes and their service processor information.The host name used must be the name specified when defining the nodes in the CSM database. Collects SNMP agent configuration information from nodes on xSeries and BladeCenter servers. This uses the CSM database to determine the nodes and their service processor information.The host name used must be the name specified when defining the nodes in the CSM database.Runs the command on all nodes on xSeries and BladeCenter servers in the cluster.Returns information for the specified or all parameters. Parameters are provided in the list (F4=list).Returns the node ambient temperature.Returns the service processor's asset tag.Returns the speed of the installed CPUs in MHz.Returns current CPU temperatures.Returns current DASD temperatures.Returns the percentage of maximum speed that the fan is rotating.Returns the number of DIMMs installed.Returns the maximum number of DIMMs the node can support.Returns the total memory installed in the node.Returns the system model type.Returns the current power status.Returns the number of hours the system has been running since the last restart.Returns the number of times the system has been restarted.Returns the model serial number of the node.Returns the current node state.Returns all temperatures: cputemp, disktemp, ambtemp.Returns VRM, power supply, and system board voltages.Specifies one or more node groups on which to run the command.Runs the command on all nodes in the cluster.Reads all log entries, starting with the first entry.Reads all log entries, starting with the first entry, and then clears the log of all entries.Clears the service processor log of all entries.Reads the number of log entries specified, starting with the first.Specifies one or more comma-separated node groups on which to run the command.Sets the system contact name.Sets the defaults for the first community name to public and the first community address to the address of the management server.Sets the community addresses.Removes the community addresses.Sets the system location.Enables the SNMP agent.Disables the SNMP agent.Enables trap-directed notification.Disables trap-directed notification.Sets the event trigger.Clears the event trigger.Returns information for all parameters.Returns all community names.Returns all community addresses.Returns system contact name.Returns all enabled events.Returns SNMP traps state.Identifies available SP frame hardware control points (tty ports) and configures them for expansion I/O units. This ignores frame hardware control points that already have SP Nodes defined for them in CSM.Displays the configuration information for SP expansion I/O units (F/C 2055) to IBM POWER3 SMP High Nodes (model 9076-NH0, F/C 2054) and IBM 375 MHz POWER3 SMP High Nodes (model 9076-NH1, F/C 2058). This panel is intended for use only during initial server installation or for subsequent configuration changes for nodes and expansion I/O units.Controls the state of SP frames in the cluster. Provides power control for SP frames and microcode update support for SP frames, nodes, and expansion I/O units.Monitors the state of SP Nodes, SP frames, p660 servers, and expansion I/O units in the cluster.Administers the cspd daemon, which runs on the management server to monitor and control the SP Nodes and p660 servers. The operation operand specifies one of three supported administrative actions: cleard, clog, or setd. The daemon writes debugging information and specific error information to its log file. The daemon writes debugging information and specific error information to its log file, located in /var/log/csm/csp in the form cspdlogfile.nnn, where nnn is the Julian date on which the daemon opened the log file. The clog operation causes the daemon to close its current log file and create a new one using the name cspdlogfile.nnn, where nnn is the current Julian date. If this name already exists, a name of the form cspdlogfile.nnn_m is used, where m is a number that is selected to create a unique file name.Specify a comma-separated list of frames.Updates all IBM.ManagedNode::HWControlNodeId output with a list of the expansion I/O units attached.Specify a file name for writing command output.Specify the command to send to the hardware components.The device specification of the hardware control point of the SP frame. Only entries that specify a tty device are accepted.Specify a comma or space-separated list of node names or expansion I/O unit frame:slot specifications on which to perform the action. This flag is only valid on the basecode, boot_supervisor, and microcode commands.Specify node group or groups on which to perform the action. This option is only valid on the basecode, boot_supervisor, and microcode commands.Specifies verbose mode. The percentage of hardware components whose state matches the command is displayed at five-second intervals. The following are also displayed: * The number of components to which the command was sent. * A list of components that did not change state. * The number of components that are expected to change state. * The number of components that achieved the expected state. * The number of components to which the command was not sent. * A list of components to which the command was not sent.Displays information for all configured SP Nodes and p660 servers.Displays information for all configured SP Nodes, SP Frames, p660 servers, and expansion I/O units.Displays frame information for a specific hardware control point.Displays information for all hardware connected to the hardware control point.Displays only the current state information, and then exits.Displays the current state information prior to displaying the changed state.Limits output to that of the state variables that are specified in the list, a comma-separated list of symbolic variable names. This list must not contain blanks.Displays the the list of symbolic variable names and inidices.Displays the output in raw format.Displays the output in symbolic format.Displays information for the specified list of one or more comma-separated nodes.Displays information for the specified list of one or more comma-separated node groups.Displays a descriptive list of symbolic variable names and variable indexes, and then exits.Specify the administrative action to perform. The operation must be one of the following: * cleard:Unsets the daemon debugging flag that is specified by the -d flag in the daemon. You can specify multiple -d flags. If you do not specify a -d flag, the all debugging flag is assumed. * clog:Changes the daemon log file. If the log file is growing large, you can use this operation to cause the daemon to write to a new log file. * setd:Sets the daemon debugging flag that is specified by the -d flag in the daemon. You can specify multiple -d flags. If you do not specify a -d flag, the all debugging flag is assumed.Specifies the daemon debug flag to be set or unset in the daemon.Concurrently issues remote shell commands to multiple hosts and formats results. The panel (dsh) command invokes commands on a set of nodes concurrently. It issues a remote shell command concurrently for each node that is specified and returns the output from all the nodes, formatted so that command results from all nodes can be managed. /usr/bin/rsh is the model for syntax and security.Transfers files between the cluster management server and nodes. The panel (dcp) command runs scp or rcp or rsync to multiple nodes at the same time. The command relies on dsh as an underlying mechanism, therefore any options or environment variables that may affect the current operation are in effect. With dcp you can transfer files to and from the management server. When files are pulled from the node, they are placed into the directory specified as the target directory and the node name is appended to the file.Runs CSM cluster system diagnostics. The probemgr command is part of the CSM diagnostics infrastructure, which can be used by system administrators to determine the root cause of system problems. The probemgr command runs a set of small diagnostics programs called probes. Each probe provides diagnostics for a particular part of the system.Copies and stores vital CSM data. The panel (csmbackup) command copies vital CSM data from the management server and stores the data in the directory specified. The command backs up a CSM management server in case of a hardware problem, or if the management server is being changed to another machine.Restores CSM data backed up by the csmbackup command. The panel (csmrestore) command restores the files that were copied by the csmbackup command into the specified directory or the default directory /var/opt/csm/csmdata. The CSM management server must be completely installed and configured by the administrator in advance; the csmrestore command does not install any CSM code on the management server. The csmrestore command only restores the nodes, node groups, devices, devicegroups, conditions and responses, and condition and response associations on the management server.This HA CSM is yet to be done for future release.Specify a command to invoke on the node list. It is passed to the remote shell. This command is specified by using the remote shell command syntax.If set, the command will be executed on all the defined nodes in CSM database.Resolves one or more CSM node groups, separated by commas, and adds the nodes to the node list or working collective.Verifies a node before adding it to the node list. If a node is not responding, it is not included in the node list.Specify a remote user name under which to invoke the commands. If not specified, the remote user name is the same as the local user name.Specify a fanout value. The default value is 64. It indicates the maximum number of concurrent remote shell commands to issue. Sequential runs can be specified by indicating a fanout value of 1. The fanout value is taken from the DSH_FANOUT environment variable if not specified.Specify the time, in seconds, to wait for response from the remote shell. Overrides the value of the DSH_TIMEOUT environment variable.Specifies output in streaming mode. The output is unsorted, but performance is likely to improve, and memory utilization is reduced.Provides the full path of the remote shell that will be used to access the remote systems. The default remote shell is rsh.Forwards options for the remote shell. The information within the quotation marks is forwarded and included in the remote shell.Specifies the shell syntax to be used on the remote system.Prints the return code of the last command that was run remotely. The return code is appended at the end of the output for each node.Selecting this option runs dshbak which presents formatted output from the dsh command. The dshback command takes lines in the following format: host_name: line of output from the remote command.This option should be used only when the option "Filter/Format Output (dshbak)" is set to 'yes'. While formating the output with dshbak command this option collapses the identical output from more than one node so that it is displayed only once.Copies the files from the management server and places them in the target directory on the nodes if the entry field is kept as "TO". If the entry field is selected as "FROM", this copies files from the nodes to the management server.Specify the complete path name of the file to be copied to or from the node. For recursive option(-r), this is a directory. You can specify multiple files for transferring to nodes, but not for retrieving files from nodes.Copies to or from all nodes in the cluster.Forwards options to the remote copy command.Preserves the source file characteristics.Recursively copies to or from the management server.Specify the number of nodes to process in parallel. The default value is 64, which you may want to change depending on the size and number of files being transferred.Specifies to use rsync, assuming its location is /usr/bin.If specified , displays verbose message.Shows the dependencies and run order of the probes.The highest level of exit code, returned by a probe, that the probe manager permits before terminating. The default value is 10. 0 Success 10 Success with Attention messages 20 Failure 127 Internal error.Indicates the message output level. The default is 3, which indicates that Attention and Error messages must be reported by the probes. 0 Specifies that the probe manager message, probe trace messages, probe explanation and suggested action messages, probe attention messages, and probe error messages should be reported. 1 Specifies that the probe trace, probe explanation and suggested action messages, probe attention messages, and probe error messages should be reported. 2 Specifies that the probe explanation and suggested action messages, probe attention messages, and probe error messages should be reported. 3 Specifies that only the probe attention messages and probe error messages should be reported. 4 Specifies that only the show probe error messages should be reported.The directory where user-specific probes reside. The default probe directory (/opt/diagnostics/probes) is examined after the user-specified directory is examined. If there are duplicate nodes, the probes in the user-specified directory take precedence over the probes in the default directory.Generates a list of probes to exclude when creating the probe dependency tree. This also means that those probes will not be run.Specifies to run the probe indicated by probe_name and all its dependencies. If this option is not specified, all probes in the default probe directory (/opt/diagnostics/probes) and all probes in the user probe directory are run.Specify the directory where CSM backup data will be stored. If not specified, the data is stored in /var/opt/csm/csmdata.Specify a file that contains a list of additional CSM files to back up.Only the specified resource is backed up. This option is useful for registering ERRM event responses to only back up a specified resource class when a resource class changes. The resource value can be Sensor, EventResponse, Condition, Association, ManagedNode, NodeGroup, DeviceHwCtrl, DeviceGroup or DmsCtrl. Only ONE resource can be specified at a time.Writes verbose messages to standard output.Specify the directory from which to restore CSM backup data. Data in this directory should have been placed there by the csmbackup command.Forces the command to copy all required files from the pkg_path. Normally,copycsmpkgs only copies files that are newer or the same as those in /csminstall, or files that do not exist in /csminstall. This flag forces copycsmpkgs to copy all files regardless of their version.Top level panel for all CSM cluster interfaces. This leads to menus for CSM Install, Manage Cluster Data, CSM Hardware Control and Additional CSM commands.Perform the tasks that are necessary to configure the system as a CSM Management Server.Uninstall the CSM management server software.Update (or install) CSM software packages and CFM configuration files on the nodes of the cluster.Create NIM machine definitions corresponding to CSM cluster node definitions.Create NIM machine group definitions corresponding to CSM cluster node group definitions.Set up the CSM customization scripts so that they may be run by NIM on the cluster node during a base operating system installation.Top level NIM panel.Define nodes that will be managed by CSM.Change node definitions in the CSM database.Remove nodes from the CSM database.Manage node group definitions in the CSM database.Define node groups that will be managed by CSM.Change a node group in the CSM database.Remove node groups from the CSM database.Display verbose messages to standard output.Remove the nodes before uninstalling the management server (Issues 'rmnode' before uninstalling).Remove and clean up nodes before uninstalling the management server (Issues 'rmnode -u' before uninstalling).Comma separated list of cluster node group names to be setup.A list of node hostnames (or IP addresses) on which to run the command.Only report what would be done by the command. Do not perform any updates.List of options to forward to CFM. Options must be enclosed within double quotes.Comma separated list of cluster node group names to be setup.Either create the node definitions or just display them.Specifies the IP address or host name for the nodes to be added.The list of node definitions that would be created is displayed to standard out and is re-directed to this node definition file.Hostname of the management server machine as known by the managed node.Allow a request to manage the node (Normally it is not necessary to set this attribute).The current phase of the node's installation. The mode is automatically set by CSM installation tools to PreManaged, Installing, or Managed, depending on the phase of the node's installation. You can manually set the mode to MinManaged to indicate Minimally Managed nodes.Display the specified attributes (Comma separated list of attributes).A comma separated list of node names to add to the group.A comma separated list of node names to add to the group.A comma separated list of node names to remove from the group.Remove node groups.Selecting this menu option leads to menus for installing, configuring the management server, verifying the Management Server Installation, uninstalling the management server, updating CSM on the cluster nodes, copy additional CSM and related packages for Linux nodes, converting CSM to NIM nodes/groups, defining CSM nodes, the CSM setup of NIM, and the network installation manager.Selecting this menu option leads to menus for defining, modifying, removing and displaying CSM nodes/node groups and CSM devices/device groups, Update CSM and Configuration Files on the Cluster Nodes,Manage RPMs on Linux Cluster Nodes.Selecting this menu leads to options to define, modify, remove, or display CSM Cluster Nodes.Selecting this menu leads to options to define, modify, remove, or display CSM Cluster Node Groups.Specifies one or more nodegroups which will be expanded to a list of nodes which will perform a network boot.Controls remote power for Cluster Systems Management nodes, devices and CECs.Choose an Action: on -- power the node(s) on off -- power the node(s) off reboot -- reboot the node(s) resetsp_hcp -- reset the service processor for the Hardware Control Point(s) resetsp_host -- reset the service processor for the node(s) Specify a comma or space-separated list of node hostnames, IP addresses, or node ranges on which to run the command.Runs the command on all of the nodes in the cluster.Enter a comment (Must be in quotes).NIM groups are created or updated for all CSM groups.Specify whether or not to update existing NIM group definitions.If this option is specified and no group is given (or the 1st group is "*"), then the membership of all the groups is displayed.Specify a file that contains a list of groups to be defined. Each line of the file should contain the group name followed by a colon,then the following three fields separated by commas: type (static or dynamic), the validation setting (validated or not validated), and the definition of the group contents (either a select string or the unexpanded member list).The name of the distribution to be installed (Linux only).The machine architecture of the node to be installed (Linux only).The version of the kernel to be installed (Linux only).Display the member list for these groups.Specify one or more node groups on which to run the command.Discovers the first adapter that can reach the server.Specify the Ethernet network speed. This flag is not used for Token Ring or FDDI adapters.Specify Ethernet network duplex. This flag is not used for Token Ring or FDDI adapters.Specify the IP address or host name of the server to discover. The default is the management server.Specify the IP address or host name of the default gateway used to reach the server. The default is 0.0.0.0.Discovers all adapters that can reach the server.Specify the node groups to process.Specify the host name/IP address of the system where the ID resides.Specify the user name that will be defined.Install Management Server. Select the CSM filesets to be installed, from the next panels. Note: * Filesets csm.client, csm.core and csm.dsh are required if not installed yet. * Fileset csm.server must be selected. * Filesets csm.diagnostics, csm.gui.dcem and csm.gui.websm are optional.Sets the community names.Removes the community names.Specify the complete path of the directory or file where the file will be copied on the target machine. This must be a directory for a file transferred from a node. For files transferred to a node, the hostname of each target node will be appended to each file or directory.Specify a comma or space-seperated list of node groups to copy to or from. Space-seperated node names must be inside double quotes.Replaces the current group membership with the given list of nodes, creating the group if it does not exist yet. The same values for node_list are supported as for the -a flag. Note that you can also specify node ranges. See the noderange man page.The mode the CEC is powered on to. Valid choices are "full" for Full System Partition mode, and "lpar" for LPAR mode. This option is required when the "cec_on" action is given, and is only applicable to pSeries systems.Choose an Action: on -- power the node(s) on off -- power the node(s) off query -- Reports power status on the specified node(s) reboot -- reboot the node(s) resetsp_hcp -- reset the service processor for the Hardware Control Point(s) resetsp_host -- reset the service processor for the node(s) cec_on -- Powers on the CEC associated with the specified node. Applies to Hardware Management Console (HMC)-attached pSeries servers only cec_off -- Powers off the CEC associated with the specified node. Applies to Hardware Management Console (HMC)-attached pSeries servers only cec_query -- Returns the power status for the CEC associated with the specified node. Applies to Hardware Management Console (HMC)-attached pSeries servers onlySpecifies a comma or space-separated list of device names to list information about. Note that you cannot use the -d flag with the -a or -A flag.Specifies one or more device groups. Note that you cannot use the -D flag with the -a or -A flag.Runs the command on all hardware in the cluster, including node servers and hardware devices. Note that you cannot use the -A flag with the -a, -d, -D, -n, or -N flag.Creates the /csminstall subdirectories and copies the required files to the correct /csminstall subdirectories.Specify a comma separated list of authentication methods to setup on the node. Valid options are rsh, ssh, krb5, or hba. hba cannot be used in combination with ssh, krb5,or rsh. hba cannot be used with the -F, --cfm, --cfmoptions, -S, --sms, or --smsoptions flags. rsh sets up remote shell authentication by creating a root.rhosts file on the node when all these conditions are true: * csmconfig shows SetupRemoteShell=1 & RemoteShell=/.../rsh. * rsh using Kerberos is currently failing to the node. * rexec is enabled on the node. ssh exchanges the ssh public keys, when: * csmconfig shows SetupRemoteShell=1 & RemoteShell=/.../ssh. * ssh using Kerberos is currently failing to the node. krb5 updates the Kerberos Version 5 krb5.keytab file on the node with the host principal keytab if SetupKRB5 > 8. hba exchanges RSCT public keys between the node and the management server. When hba is selected you must trust your network at the time to insure that a rogue machine is not going to insert their public key in place of the real node public key.Shows attributes from the IBM.Host resource class on each node, instead of attributes from the IBM.ManagedNode resource class. The attributes from IBM.Host represent the actual values currently on the node. In some cases, the corresponding attributes in IBM.ManagedNode represent the value requested by the administrator.Replaces the current group membership with the given list of devices, creating the group if it does not exist yet. The same values for device_list are also supported for the -a flag.Sets the hostname field with the HWControlNodeId value, if resolvable.Runs the specified probes on all nodes in the CSM database.Specifies a comma or space-separated list of host names or node ranges on which to run the specified probes. Space-separated lists must be inside double quotes. See the noderange man page for information on node ranges.Specifies a comma or space-separated list of node groups on which to run the specified probes. Space-separated lists must be inside double quotes. The node groups are evaluated by the nodegrp command.Creates a remote console user_ID and password file. The -c flag generates a password file that the rconsole command uses when opening remote consoles on BladeCenter HS20-8832 and JS20-8842 blade servers. The systemid command must be run with the -c flag for each management module that controls blade servers requiring console access. The user ID and password must match a stored management module login profile having blade server remote console access rights granted. The name of the password file generated by the systemid command with the -c flag is the IP address of the management module, appended with _console. The -c flag is not required to open remote consoles on any other hardware.Removes the specified password file.Reports which Managed nodes are up-to-date by comparing the last CFM update time with the modification time of files in the /cfmroot directory. Only use this flag with the -q flag.Specifies the full path name of the remote copy command to be used by dcp. The default value will be used from csmconfig command.Queries and returns the fanout value and the remote host list. (Overrides other options.)Specifies the time, in seconds, to wait for a response from the remote copy command.Verifies that a node is reachable, using ping, before adding it to the node list of remote node host names, IP addresses, or node ranges.Displays the selected remote copy command.Disables output file writing for an instance of the command when used with the --reports flag or when the DSH_REPORTS_DIRECTORY is set. Reporting remains enabled. This flag is required when using reporting with the dshbak command.Informs the user that a node is not responding and prompts the user to decide whether the node should be included in the node list.Sets the reports directory for reporting. All output from each host is saved to individual output and error files and a report is generated. A unique subdirectory is created to hold the output files and the report for each instance of the command. The subdirectory name is created using the default unspecified or the string provided using the --reportName flag. An integer extension is added to the name to create a unique directory name. The flag overrides the DSH_REPORTS_DIRECTORY environment variable.Displays the current environment variable settings. For example, the list of nodes in the current node list or working collective file and the value of the DSH_FANOUT environment variable are displayed. Note: This flag must be specified by itself on the dsh command line. It cannot be used in conjunction with any other dsh flag or with the command parameter.Specifies to not export locale environment.Prints the results of monitoring for each node in the form of the starting and completion messages for each node.Sets the log file. Log entries are added for each instance of the dsh command. This flag overrides the DSH_LOG environment variable.Specifies that commands that were unsuccessful should continue to be sent to the remote nodes.ORDisplay Verbose Messages?Copy installation software packagesCopy packages from this locationForce installSetup all nodesList of nodesList of groupsUpdate all nodesUpdate all nodes in PreManaged modeUpdate all nodes in Managed modeUpdate this list of nodesUpdate the nodes in these groupsForce the updatesDisplay preview of updates but do not updateInstall or update CSM software packagesUpdate configuration filesOptions to pass to CFM. (Must be in quotes.)Convert all CSM groupsConvert these groups. (Comma separated list.)Update existing NIM groupsCreate node definitionsCreate definitions using this node definition stanza fileSpecify the first (or only) node to be defined.Number of nodes to defineList of console serversList of hardware control pointsCreate definitions using this hostname mapping fileUpdate the node after it has been definedDo cleanup on the nodesChange all the nodesList of nodes to changeFile containing list of nodes to changeChange the nodes that match this select stringList of node namesList of group namesSelect string "where" clauseFile containing list of nodesDisplay all attributesDisplay this list of attributesDisplay IP addressesDisplay output in long formatDisplay the ping status of nodesDisplay the short hostnameDisplay node name at beginning of each rowDelimiter used to separate itemsNew Group NameSelect StringFile containing list of groups to defineGroup names represent generic namesGroup to be acted onList of nodes to addList of nodes to removeName of group to removeDisplay the member list for these groupsList all defined node groups.List the definition of all groups.Display all node groups containing this node.Display the "where" select string for this node groupRemove and cleanup CSM cluster nodes before uninstallingNote: Unset an attribute by specifying as its new valueAdapter Type to AcquireDiscover Network Adapter?Network SpeedNetwork DuplexServer Hostname or IP addressGateway IP addressDiscover All Adapters?Adapter Information FilenamePerform Adapter Collection on All Nodes?Node ListNode GroupsEnter Adapter Information into CSM database?Output filenamePerform the network boot on all nodes?Perform on this list of nodesPerform on this list of nodegroupsActionNode ListNode GroupsUse All Nodes?Host Name / IP AddressUser IDPower MethodHardware Control PointFile nameNIM machine typeNIM network nameRing speedCable typePlatformNetboot kernelFile containing a list of cluster nodes.Display the member list for all groups.A file containing a list of node names.Install/update Linux RPMs.Options to pass to SMS. (Must be in quotes.)Exchange RSCT public keys?Display LCD Values?Add or update CSM cluster nodesName of stanza file to create or updateGather information for every adapter?Discover the first adapter that can be used to ping the management server?Discover all the adapters that can be used to ping the management server?Force a Broadcast Boot?Install Server Hostname or IP addressGateway IP addressUpdate configuration files (CFM option)Install/update Linux RPMs (SMS option)ForceForce updates to existing node definitionsNote: To list all nodes, leave above entries blankDisplay output in defnode formatDisplay output sorted by first attributeDisplay intersection of these two groupsDisplay members of a group not in a second groupAccept the CSM LicenseUpdate existing NIM group definitionsRing speed (required if token ring)Cable type (required if ethernet)List of device groupsGroup names represent generic device namesList of groups (comma seperated) OROptions to pass to CFM (Must be in quotes)Convert these groups (Comma separated list)Update existing NIM definitionsDefine nodes using this node definition fileDefine one or more nodes explicitlySuppress node password promptCreate node definitions (no = just display)Number of nodes to define or node listAllowManageRequestConsoleMethodConsoleServerNameConsoleServerNumberConsolePortNumHWControlPointHWControlNodeIdInstallCSMVersionInstallMethodInstallOSNameInstallDistributionNameInstallDistributionVersionInstallPkgArchitectureInstallKernelVersionInstallAdapterMacaddrInstallAdapterGatewayInstallAdapterTypeInstallAdapterSpeedInstallAdapterDuplexInstallDiskInstallDiskTypeLParIDManagementServerModePowerMethodSuppress Kerberos PW promptingUserCommentNote: Unset an attribute by specifying ("") as it's new valueDefine nodes using this hostname mapping fileChange nodes matching this select stringNew Node Group NameList of NodesGroup names represent generic node namesNode group to be acted onName of node group to removeList definition of all groupsList node groups containing this nodeGroup name represents generic namesDiscover the first adapter that can be used toping the management server?Discover all the adapters that can be used to pingthe management server?Method to use to obtain MAC addressGroup to be modifiedSet password on node service processor /hardware control pointRestore default userid and passwordDisplay current CSM version?Display current settings only? (name of attribute or "yes" for all)License: Try & BuyLicense: Full (pathname)Perform Additional Management Server ConfigurationCluster IDCluster Type/ModelRemote ShellSetup Remote Shell?AddUnrecognizedNodesRegSyncDelaySetupKRB5PowerStatusModeHeartbeatFrequencyHeartbeatSensitivityVerify Management Server InstallationRun probe for Management Server configurationCopy Additional CSM and related packages (Linux nodes)List of pathnames (colon-separated)Force the command to copy all required files from path?Update Configuration Files on the Cluster NodesDistribute to all nodesDistribute to nodes in this fileDistribute to this list of nodesDistribute to this list of groupsQuery cluster configuration file status onlyBackup existing config files on nodesReplace newer files on cluster nodesPerform binary comparison on filesSingle updated file to distribute (default all)Generate distfile but do not distributeRemote shell (optional)Number of nodes to update in parallel (fanout)Timeout period for completion (sec)Manage RPM's on Linux Cluster NodesDistribute to this list of groupsReport only - do not perform operationsQuery - display unique RPM'sQuery - display common RPM'sUpdate specific RPMSInclude dependency RPMsInstall these new RPMsRemove these existing RPMsRemove dependent RPMsCopy distribution CD images to /csminstallPathnames of images (colon-separated)Hostname or attributes for images to copyDefine CSM Cluster DevicesCreate device definitions (no = just display)Create definitions using this device definition stanza fileCreate definitions using this hostname mapping fileDefine one or more devices explicitlyNumber of devices to defineName of node groups to removeStatusMethodPowerMethodHWControlDeviceIdDeviceTypeHWTypeHWModelHWSerialNumModify CSM Cluster DevicesChange all the devicesList of devices to changeFile containing list of devices to changeChange the devices that match this select string Note: Unset an attribute by specifying ("") as it's new valueRemove CSM Cluster DevicesList of devicesFile containing list of devicesDisplay CSM Cluster DevicesList of device namesNote: To list all devices, leave above entries blankDisplay the ping status of devicesDisplay output in devicedef formatDisplay device name at beginning of each rowDefine CSM Device GroupsNew Device Group NameList of DevicesModify a CSM Device GroupDevice group to be acted onList of devices to addList of devices to removeRemove CSM Device GroupsName of device group to removeDisplay CSM Device GroupsList all defined device groupsList device groups containing this deviceDisplay "where" select string for this device groupCSM Cluster StatusDisplay status for all nodesNode GroupDisplay LCD/LED valuesSpecify the columns to displayOutput delimiterSort output by hardware control pointProcess entries in Conserver config fileRewrite config file using all CSM nodesRewrite config file interface entryRemove config file entriesRefresh Conserver DaemonEnd current process and start anotherCollect Environmental/VPD Information from NodesRun command on all xSeries/Blade nodesInformation to reportCollect Service Processor Log Information from NodesRead all log entriesRead all log entries and clear logClear all log entriesNumber of entries to readSet SNMP Agent Configuration Information for NodesSet system contact nameSet community name and first community addressSet community addressRemove community addressSet system location Enable SNMP AgentDisable SNMP AgentEnable trap-directed notificationDisable trap-directed notificationSet event triggerClear event triggerCollect SNMP Agent Configuration Information for NodesReturn informationConfigure SP frame hardware control points for I/O unitsList of frames to configureDisplay configuration information for I/O units and nodesUpdate output with I/O units attachedControl SP hardwareCommand to sendMonitor SP Nodes and FramesDisplay data for all nodes,serversDisplay for all nodes,servers,frames,I/O unitsDisplay frame information for hardware control pointDisplay information for all hardware connected to hardware control pointDisplay current stateDisplay current state prior to changed stateDisplay only the following state variable valuesDisplay list of symbolic variable names and indicesDisplay output in raw formatDisplay output in symbolic formatAdminister CSP daemonOperationDebug flag (optional)CSM Cluster Command (dsh)Command to executeExecute on all defined nodesNode ListVerify node reachability priorUserid to execute command withFanout valueTimeout valueStreaming mode for outputRemote shell pathRemote shell optionsRemote shell syntax to useAppend output with return codeFilter/Format Output (dshbak)Collapse identical dshbak outputCSM Cluster Copy (dcp)Copy TO or FROM Managed NodesSource file/directory to copyTarget file/directory for the copied filesCopy to/from all Cluster nodesOptions for copy operationPreserve source file attributesRecursively copy filesFanout (default=64)Use rsync for copyLogin (default=current login)CSM Probe ManagerDisplay dependencies and run orderExit code for termination probemgrMessage output levelDirectory containing user probesSpecific probes to excludeSpecific probe to executeBackup CSM DataDirectoryFilename containing additional filesSpecific resource to backupRestore CSM DataHA CSM(TBD)List all defined node groupsList the definition of all groupsDisplay all node groups containing this nodeDisplay "where" select string for this node groupRemove and cleanup CSM cluster nodes before uninstallingNote: Unset an attribute by specifying ("") as its new valueFile containing a list of cluster nodesDisplay the member list for all groupsA file containing a list of node namesInstall/update Linux RPMsOptions to pass to SMS (Must be in quotes)Number of nodes to defineSet community namesRemove community namesList of nodes to replace the group's current nodesCEC Startup ModeDevice ListDevice GroupsUse All Nodes and Devices?Copy files needed for node installList of authentication methods to be set on nodeDisplay attributes from IBM.Host resource classList of devices to replace the group's current devicesSet hostname field with 'HWControlNodeId' attributeExecute the specified probe(s) on all nodes?Display output in nodedef formatWrite console user_id and password?Remove the specified password fileList which nodes are up to date?Remote copy command (full path name)Display fanout value and node list?Timeout valueVerify node reachability prior?Display remote copy command?Suppress output file writingPrompt for non-responsive nodesReport output pathDisplay environment variable settingsExport locale settings to remote nodesMonitor command execution for each nodeLog file nameRetry unsuccessful command executionyes,nostandalone,dataless,disklesschrp,rspc,rs6kmp,upFROM,TOCluster System ManagementCSM InstallInstall the Management ServerUninstall the Management ServerUpdate CSM on the Cluster NodesConvert CSM to NIM NodesConvert CSM to NIM GroupsCSM Setup of NIMNetwork Installation ManagerManage Cluster DataCluster NodesDefine CSM Cluster NodesModify a CSM Cluster NodeRemove a CSM Cluster NodeDisplay CSM Cluster NodesCluster Node GroupsDefne a CSM Node GroupModify a CSM Node GroupRemove a CSM Node GroupDisplay CSM Node GroupsCSM Hardware ControlPower ControlGet Adapter InformationNetwork Boot NodeList Hardware InformationHardware Control Access InformationAdditional CSM CommandsConfigure the Management ServerVerify Management Server InstallationCopy Additional CSM and related packages (Linux nodes)Accept the CSM LicensePerform Additional Management Server ConfigurationUpdate Configuration Files on the Cluster NodesManage RPMs on Linux Cluster NodesCluster DevicesCluster Device GroupsModify CSM Cluster NodesRemove CSM Cluster NodesDefine CSM Node GroupsRemove CSM Node GroupsDefine CSM Cluster DevicesModify CSM Cluster DevicesRemove CSM Cluster DevicesDisplay CSM Cluster DevicesDefine CSM Device GroupsModify a CSM Device GroupRemove CSM Device GroupsDisplay CSM Devices GroupsCSM Cluster StatusAdditional H/W Control CommandsConserver CommandsxSeries/Blade CommandsSP/Attached pSeries CommandsProcess entries in Conserver config fileRefresh Conserver DaemonCollect Environmental/VPD Information from NodesCollect Service Processor Log Information from NodesSet SNMP Agent Configuration Information for NodesCollect SNMP Agent Configuration Information for NodesConfigure SP frame hardware control points for I/O unitsDisplay configuration information for I/O units and nodesControl SP hardwareMonitor SP Nodes and FramesAdminister CSP daemonCSM Cluster Command (dsh)CSM Cluster Copy (dcp)CSM Probe ManagerBackup CSM DataRestore CSM DataHA CSMCluster Systems ManagementDefine a CSM Node Groupe kk1PB$7u]*r@*r@*r@ ]./usr/sbin/rsct/trctmplts/_CLG.tpl/inst$# IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2001,2003 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Trace templates for component _CLG generated by cugentpl. 0 ">>Function '%s' entered." 1 ">>Function '%s' entered with parameters [%s]." 2 "<get_OSDefs(); } #-------------------------------------------------------------------------------- =head3 usage Notes: =cut #-------------------------------------------------------------------------------- sub usage { MessageUtils->message('I', 'IMsgcopycsmpkgsUsage'); exit 1; } #-------------------------------------------------------------------------------- =head3 getArgs Notes: =cut #-------------------------------------------------------------------------------- sub getArgs { my $pkgpath = ""; if (!getopts('p:cvVh')) { &usage; } $::command_line = $0; if ($::opt_h) { &usage } $::COPY_OPT_FLAG = $::opt_c; if ($::opt_v || $::opt_V) { if ($::opt_v) { $::VERBOSE = $::opt_v; } if ($::opt_V) { $::VERBOSE = $::opt_V; } } if ($::opt_p) { # Packages path $pkgpath = $::opt_p; } if (!($::opt_p)) { &usage; } # Handle attr=value arguments if (scalar(@ARGV) > 0) { foreach my $a (@ARGV) { # Note: we allow a null value my ($attr, $value) = $a =~ /^\s*(\S+?)\s*=\s*(\S*.*)$/; # mkrsrc-api needs something for the value if (!length($value)) { $value = "''"; } if (!defined($attr)) { MessageUtils->message('W', 'EMsgBAD_ATTR_VAL_FORM'); &usage; } my $found = 0; foreach my $va (@::COPY_VALID_ATTRS) { if ($attr eq $va) { # Put quotes around the value to protect spaces # or weird chars $::ATTRS{$va} = $value; $found = 1; } } if (!$found) { MessageUtils->message('E1', 'EMsgBAD_ATTR', $attr); } } } # verify the correctness of the attributes &checkattrs; @::PKGPATH = split(":", $pkgpath); foreach my $p (split(":", $pkgpath)) { #gather the subdirectories too push @::PKGPATH, (ServerUtils->returnSubdirectory($p)); } } #-------------------------------------------------------------------------------- =head3 checkattrs Notes: =cut #-------------------------------------------------------------------------------- sub checkattrs { #check if all the attributes are there, if not defined then get the #default from Management Server if (!($::ATTRS{'InstallOSName'})) { $::ATTRS{'InstallOSName'} = InstallUtils->get_OSName; } if (!($::ATTRS{'InstallCSMVersion'})) { $::ATTRS{'InstallCSMVersion'} = InstallUtils->get_CSMVersion("csm\.core"); } if (!($::ATTRS{'InstallDistributionName'})) { if (($::ATTRS{'InstallOSName'} eq "Linux") && ($::PLTFRM eq "Linux")) { $::ATTRS{'InstallDistributionName'} = InstallUtils->get_DistributionName; } elsif (($::ATTRS{'InstallOSName'} eq "Linux") && ($::PLTFRM eq "AIX")) { NodeUtils->message('E1', 'EMsgNoDistributionName'); } } if (!($::ATTRS{'InstallDistributionVersion'})) { if ((($::ATTRS{'InstallOSName'} eq "Linux") && ($::PLTFRM eq "Linux")) || (($::ATTRS{'InstallOSName'} eq "AIX") && ($::PLTFRM eq "AIX"))) { $::ATTRS{'InstallDistributionVersion'} = InstallUtils->get_DistributionVersion; } else { NodeUtils->message('E1', 'EMsgNoDistributionVersion'); } } if (!($::ATTRS{'InstallPkgArchitecture'})) { if (($::ATTRS{'InstallOSName'} eq "Linux") && ($::PLTFRM eq "Linux")) { $::ATTRS{'InstallPkgArchitecture'} = InstallUtils->get_PkgArchitecture; } elsif (($::ATTRS{'InstallOSName'} eq "Linux") && ($::PLTFRM eq "AIX")) { NodeUtils->message('E1', 'EMsgNoArch'); } } # check for the valid attributes if (length($::ATTRS{'InstallCSMVersion'}) == 0) { NodeUtils->message('E2', 'EMsgNO_CORE_COPY'); } if ($::ATTRS{'InstallOSName'} eq "Linux") { if ($::ATTRS{'InstallPkgArchitecture'} =~ /i.86/) #SSS { $::ATTRS{'InstallPkgArchitecture'} = "i386"; } my $temp_distro = $::ATTRS{'InstallDistributionName'} . " " . $::ATTRS{'InstallDistributionVersion'}; if (!grep(/^$temp_distro$/, @::VALID_DISTROS)) { NodeUtils->message('E', 'EMsgUNSUPPORTED_DISTRO', $temp_distro, join(', ', @::VALID_DISTROS)); } else { NodeUtils->message('V', 'IMsgDETECTED_DISTRO', $temp_distro); } if (!grep(/^$::ATTRS{'InstallCSMVersion'}$/, @::VALID_CSM_DISTROS)) { NodeUtils->message( 'E5', 'EMsgUNSUPPORTED_CSM_DISTRO', "CSM" . $::ATTRS{'InstallCSMVersion'}, join(', ', @::VALID_CSM_DISTROS) ); } else { NodeUtils->message( 'V', 'IMsgDETECTED_CSM_DISTRO', "CSM" . $::ATTRS{'InstallCSMVersion'} ); } $::DISTRO = $temp_distro; } elsif ($::ATTRS{'InstallOSName'} eq "AIX") { # copycsmpkgs will no longer be used to copy AIX files. If Linux nodes are being # managed from an AIX management server then the copycsmpkgs command will be used # to copy the Linux packages. NodeUtils->message('E', 'EMsgCopyingAIXpkgs'); exit 1; } else { NodeUtils->message("E2", 'EMsgINVALID_OSTYPE'); } } #-------------------------------------------------------------------------------- =head3 getPackageList Notes: =cut #-------------------------------------------------------------------------------- sub getPackageList { %::pkgdefs = InstallUtils->get_pkgdefs( $::ATTRS{'InstallOSName'}, $::ATTRS{'InstallDistributionName'}, $::ATTRS{'InstallDistributionVersion'}, $::ATTRS{'InstallPkgArchitecture'}, 'MgdNode', $::ATTRS{'InstallCSMVersion'} ); if ($::ATTRS{'InstallOSName'} eq "AIX") { $::osTypeVersion = $::ATTRS{'InstallOSName'} . $::ATTRS{'InstallDistributionVersion'}; $::INSTALLDIR = "/csminstall"; $::INSTALLDIR_CSM = $::INSTALLDIR . "/csm"; #/csminstall/csm $::INSTALLDIR_CSMVR = $::INSTALLDIR_CSM . "/" . $::ATTRS{'InstallCSMVersion'}; #/csminstall/csm/1.2/ $::INSTALLDIR_CSMVRBIN = $::INSTALLDIR_CSMVR . "/bin"; #/csminstall/csm/1.2/bin $::INSTALLDIR_OS = $::INSTALLDIR . "/" . $::ATTRS{'InstallOSName'}; #/csminstall/AIX $::INSTALLDIR_OSVER = $::INSTALLDIR_OS . "/" . $::ATTRS{InstallDistributionVersion}; #/csminstall/AIX/5.1 $::INSTALLDIR_OSCSM = $::INSTALLDIR_OS . "/csm"; #/csminstall/AIX/csm $::INSTALLDIR_CSMVER = $::INSTALLDIR_OSCSM . "/" . $::ATTRS{'InstallCSMVersion'}; #/csminstall/AIX/csm/1.2.0 $::INSTALLDIR_CSMBIN = $::INSTALLDIR_CSMVER . "/bin"; #/csminstall/AIX/csm/1.2.0/bin $::INSTALLDIR_CSMPKG = $::INSTALLDIR_CSMVER . "/packages"; #/csminstall/AIX/csm/1.2.0/packages $::INSTALLDIR_CSMRPM = $::INSTALLDIR_CSMPKG . "/rpms"; #/csminstall/AIX/csm/1.2.0/packages/rpms $::INSTALLDIR_CSMINSTLP = $::INSTALLDIR_CSMPKG . "/installp"; #/csminstall/AIX/csm/1.2.0/packages/installp # # create package lists # # List of Open Source Packages that are required on the node my @mgdnode_open_srcrpms = (@{$::pkgdefs{opensrc_prereqs}}); @::opensrc_rpm_prereqs = (@mgdnode_open_srcrpms); # Lists of packages that are part of each CSM component my @csm_client_packages = (@{$::pkgdefs{csm_packages}}); @::csm_packages = (@csm_client_packages); my @rsct_client_packages = (@{$::pkgdefs{rsct_packages}}); @::rsct_packages = (@rsct_client_packages); # Operating System Prereqs we need for Managed Nodes @::os_prereq = (@{$::pkgdefs{os_prereqs}}); } elsif ($::ATTRS{'InstallOSName'} eq "Linux") { $::osTypeVersion = $::ATTRS{'InstallOSName'} . $::ATTRS{'InstallDistributionName'} . $::ATTRS{'InstallDistributionVersion'}; $::INSTALLDIR = "/csminstall"; $::INSTALLDIR_CSM = $::INSTALLDIR . "/csm"; #/csminstall/csm $::INSTALLDIR_CSMVR = $::INSTALLDIR_CSM . "/" . $::ATTRS{InstallCSMVersion}; #/csminstall/csm/1.2/ $::INSTALLDIR_CSMVRBIN = $::INSTALLDIR_CSMVR . "/bin"; #/csminstall/csm/1.2/bin $::INSTALLDIR_OS = $::INSTALLDIR . "/" . $::ATTRS{"InstallOSName"} . "/" . $::ATTRS{'InstallDistributionName'}; #/csminstall/Linux/RedHat $::INSTALLDIR_OSVER = $::INSTALLDIR_OS . "/" . $::ATTRS{InstallDistributionVersion}; #/csminstall/Linux/RedHat/7.0 $::INSTALLDIR_OSVER_ARCH = $::INSTALLDIR_OSVER . "/" . $::ATTRS{ 'InstallPkgArchitecture'}; #/csminstall/Linux/Redhat/7.0/i386 $::INSTALLDIR_OSCSM = $::INSTALLDIR_OS . "/csm"; #/csminstall/Linux/RedHat/csm $::INSTALLDIR_CSMVER = $::INSTALLDIR_OSCSM . "/" . $::ATTRS{InstallCSMVersion}; #/csminstall/Linux/RedHat/csm/1.2.0 my $INSTALLDIR_OS_NAME = $::PREREQS_ATTR{DistributionName}; if ($::PREREQS_ATTR{DistributionName} =~ /RedHat/) { $INSTALLDIR_OS_NAME = "RedHat"; } $::INSTALLDIR_OS_NAME_RPMS = $::INSTALLDIR_OSVER_ARCH . "/" . $INSTALLDIR_OS_NAME . "/RPMS"; #/csminstall/Linux/RedHat/7.3/i386/RedHat/RPMS $::INSTALLDIR_CSMBIN = $::INSTALLDIR_CSMVER . "/bin"; #/csminstall/Linux/RedHat/csm/1.2.0/bin $::INSTALLDIR_CSMPKG = $::INSTALLDIR_CSMVER . "/packages"; #/csminstall/Linux/RedHat/csm/1.2.0/packages # # create package lists # # Lists of Open Source Packages that are required on the node my @mgdnode_open_srcrpms = (@{$::pkgdefs{opensrc_prereqs}}); @::opensrc_rpm_prereqs = (@mgdnode_open_srcrpms); # Lists of packages that are part of each CSM component my @csm_client_packages = (@{$::pkgdefs{csm_packages}}); @::csm_packages = (@csm_client_packages); my @rsct_client_packages = (@{$::pkgdefs{rsct_packages}}); @::rsct_packages = (@rsct_client_packages); # No need of director if the OS is AIX if ($::PLTFRM eq "Linux") { @::director_packages = (@{$::pkgdefs{director_packages}}); } else { @::director_packages = (); } # Operating System Prereqs for Managed Nodes @::os_prereq = (@{$::pkgdefs{os_prereqs}}); # get sis packages #if ( !($::ATTRS{'InstallPkgArchitecture'} =~ /ppc64/) ) #{ # if( $::DISTRO =~ /SLES/ || $::DISTRO =~ /SuSE/ ) # { # @::sis_packages = (@{$::pkgdefs{sis_packages}}); # } #} # Populate the version release of definition hash #foreach my $tmp_var_rpm (@::opensrc_rpm_prereqs, @::csm_packages, @::rsct_packages, @::director_packages, @::os_prereq, @::sis_packages) foreach my $tmp_var_rpm ( @::opensrc_rpm_prereqs, @::csm_packages, @::rsct_packages, @::director_packages, @::os_prereq ) { my ($my_version, $my_release) = split(/::/, InstallUtils->get_definition_version($tmp_var_rpm)); my @parts = split /-/, $tmp_var_rpm; my $basename = shift @parts; my $p; BNAME: while ($p = shift @parts) { if ($p !~ m/^\d/) { #if it doesn't start with a digit $basename .= "-$p"; } else { unshift @parts, $p; last BNAME; } } my $tmp_var1; my $my_rindex = rindex($basename, "*"); if ($my_rindex != -1) { $tmp_var1 = substr($basename, 0, rindex($basename, "*")); } else { $tmp_var1 = $basename; } $my_rindex = rindex($tmp_var1, "-"); if (($my_rindex + 1) == 0) { $basename = $tmp_var1; } elsif (($my_rindex + 1) == length($tmp_var1)) { $basename = substr($tmp_var1, 0, rindex($tmp_var1, "*")); } else { $basename = $tmp_var1; } $::PackageVersionName{$basename}{'Version'} = $my_version; $::PackageVersionName{$basename}{'Release'} = $my_release; $::PackageVersionName{$basename}{'FullName'} = $tmp_var_rpm; } } else { NodeUtils->message("E2", 'EMsgINVALID_OSTYPE'); } } #-------------------------------------------------------------------------------- =head3 create_directory_structure Notes: =cut #-------------------------------------------------------------------------------- sub create_directory_structure { NodeUtils->message('I', 'IMsgCreatingDirectories'); mkpath($::INSTALLDIR_CSMVRBIN, $::VERBOSE, 0755); mkpath($::INSTALLDIR_CSMBIN, $::VERBOSE, 0755); mkpath($::INSTALLDIR_CSMPKG, $::VERBOSE, 0755); if ($::ATTRS{'InstallOSName'} eq "AIX") { mkpath($::INSTALLDIR_CSMRPM, $::VERBOSE, 0755); mkpath($::INSTALLDIR_CSMINSTLP, $::VERBOSE, 0755); } elsif ($::ATTRS{'InstallOSName'} eq "Linux") { InstallUtils->createRPMSdir( $::ATTRS{'InstallOSName'}, $::ATTRS{'InstallDistributionName'}, $::ATTRS{'InstallDistributionVersion'}, $::ATTRS{'InstallPkgArchitecture'} ); } else { NodeUtils->message('E2', 'EMsgINVALID_OSTYPE'); } } #-------------------------------------------------------------------------------- =head3 Main =cut #-------------------------------------------------------------------------------- { # main # initialize runtime env &initialize; # Check the arguments &getArgs; # get the packege list that needs to be copied &getPackageList; #Create the destination directories &create_directory_structure; # get version/release of rpms in /csminstall InstallUtils->get_csminstall_pathVersion(); # Copy the packages to the destination directories # find rpms in the -p flag paths InstallUtils->search_csm(); InstallUtils->search_opensrc_prereqs(); # handle force copy flag if ($::COPY_OPT_FLAG) { if (scalar(@::RpmsNotFoundInCmdPath) >= 1) { NodeUtils->message('E1', 'EMsgNoRpmFound', join(", ", @::RpmsNotFoundInCmdPath)); } else { InstallUtils->create_rpm_list_to_copy(); if (scalar(@::Rpms_not_found) >= 1) { NodeUtils->message('E1', 'EMsgNoRpmFound', join(", ", @::Rpms_not_found)); } else { NodeUtils->message('I', 'IMsgCopyingRpms', "CSM, RSCT, Director and Open Source"); ArchiveUtils->copy_rpm(); ServerUtils->post_csm_copy(); } } } else { InstallUtils->create_rpm_list_to_copy(); if (scalar(@::Rpms_not_found) >= 1) { #check for the rpms to be ignored my @rpm_ignored = (); my @rpm_not_ignored = (); foreach my $rpm_name (@::Rpms_not_found) { if ( ($rpm_name =~ m/autoupdate/) || ($rpm_name =~ m/perl-libnet/) || ($rpm_name =~ m/perl-DBI/) || ($rpm_name =~ m/perl-XML-Parser/) || ($rpm_name =~ m/perl-XML-Simple/) || ($rpm_name =~ m/fping/)) { push(@rpm_ignored, $rpm_name); } else { push(@rpm_not_ignored, $rpm_name); } } @::Rpms_not_found = @rpm_not_ignored; if (scalar(@rpm_ignored) >= 1) { NodeUtils->message('I', 'IMsgMissingRPM', join(", ", @rpm_ignored)); } if (scalar(@::Rpms_not_found) > 0) { NodeUtils->message('E1', 'EMsgNoRpmFound', join(", ", @::Rpms_not_found)); } NodeUtils->message('I', 'IMsgCopyingRpms', "CSM, RSCT, Director and Open Source"); ArchiveUtils->copy_rpm(); ServerUtils->post_csm_copy(); } else { NodeUtils->message('I', 'IMsgCopyingRpms', "CSM, RSCT, Director and Open Source"); ArchiveUtils->copy_rpm(); ServerUtils->post_csm_copy(); } } #Search for the distro rpms InstallUtils->search_copy_distro_rpms(); # Copy the 'binaries' needed for install to /csminstall/csm # We need to copy the binaries here in copycsmpkgs as well as in installms # because in a mixed-architecture Linux cluster (xLinux and pLinux), installms # would have only copied the binaries for the management server's architecture. # MessageUtils->message('I', 'IMsgCOPYING_CSMBINARIES'); ServerUtils->copyBinaries( $::ATTRS{'InstallOSName'}, $::ATTRS{'InstallDistributionName'}, $::ATTRS{'InstallDistributionVersion'}, $::ATTRS{'InstallPkgArchitecture'}, $::ATTRS{'InstallCSMVersion'}, ); exit 0; #if( $::DISTRO =~ /SLES/ || $::DISTRO =~/SuSE/ ) { # ©_sis_rpms; #} } # main ------- k.n0PB7uq@q@q@ ./opt/csm/bin/csmcorecfg_defau#!/usr/bin/ksh # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2001,2003 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG mkdir -p /var/log/csm exit 0 na kNXp0PB7uq@q@q@ ./opt/csm/bin/csmcoreuncfgdefau#! /bin/ksh # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2001,2003 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG rm -rf /var/log/csm #/opt/csm/bin/cfmuninst k\r0PB7uBq@Bq@Bq@ ./opt/csm/bin/installms#!/usr/bin/perl # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2000,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # @(#)80 1.28.1.217 src/csm/install/installms.perl, setup, csm_rveg, rveg0414a 3/21/04 11:36:52 #-------------------------------------------------------------------------------- =head1 installms.perl Installs CSM on Linux managment servers Notes: AIX code removed =cut #-------------------------------------------------------------------------------- =head3 File header Notes: file header gathers pkgdefs values. =cut #-------------------------------------------------------------------------------- use strict; BEGIN { $::csmpm = $ENV{'CSM_PM'} ? $ENV{'CSM_PM'} : '/opt/csm/pm'; } use lib $::csmpm; use File::Path; # Provides mkpath(); use FindBin qw($Bin); use lib "$Bin"; use Getopt::Std; use NodeUtils; use CSMDefs; use InstallUtils; $::MSGCAT = 'csmInstall.cat'; $::MSGMAPPATH = $ENV{'CSM_MSGMAPS'} ? $ENV{'CSM_MSGMAPS'} : '/opt/csm/msgmaps'; $::MSGSET = 'csminstall'; #-------------------------------------------------------------------------------- =head3 initialize initializes globals from package defs =cut #-------------------------------------------------------------------------------- sub initialize { # 0 = tftp server rpm not installed. $::default_tftp_server_installed = 0; $::command_line; $::COPY_OPT_FLAG; %::PackageVersionName = (); %::PackageVersionName_Server = (); %::PackageVersionName_Node = (); %::PathVersionName = (); %::CmdLinePathVersionName = (); %::temp_CmdLinePathVersionName = (); @::RpmsNotFoundInCmdPath = (); @::Rpms_to_be_copied = (); @::Rpms_not_found = (); # OS Definitions my %OSDefs = ServerUtils->get_OSDefs(); $::PREREQS_ATTR{'OSName'} = NodeUtils->get_OSName; my $OSName = $::PREREQS_ATTR{'OSName'}; # NLS hack if ($ENV{LANG} =~ /^(C|POSIX|en_US)/) { $::ENGLISH = 1; } # installms is not supported on AIX management servers if ($OSName eq "AIX") { NodeUtils->message('E', 'EMsgAIXandInstallms'); exit 1; } # processor $::PREREQS_ATTR{'PkgArchitecture'} = NodeUtils->get_PkgArchitecture; if ($::PREREQS_ATTR{'PkgArchitecture'} =~ /i.86/) { $::PREREQS_ATTR{'PkgArchitecture'} = "i386"; } # CSM version $::PREREQS_ATTR{'CsmCoreVersion'} = NodeUtils->get_CSMVersion("csm\.core"); if (length($::PREREQS_ATTR{'CsmCoreVersion'}) == 0) { NodeUtils->message('E2', 'EMsgNO_CORE'); } @::VALID_ATTRS = ("RemoteShell", "SetupRemoteShell"); $::PREREQS_ATTR{'DistributionName'} = NodeUtils->get_DistributionName; $::PREREQS_ATTR{'DistributionVersion'} = NodeUtils->get_DistributionVersion; # Pacakge Defines # management server %::Svrpkgdefs = ServerUtils->get_pkgdefs( $::PREREQS_ATTR{'OSName'}, $::PREREQS_ATTR{'DistributionName'}, $::PREREQS_ATTR{'DistributionVersion'}, $::PREREQS_ATTR{'PkgArchitecture'}, "MgmtServer", $::PREREQS_ATTR{'CsmCoreVersion'} ); # managed node %::Nodepkgdefs = ServerUtils->get_pkgdefs( $::PREREQS_ATTR{'OSName'}, $::PREREQS_ATTR{'DistributionName'}, $::PREREQS_ATTR{'DistributionVersion'}, $::PREREQS_ATTR{'PkgArchitecture'}, "MgdNode", $::PREREQS_ATTR{'CsmCoreVersion'} ); # version/release hash for Server and Node package list foreach my $k (keys %::Svrpkgdefs) { if ( ($k eq "director_packages") || ($k eq "opensrc_prereqs") || ($k eq "csm_packages") || ($k eq "os_prereqs") || ($k eq "rsct_packages")) { @::tmp_var_array = (@{$::Svrpkgdefs{$k}}); foreach my $tmp_var_rpm (@::tmp_var_array) { my ($my_version, $my_release) = split(/::/, ArchiveUtils->get_definition_version($tmp_var_rpm)); my @parts = split /-/, $tmp_var_rpm; my $basename = shift @parts; my $p; BNAME: while ($p = shift @parts) # this sucks { if ($p !~ m/^\d/) { #if it doesn't start with a digit $basename .= "-$p"; } else { unshift @parts, $p; last BNAME; } } my $tmp_var1; my $my_rindex = rindex($basename, "*"); if ($my_rindex != -1) { $tmp_var1 = substr($basename, 0, rindex($basename, "*")); } else { $tmp_var1 = $basename; } $my_rindex = rindex($tmp_var1, "-"); if (($my_rindex + 1) == 0) { $basename = $tmp_var1; } elsif (($my_rindex + 1) == length($tmp_var1)) { $basename = substr($tmp_var1, 0, rindex($tmp_var1, "*")); } else { $basename = $tmp_var1; } $::PackageVersionName_Server{$basename}{'Version'} = $my_version; $::PackageVersionName_Server{$basename}{'Release'} = $my_release; $::PackageVersionName_Server{$basename}{'FullName'} = $tmp_var_rpm; } } } foreach my $k (keys %::Nodepkgdefs) { if ( ($k eq "director_packages") || ($k eq "opensrc_prereqs") || ($k eq "csm_packages") || ($k eq "os_prereqs") || ($k eq "rsct_packages")) { @::tmp_var_array = (@{$::Nodepkgdefs{$k}}); foreach my $tmp_var_rpm (@::tmp_var_array) { my ($my_version, $my_release) = split(/::/, ArchiveUtils->get_definition_version($tmp_var_rpm)); my @parts = split /-/, $tmp_var_rpm; my $basename = shift @parts; my $p; BNAME: while ($p = shift @parts) { if ($p !~ m/^\d/) { #if it doesn't start with a digit $basename .= "-$p"; } else { unshift @parts, $p; last BNAME; } } my $tmp_var1; my $my_rindex = rindex($basename, "*"); if ($my_rindex != -1) { $tmp_var1 = substr($basename, 0, rindex($basename, "*")); } else { $tmp_var1 = $basename; } $my_rindex = rindex($tmp_var1, "-"); if (($my_rindex + 1) == 0) { $basename = $tmp_var1; } elsif (($my_rindex + 1) == length($tmp_var1)) { $basename = substr($tmp_var1, 0, rindex($tmp_var1, "*")); } else { $basename = $tmp_var1; } $::PackageVersionName_Node{$basename}{"Version"} = $my_version; $::PackageVersionName_Node{$basename}{"Release"} = $my_release; $::PackageVersionName_Node{$basename}{"FullName"} = $tmp_var_rpm; } } } } #-------------------------------------------------------------------------------- =head3 set_variables =cut #-------------------------------------------------------------------------------- sub set_variables { # installms only runs on Linux systems my $OSName = $::PREREQS_ATTR{'OSName'}; if ($OSName ne "Linux") { # should never get here NodeUtils->message("E2", 'EMsgINVALID_OSTYPE'); } my $temp_distro = $::PREREQS_ATTR{'DistributionName'} . " " . $::PREREQS_ATTR{'DistributionVersion'}; if (!grep(/^$temp_distro$/, @::VALID_DISTROS)) { NodeUtils->message('W', 'EMsgUNSUPPORTED_DISTRO', $temp_distro, join(', ', @::VALID_DISTROS)); } else { NodeUtils->message('V', 'IMsgDETECTED_DISTRO', $temp_distro); } if (!grep(/^$::PREREQS_ATTR{'CsmCoreVersion'}$/, @::VALID_CSM_DISTROS)) { NodeUtils->message( 'E5', 'EMsgUNSUPPORTED_CSM_DISTRO', "CSM" . $::PREREQS_ATTR{'CsmCoreVersion'}, join(', ', @::VALID_CSM_DISTROS) ); } else { NodeUtils->message('V', 'IMsgDETECTED_CSM_DISTRO', "CSM" . $::PREREQS_ATTR{'CsmCoreVersion'}); } $::PREREQS_ATTR{'OSTypeVer'} = $::PREREQS_ATTR{'OSName'} . $::PREREQS_ATTR{'DistributionName'} . $::PREREQS_ATTR{'DistributionVersion'}; # installation path $::INSTALLDIR = "/csminstall"; $::INSTALLDIR_CSM = $::INSTALLDIR . "/csm"; $::INSTALLDIR_CSMVR = $::INSTALLDIR_CSM . "/" . $::PREREQS_ATTR{CsmCoreVersion}; $::INSTALLDIR_CSMVRBIN = $::INSTALLDIR_CSMVR . "/bin"; $::INSTALLDIR_OS = $::INSTALLDIR . "/" . $::PREREQS_ATTR{"OSName"} . "/" . $::PREREQS_ATTR{'DistributionName'}; $::INSTALLDIR_OSVER = $::INSTALLDIR_OS . "/" . $::PREREQS_ATTR{DistributionVersion}; $::INSTALLDIR_OSVER_ARCH = $::INSTALLDIR_OSVER . "/" . $::PREREQS_ATTR{'PkgArchitecture'}; $::INSTALLDIR_OSCSM = $::INSTALLDIR_OS . "/csm"; $::INSTALLDIR_CSMVER = $::INSTALLDIR_OSCSM . "/" . $::PREREQS_ATTR{CsmCoreVersion}; my $INSTALLDIR_OS_NAME = $::PREREQS_ATTR{DistributionName}; if ($::PREREQS_ATTR{DistributionName} =~ /RedHat/) { $INSTALLDIR_OS_NAME = "RedHat"; } $::INSTALLDIR_OS_NAME_RPMS = $::INSTALLDIR_OSVER_ARCH . "/" . $INSTALLDIR_OS_NAME . "/RPMS"; $::INSTALLDIR_CSMBIN = $::INSTALLDIR_CSMVER . "/bin"; $::INSTALLDIR_CSMPKG = $::INSTALLDIR_CSMVER . "/packages"; # package lists # open source rpm prereqs @::mgmtserver_open_srcrpms = (@{$::Svrpkgdefs{opensrc_prereqs}}); @::mdgnode_open_srcrpms = (@{$::Nodepkgdefs{opensrc_prereqs}}); @::opensrc_rpm_prereqs = (@::mgmtserver_open_srcrpms, @::mdgnode_open_srcrpms); @::opensrc_rpm_prereqs = ServerUtils->get_uniqu_arry_elemnts(@::opensrc_rpm_prereqs); # csm packages @::mgmtserver_csm_packages = (@{$::Svrpkgdefs{csm_packages}}); @::mdgnode_csm_packages = (@{$::Nodepkgdefs{csm_packages}}); @::csm_packages = (@::mgmtserver_csm_packages, @::mdgnode_csm_packages); @::csm_packages = ServerUtils->get_uniqu_arry_elemnts(@::csm_packages); # rsct packages @::mgmtserver_rsct_packages = (@{$::Svrpkgdefs{rsct_packages}}); @::mdgnode_rsct_packages = (@{$::Nodepkgdefs{rsct_packages}}); @::rsct_packages = (@::mgmtserver_rsct_packages, @::mdgnode_rsct_packages); @::rsct_packages = ServerUtils->get_uniqu_arry_elemnts(@::rsct_packages); # director packages @::director_packages = (@{$::Svrpkgdefs{director_packages}}); # operating system prereqs @::mgmtserver_os_prereq = (@{$::Svrpkgdefs{os_prereqs}}); @::mdgnode_os_prereq = (@{$::Nodepkgdefs{os_prereqs}}); @::os_prereq = (@::mgmtserver_os_prereq, @::mdgnode_os_prereq); @::os_prereq = ServerUtils->get_uniqu_arry_elemnts(@::os_prereq); # get sis packages #if( ($::DISTRO =~ /SLES/ || $::DISTRO =~/SuSE/ ) && $::PREREQS_ATTR{'PkgArchitecture'}=~/i?86/ ) #{ #@::mgmtserver_sis_packages = (@{$::Svrpkgdefs{sis_packages}}); #@::mdgnode_sis_packages = (@{$::Nodepkgdefs{sis_packages}}); #@::sis_packages = (@::mgmtserver_sis_packages, @::mdgnode_sis_packages); #@::sis_packages = ServerUtils->get_uniqu_arry_elemnts(@::sis_packages); #} # CSM binaries copied to /csminstall/csm directory @::csm_bin_file_csm = (@{$::Svrpkgdefs{csm_bin_copy_csm}}); # CSM binaries copied to /tftpboot directory @::csm_bin_file_tftpboot = (@{$::Svrpkgdefs{csm_bin_copy_tftpboot}}); # default csm tftp server @::default_tftp_server_name = (@{$::Svrpkgdefs{default_tftp_server_pkg_name}}); # Populate the version release of definition hash foreach my $tmp_var_rpm (@::opensrc_rpm_prereqs, @::csm_packages, @::rsct_packages, @::director_packages, @::os_prereq) { my ($my_version, $my_release) = split(/::/, ArchiveUtils->get_definition_version($tmp_var_rpm)); my @parts = split /-/, $tmp_var_rpm; my $basename = shift @parts; my $p; BNAME: while ($p = shift @parts) { if ($p !~ m/^\d/) { #if it doesn't start with a digit $basename .= "-$p"; } else { unshift @parts, $p; last BNAME; } } my $tmp_var1; my $my_rindex = rindex($basename, "*"); if ($my_rindex != -1) { $tmp_var1 = substr($basename, 0, rindex($basename, "*")); } else { $tmp_var1 = $basename; } $my_rindex = rindex($tmp_var1, "-"); if (($my_rindex + 1) == 0) { $basename = $tmp_var1; } elsif (($my_rindex + 1) == length($tmp_var1)) { $basename = substr($tmp_var1, 0, rindex($tmp_var1, "*")); } else { $basename = $tmp_var1; } $::PackageVersionName{$basename}{'Version'} = $my_version; $::PackageVersionName{$basename}{'Release'} = $my_release; $::PackageVersionName{$basename}{'FullName'} = $tmp_var_rpm; } } #-------------------------------------------------------------------------------- =head3 usage Notes: =cut #-------------------------------------------------------------------------------- sub usage { NodeUtils->message('I', 'IMsginstallmsUsage', join(' ', @::VALID_ATTRS)); exit 1; } #-------------------------------------------------------------------------------- =head3 getArgs Notes: =cut #-------------------------------------------------------------------------------- sub getArgs { my @command_line = (); @command_line = @ARGV; $::command_line = $0 . " " . join(" ", @command_line); my $my_dir = NodeUtils->runcmd("pwd"); chomp($my_dir); if ($my_dir =~ /$::MNTCDROM/) { NodeUtils->message('E1', 'IMsgCHANGE_TO_NON_CDROM_DRIVE', $my_dir); exit 1; } my $pkgpath = ""; if (!getopts('p:cfxvVh')) { &usage; } if ($::opt_h) { &usage } $::DONT_COPY_RPMS = $::opt_x; $::FORCE_INSTALL = $::opt_f; $::COPY_OPT_FLAG = $::opt_c; if ($::opt_v || $::opt_V) { if ($::opt_v) { $::VERBOSE = $::opt_v; } if ($::opt_V) { $::VERBOSE = $::opt_V; } } if ($::opt_x && $::opt_p) { &usage; } if (!($::opt_p ^ $::opt_x)) { &usage; } # Packages path if ($::opt_p) { $pkgpath = $::opt_p; } # Handle attr=value arguments if (scalar(@ARGV) > 0) { foreach my $a (@ARGV) { # allow a null attr values my ($attr, $value) = $a =~ /^\s*(\S+?)\s*=\s*(\S*.*)$/; if (!length($value)) { $value = "''"; } if (!defined($attr)) { NodeUtils->message('W', 'EMsgBAD_ATTR_VAL_FORM'); &usage; } my $found = 0; foreach my $va (@::VALID_ATTRS) { if ($attr =~ /^$va$/i) { # Put quotes around the value to protect spaces # or weird chars $::ATTRS{$va} = $value; # Quotes mess up some values $found = 1; } } if (!$found) { NodeUtils->message('E', 'EMsgBAD_ATTR', $attr); NodeUtils->message('I', 'IMsgVALID_ATTRS', join('\n\t', @::VALID_ATTRS)); exit 1; } } } # Validate attributes and flags my $distro = $::PREREQS_ATTR{'DistributionName'} . " " . $::PREREQS_ATTR{'DistributionVersion'}; if (!grep(/^$distro$/, @::VALID_DISTROS)) { NodeUtils->message('W', 'EMsgUNSUPPORTED_DISTRO', $distro, join(', ', @::VALID_DISTROS)); } else { NodeUtils->message('V', 'IMsgDETECTED_DISTRO', $distro); } $::DISTRO = $distro; @::PKGPATH = split(":", $pkgpath); # Gather the subdirectories foreach my $p (split(":", $pkgpath)) { push @::PKGPATH, (ServerUtils->returnSubdirectory($p)); } } #-------------------------------------------------------------------------------- =head3 process_IBMJava Notes: Special processing for IBMJava. If IBMJava2-SDK is already installed on the system then don't install IBMJava2-JRE rpm. Note that the $rpm variable contains the JRE version number at the end. This ensures that we always use the correct version. version numbers are hard-coded in this routine =cut #-------------------------------------------------------------------------------- sub process_IBMJava { my ($rpm, $my_location, $my_fullname) = @_; my $SDK_rpm; my $high_version_flag = 0; my $already_installed_flag = 0; my $update_flag = 0; my $packager_name_flag = 0; my $already_installed_name; my ($name, $version, $release, $arch, $packager_name); my $my_version = $::PackageVersionName_Server{$rpm}{'Version'}; #if ($my_fullname=~/IBMJava2-JRE-(\d\.\d*\.\d*)/) { # $my_version=$1; #} else { # $my_version="1.4.1"; #default 1.4.1 #} ($SDK_rpm = $rpm) =~ s/IBMJava2-JRE/IBMJava2-SDK/; my @outout = NodeUtils->runcmd( "$::RPMCMD -q --qf '%{Name}::%{Version}::%{Release}::%{Arch}::%{Vendor}\n' $rpm", -1 ); foreach my $i (@outout) { if (!($i =~ /.*::.*::.*::.*::.*/)) { next; } ($name, $version, $release, $arch, $packager_name) = split(/::/, $i); if (ArchiveUtils->testVersion($version, ">", $my_version)) { $high_version_flag = 1; $already_installed_name = $name . "-" . $version . "-" . $release; } elsif (ArchiveUtils->testVersion($version, "=", $my_version)) { $already_installed_flag = 1; } elsif (ArchiveUtils->testVersion($version, "<", $my_version)) { $update_flag = 1; } if ( ($packager_name !~ /International Business Machines/) && ($packager_name !~ /UnitedLinux/)) { $packager_name_flag = 1; } } @outout = NodeUtils->runcmd( "$::RPMCMD -q --qf '%{Name}::%{Version}::%{Release}::%{Arch}::%{Vendor}\n' $SDK_rpm", -1 ); foreach my $i (@outout) { if (!($i =~ /.*::.*::.*::.*::.*/)) { next; } ($name, $version, $release, $arch, $packager_name) = split(/::/, $i); if (ArchiveUtils->testVersion($version, ">", $my_version)) { $high_version_flag = 1; $already_installed_name = $name . "-" . $version . "-" . $release; } elsif (ArchiveUtils->testVersion($version, "=", $my_version)) { $already_installed_flag = 1; } elsif (ArchiveUtils->testVersion($version, "<", $my_version)) { $update_flag = 1; } if ( ($packager_name !~ /International Business Machines/) && ($packager_name !~ /UnitedLinux/)) { $packager_name_flag = 1; } } # check for packager name flag for already installed rpm if ($packager_name_flag == 1) { NodeUtils->message('E1', 'EMsgUnsupportedRpmName', $rpm, $packager_name, $rpm); } @outout = NodeUtils->runcmd( "$::RPMCMD -qp --qf '%{Name}::%{Version}::%{Release}::%{Arch}::%{Vendor}\n' $my_location/$my_fullname", -1 ); foreach my $i (@outout) { if (!($i =~ /.*::.*::.*::.*::.*/)) { next; } ($name, $version, $release, $arch, $packager_name) = split(/::/, $i); if ( ($packager_name !~ /International Business Machines/) && ($packager_name !~ /UnitedLinux/)) { $packager_name_flag = 1; } if (ArchiveUtils->testVersion($version, ">", $my_version)) { NodeUtils->message('E1', 'EMsgNoRpmFound', $name); } } # return 2 = already installed # return 1 = higher version installed, install with the --oldpackage option # return 0 = package not installed # check for packager name flag for already installed rpm if ($packager_name_flag == 1) { NodeUtils->message('E1', 'EMsgNoRpmFound', $name); } if ($high_version_flag == 1) { if ($already_installed_flag == 1) { if ($::FORCE_INSTALL) { return 0; } else { return 2; } } elsif ($update_flag == 1) { if ($::FORCE_INSTALL) { return 0; } else { return 0; } } else { if ( $::PREREQS_ATTR{'DistributionName'} =~ /SuSE/ || $::PREREQS_ATTR{'DistributionName'} =~ /SLES/) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E2', 'EMsgRPMWrongVersion', $rpm, $already_installed_name, $already_installed_name ); } else { return 1; } } } elsif ($already_installed_flag == 1) { if ($::FORCE_INSTALL) { return 0; } else { return 2; } } elsif ($update_flag == 1) { if ($::FORCE_INSTALL) { return 0; } else { return 0; } } else { return 0; } } #-------------------------------------------------------------------------------- =head3 arrange_rpm Notes: move to ArchiveUtils Arranges the rpm array in order of the installed =cut #-------------------------------------------------------------------------------- sub arrange_rpm { my (@rpm_array) = @_; my @temp_array = (); my @shortname_array = (); my %temp_hash = (); #get the shortname of the rpm foreach my $rpm_name (@rpm_array) { my @parts = split /-/, $rpm_name; my $shortname = shift @parts; my $p; SNAME: while ($p = shift @parts) { if ($p !~ m/^\d/) { #if it doesn't start with a digit $shortname .= "-$p"; } else { unshift @parts, $p; last SNAME; } } my $tmp_var1; my $my_rindex = rindex($shortname, "*"); if ($my_rindex != -1) { $tmp_var1 = substr($shortname, 0, rindex($shortname, "*")); } else { $tmp_var1 = $shortname; } $my_rindex = rindex($tmp_var1, "-"); if (($my_rindex + 1) == 0) { $shortname = $tmp_var1; } elsif (($my_rindex + 1) == length($tmp_var1)) { $shortname = substr($tmp_var1, 0, rindex($tmp_var1, "*")); } else { $shortname = $tmp_var1; } push(@shortname_array, $shortname); } foreach my $rpm (@::Rpms_to_be_installed) { $temp_hash{$rpm}++; } foreach my $rpm (@shortname_array) { if (exists($temp_hash{$rpm})) { push(@temp_array, $rpm); } } @::Rpms_to_be_installed = @temp_array; } #-------------------------------------------------------------------------------- =head3 install_rpm_Linux Notes: move to ArchiveUtils - this is huge... This is the new install rpm , which does the rpm installation bases on the new list - currently it supports only Linux =cut #-------------------------------------------------------------------------------- sub install_rpm_Linux { my ($flag) = @_; my ($flags, $installflag, @my_path); if (!$installflag) { $installflag = "-U"; } # Default to -U @my_path = ($::INSTALLDIR_CSMPKG, $::INSTALLDIR_OS_NAME_RPMS); # check if there are any rpms not found, if exists than exit if (scalar(@::Rpms_not_found) >= 1) { my @rpm_ignored = (); my @rpm_not_ignored = (); foreach my $rpm_name (@::Rpms_not_found) { if ($rpm_name =~ m/fping/) { push(@rpm_ignored, $rpm_name); } elsif ($rpm_name =~ m/tftp/) { # see if some tftp server is installed: my ($isDefault, @tftpServers) = NetworkUtils->check4InstalledTftpServers(); if ($#tftpServers eq -1 && !$isDefault) { MessageUtils->message('W', 'IMsgNoDefaultTFTPServerFound', @::default_tftp_server_name); } } else { push(@rpm_not_ignored, $rpm_name); } } # Ignore all SIS packages if (scalar(@rpm_not_ignored) > 0) { my $rpm_temp; my @rpm_not_found; foreach $rpm_temp (@rpm_not_ignored) { my $short_rpm; my $my_rindex = rindex($rpm_temp, "*"); if ($my_rindex != -1) { $short_rpm = substr($rpm_temp, 0, $my_rindex); } #my @foo = grep(/$short_rpm/, @::sis_packages); #if (scalar(@foo)) { # push (@rpm_ignored,$rpm_temp); # $::IGNORE_SIS = 1; #} #else { push(@rpm_not_found, $rpm_temp); #} } @::Rpms_not_found = @rpm_not_found; } else { @::Rpms_not_found = @rpm_not_ignored; } if (scalar(@rpm_ignored) > 0) { NodeUtils->message('I', 'IMsgMissingRPM', join(", ", @rpm_ignored)); } if (scalar(@::Rpms_not_found) >= 1) { NodeUtils->message('E1', 'EMsgNoRpmFound', join(", ", @::Rpms_not_found)); } } if (scalar(@::Rpms_already_installed) >= 1) { foreach my $temp_rpm_name (@::Rpms_already_installed) { # below one line for Special condition for IBMJava if ($temp_rpm_name =~ /^IBMJava2-JRE/) { next; } NodeUtils->message('I', 'IMsgRPM_ALREADY_INSTALLED', $temp_rpm_name); } } #check if any rpms need to be installed if (scalar(@::Rpms_to_be_installed) >= 1) { if ( (grep /rsct/, @::Rpms_to_be_installed) > 0 ) { # if this is the rsct list then install them all at once my ($rpmlist, $cmd); my ($location, $destination, $full_name); foreach my $my_rpm (@::Rpms_to_be_installed) { $full_name = $::Rpm_name_path{$my_rpm}{'BaseName'}; $location = $::Rpm_name_path{$my_rpm}{'Location'}; $rpmlist .=" $location/$full_name"; NodeUtils->message('I', 'IMsgINSTALLING_RPMS', $full_name); } $cmd = "$::RPMCMD $installflag $rpmlist"; $cmd .= " --force " if $::FORCE_INSTALL; NodeUtils->runcmd("$cmd"); } else { #file name =full name of the file including path foreach my $my_rpm (@::Rpms_to_be_installed) { my ($location, $destination, $full_name); $full_name = $::Rpm_name_path{$my_rpm}{'BaseName'}; $location = $::Rpm_name_path{$my_rpm}{'Location'}; #Install the Rpm dependencies ArchiveUtils->installRequiredRpms($my_rpm, @my_path); # Special processing for open source rpms install if ($flag) { #Special process for conserver if ($my_rpm =~ /conserver/) { my $conserverinstallflag = &processConsever($location . "/" . $full_name, $my_path[0]); if ($conserverinstallflag == 0) { next; } # conserver is installed. } if ($my_rpm =~ /tftp/) { my $rc = NetworkUtils->process_tftp(); if ($rc) { #ArchiveUtils->display_opensrcLicence($my_rpm); #workaround for NLS problem if ($::ENGLISH) { NodeUtils->message('I', 'IMsgINSTALLING_RPM', $full_name); } else { NodeUtils->message('I', 'IMsgINSTALLING_RPMS', $full_name); } my $cmd = "$::RPMCMD $installflag $flags $location/$full_name"; $cmd = "$cmd --force" if $::FORCE_INSTALL; $rc = NodeUtils->run_cmd($cmd, "W", "show_all"); if ($rc eq 0) { $::default_tftp_server_installed = 1; next; } else { exit; } } next; } if ($my_rpm =~ /^IBMJava2-JRE/) { my $rc = &process_IBMJava($my_rpm, $location, $full_name); if ($rc == 0) { ArchiveUtils->display_opensrcLicence($my_rpm); #workaround for NLS problem if ($::ENGLISH) { NodeUtils->message('I', 'IMsgINSTALLING_RPM', $full_name); } else { NodeUtils->message('I', 'IMsgINSTALLING_RPMS', $full_name); } my $cmd = "$::RPMCMD $installflag $flags $location/$full_name"; $cmd = "$cmd --force" if $::FORCE_INSTALL; NodeUtils->runcmd("$cmd"); #SuSE changes #In SuSE8.1 and SLES8, after installing IBMJava2-JRE-1.3, should comment "export LD_ASSUME_KERNEL=2.2.5" if ( ( $::PREREQS_ATTR{'DistributionName'} =~ /SuSE/ && $::PREREQS_ATTR{'DistributionVersion'} eq '8.1' ) || ( $::PREREQS_ATTR{'DistributionName'} =~ /SLES/ && $::PREREQS_ATTR{'DistributionVersion'} eq '8.1') ) { NodeUtils->runcmd( "/usr/bin/perl -p -i -e 's/^export LD_ASSUME_KERNEL=2.2.5/# export LD_ASSUME_KERNEL=2.2.5/g' /opt/IBMJava2-13/jre/bin/java" ); } #End SuSE changes #RedHat 9 changes #In RedHat 9, after installing IBMJava2-JRE-1.3.1, should set "export LD_ASSUME_KERNEL=2.2.5" if ( ( $::PREREQS_ATTR{'DistributionName'} =~ /RedHat/ && $::PREREQS_ATTR{'DistributionVersion'} eq '9' ) || ($::PREREQS_ATTR{'DistributionName'} =~ /RedHatEL-ES/ && $::PREREQS_ATTR{'DistributionVersion'} eq '2.1') ) { NodeUtils->runcmd( "/usr/bin/perl -p -i -e 's/^# Run./export LD_ASSUME_KERNEL=2.2.5/' /opt/IBMJava2-131/jre/bin/java" ); } #End next; } elsif ($rc == 1) { ArchiveUtils->display_opensrcLicence($my_rpm); #workaround for NLS problem if ($::ENGLISH) { NodeUtils->message('I', 'IMsgINSTALLING_RPM', $full_name); } else { NodeUtils->message('I', 'IMsgINSTALLING_RPMS', $full_name); } $installflag = "-i"; $flags = "--oldpackage"; my $cmd = "$::RPMCMD $installflag $flags $location/$full_name"; $cmd = "$cmd --force" if $::FORCE_INSTALL; NodeUtils->runcmd("$cmd"); #SuSE changes #In SuSE8.1 and SLES8, after installing IBMJava2-JRE-1.3, should comment "export LD_ASSUME_KERNEL=2.2.5" if ( ( $::PREREQS_ATTR{'DistributionName'} =~ /SuSE/ && $::PREREQS_ATTR{'DistributionVersion'} eq '8.1' ) || ( $::PREREQS_ATTR{'DistributionName'} =~ /SLES/ && $::PREREQS_ATTR{'DistributionVersion'} eq '8.1') ) { NodeUtils->runcmd( "/usr/bin/perl -p -i -e 's/^export LD_ASSUME_KERNEL=2.2.5/# export LD_ASSUME_KERNEL=2.2.5/g' /opt/IBMJava2-13/jre/bin/java" ); } #End SuSE changes #RedHat 9 changes #In RedHat 9, after installing IBMJava2-JRE-1.3.1, should set "export LD_ASSUME_KERNEL=2.2.5" if ( ( $::PREREQS_ATTR{'DistributionName'} =~ /RedHat/ && $::PREREQS_ATTR{'DistributionVersion'} eq '9' ) || ($::PREREQS_ATTR{'DistributionName'} =~ /RedHatEL-ES/ && $::PREREQS_ATTR{'DistributionVersion'} eq '2.1') ) { NodeUtils->runcmd( "/usr/bin/perl -p -i -e 's/^# Run./export LD_ASSUME_KERNEL=2.2.5/' /opt/IBMJava2-131/jre/bin/java" ); } #End next; } else { NodeUtils->message('I', 'IMsgRPM_ALREADY_INSTALLED', $my_rpm); next; } } if (grep(/^$my_rpm$/, @::GPL_PACKAGES) and !$::DISPLAYED_GPL_LICENSE) { ArchiveUtils->display_opensrcLicence($my_rpm); } if ($my_rpm =~ /^openCIMOM/) { #workaround for NLS problem if ($::ENGLISH) { NodeUtils->message('I', 'IMsgINSTALLING_RPM', $full_name); } else { NodeUtils->message('I', 'IMsgINSTALLING_RPMS', $full_name); } $flags = "--oldpackage"; if ($::rpm_pkg_flag{openCIMOM}) { $flags = $flags . " " . $::rpm_pkg_flag{openCIMOM}; } my $cmd = "$::RPMCMD $installflag $flags $location/$full_name"; $cmd = "$cmd --force" if $::FORCE_INSTALL; NodeUtils->runcmd("$cmd"); next; } } #workaround for NLS problem if ($::ENGLISH) { NodeUtils->message('I', 'IMsgINSTALLING_RPM', $full_name); } else { NodeUtils->message('I', 'IMsgINSTALLING_RPMS', $full_name); } my $cmd = "$::RPMCMD $installflag $flags $location/$full_name"; $cmd = "$cmd --force" if $::FORCE_INSTALL; # More special processing for conserver. For some reason, when conserver # is upgraded from 7.2.2* to 7.2.4, the rpm command hangs if it is run # in backticks(``), as is done in NodeUtils->runcmd. It works fine when # run from system(). if (grep /conserver/, $full_name) { NodeUtils->message('V', 'IMsgCMD', $cmd); system("$cmd"); } else { if ( (grep /nfs-utils/, $full_name) || (grep /XFree86-libs/, $full_name)) { NodeUtils->runcmd("$cmd", 0); } else { NodeUtils->runcmd("$cmd"); } } } } } } #-------------------------------------------------------------------------------- =head3 install_packages_Linux Notes: move to ArchiveUtils This is the new install packages, which call the new install rpm. Currently it supports only Linux. =cut #-------------------------------------------------------------------------------- sub install_packages_Linux { my ($rpm, $tarball_list, $cmd, $rc, $returncode); my @linux_prereqs; $rc = 0; $returncode = 0; #SuSE Changes NodeUtils->message("I", 'IMsgINSTALLING_RPMS', "LINUX OS PRE REQUISITIES"); # collect the rpms name those are eligible ArchiveUtils->search_rpm_csminstall_path(@::mgmtserver_os_prereq); ArchiveUtils->create_rpm_list_to_install(); &arrange_rpm(@::mgmtserver_os_prereq); &install_rpm_Linux(); #End of SuSE Changes NodeUtils->message("I", 'IMsgINSTALLING_RPMS', "OPEN SOURCE PRE REQUISITIES"); # This is the list of GPL open source packages to be installed. If any # of these packages must be installed, a license is displayed first # and the user must press Enter to accept the license. if ($::PREREQS_ATTR{'PkgArchitecture'} =~ /ppc64/) { @::GPL_PACKAGES = (''); } else { @::GPL_PACKAGES = ('syslinux'); } # This variable is set when the GPL license has been displayed once, # and prevents the license question from being displayed again. $::DISPLAYED_GPL_LICENSE = 0; # collect the rpms name those are eligible # Remove the director rpms from the mgmtserver_open_srcrpms array # These rpms need to be copied only. They are going to be installed # by addlcsext command my @temp_aaray = (); foreach my $my_temp_rpm (@::mgmtserver_open_srcrpms) { if ( (grep /ITDAgent/, $my_temp_rpm) || (grep /DirAgent/, $my_temp_rpm) || (grep /RAIDLxAg/, $my_temp_rpm) || (grep /MPAAgent/, $my_temp_rpm)) { } else { push(@temp_aaray, $my_temp_rpm); } } @::mgmtserver_open_srcrpms = @temp_aaray; ArchiveUtils->search_rpm_csminstall_path(@::mgmtserver_open_srcrpms); ArchiveUtils->create_rpm_list_to_install(); # Special condition for IBMJava, and tftp Begin push(@::Rpms_to_be_installed, "IBMJava2-JRE"); @::Rpms_to_be_installed = ServerUtils->get_uniqu_arry_elemnts(@::Rpms_to_be_installed); # Special condition for IBMJava End &arrange_rpm(@::mgmtserver_open_srcrpms); &install_rpm_Linux(1); NodeUtils->message('I', 'IMsgINSTALLING_RPMS', "RSCT"); #check if the rsct.basic is installed or not, if not installed # then remove rsct.basic from the list NodeUtils->runcmd("$::RPMCMD -q rsct.basic", -1); if ($::RUNCMD_RC == 1) { my @temp_arry = (); foreach my $temp_element (@::mgmtserver_rsct_packages) { if ($temp_element !~ /rsct.basic/) { push(@temp_arry, $temp_element); } } @::mgmtserver_rsct_packages = @temp_arry; } # collect the rpms name those are eligible ArchiveUtils->search_rpm_csminstall_path(@::mgmtserver_rsct_packages); ArchiveUtils->create_rpm_list_to_install(); &arrange_rpm(@::mgmtserver_rsct_packages); &install_rpm_Linux(); # TO DO: if rsct.core was already installed, but ctrmc was not started, # this would have to time out before continuing # &waitForERRM(); -- this is now done in csmserverposti NodeUtils->message('I', 'IMsgINSTALLING_RPMS', "CSM"); # collect the rpms name those are eligible ArchiveUtils->search_rpm_csminstall_path(@::mgmtserver_csm_packages); ArchiveUtils->create_rpm_list_to_install(); # check if Migration install from lower level CSM my $preVersion = NodeUtils->runcmd("$::RPMCMD -q csm.server --qf '%{VERSION}'", -1); if ($::RUNCMD_RC == 0) { NodeUtils->runcmd("/usr/bin/chrsrc-api -s IBM.DmsCtrl::::MigrationInfo::$preVersion",-1); } # added end &arrange_rpm(@::mgmtserver_csm_packages); &install_rpm_Linux(); # install SIS PACKAGES in SuSE and SLES #if( ( $::DISTRO =~ /SLES/ || $::DISTRO =~/SuSE/ ) && $::PREREQS_ATTR{'PkgArchitecture'}=~/i?86/ ) #{ # NodeUtils->message('I', 'IMsgINSTALLING_RPMS', "SIS"); # ArchiveUtils->search_rpm_csminstall_path(@::mgmtserver_sis_packages); #ArchiveUtils->create_rpm_list_to_install(); #&arrange_rpm(@::mgmtserver_sis_packages); # &install_rpm_Linux(); #} } #-------------------------------------------------------------------------------- =head3 set_cluster_attrs Notes: move to ServerUtls? Big routine... Set global cluster attributes by using ATTR=Value provided by the user. This set attributes in the dmsctrl resource class. The attributes are stored in the %::ATTRS hash. =cut #-------------------------------------------------------------------------------- sub set_cluster_attrs { my $rc = 0; my ($attr, $value, $dmsctrlkey); return 0 if (!(keys %::ATTRS)); my $cmd = "/opt/csm/bin/csmconfig"; foreach $attr (keys %::ATTRS) { $value = $::ATTRS{$attr}; $cmd .= " $attr=$value"; } my $output = NodeUtils->runcmd($cmd, 0); $rc = $::RUNCMD_RC; return $rc; } #-------------------------------------------------------------------------------- =head3 processConsever Notes: Process for conserver return 1....Install return 0....Already Installed =cut #-------------------------------------------------------------------------------- sub processConsever { my ($conserrpmfile, $myConserverPathName) = @_; my $conserverSpecialinstallflag = 0; my $req_ver = "7.2.2"; my $req_rel = "6"; my $conserveroutput = ""; my @temp_array = (); my ($curr_rel, $curr_ver, $ins_rel, $ins_ver); # get the version and release of the copied rpm (@temp_array) = ArchiveUtils->getRPMVersionRelease($conserrpmfile, 1); $curr_ver = $temp_array[0]; $curr_rel = $temp_array[1]; # get the version and release valus of the installed rpm $conserveroutput = NodeUtils->runcmd("$::RPMCMD -q conserver", -1); if ($::RUNCMD_RC != 0) { if ( ArchiveUtils->testVersion($curr_ver, "<", $req_ver, $curr_rel, $req_rel) ) { NodeUtils->message('E1', 'EMsgMinConserverNot', $myConserverPathName); } else { return 1; } } else { (@temp_array) = ArchiveUtils->getRPMVersionRelease($conserveroutput); $ins_ver = $temp_array[0]; $ins_rel = $temp_array[1]; # First set if ( ArchiveUtils->testVersion($ins_ver, ">", $curr_ver, $ins_rel, $curr_rel) ) { if ( ArchiveUtils->testVersion( $ins_ver, ">", $req_ver, $ins_rel, $req_rel ) ) { return 1; } elsif ( ArchiveUtils->testVersion( $ins_ver, "<", $req_ver, $ins_rel, $req_rel ) ) { NodeUtils->message('E1', 'EMsgMinConserverNot', $myConserverPathName); } elsif ( ArchiveUtils->testVersion( $ins_ver, "=", $req_ver, $ins_rel, $req_rel ) ) { NodeUtils->message('V', 'IMsgRPM_ALREADY_INSTALLED', "conserver"); return 0; } } elsif ( ArchiveUtils->testVersion( $ins_ver, "<", $curr_ver, $ins_rel, $curr_rel ) ) { if ( ArchiveUtils->testVersion( $ins_ver, "<", $req_ver, $ins_rel, $req_rel ) ) { if ( ArchiveUtils->testVersion( $curr_ver, "=", $req_ver, $curr_rel, $req_rel ) ) { $conserverSpecialinstallflag = 1; goto CONSER; } elsif ( ArchiveUtils->testVersion( $curr_ver, ">", $req_ver, $curr_rel, $req_rel ) ) { $conserverSpecialinstallflag = 1; goto CONSER; } elsif ( ArchiveUtils->testVersion( $curr_ver, "<", $req_ver, $curr_rel, $req_rel ) ) { NodeUtils->message('E1', 'EMsgMinConserverNot', $myConserverPathName); } } elsif ( ArchiveUtils->testVersion( $ins_ver, ">", $req_ver, $ins_rel, $req_rel ) ) { if ( ArchiveUtils->testVersion( $curr_ver, ">", $req_ver, $curr_rel, $req_rel ) ) { return 1; } else { NodeUtils->message('V', 'IMsgRPM_ALREADY_INSTALLED', "conserver"); return 0; } } elsif ( ArchiveUtils->testVersion( $ins_ver, "=", $req_ver, $ins_rel, $req_rel ) ) { return 1; } } elsif ( ArchiveUtils->testVersion( $ins_ver, "=", $curr_ver, $ins_rel, $curr_rel ) ) { if ( ArchiveUtils->testVersion( $ins_ver, ">", $req_ver, $ins_rel, $req_rel ) ) { return 1; } elsif ( ArchiveUtils->testVersion( $ins_ver, "<", $req_ver, $ins_rel, $req_rel ) ) { NodeUtils->message('E1', 'EMsgMinConserverNot', $myConserverPathName); } elsif ( ArchiveUtils->testVersion( $ins_ver, "=", $req_ver, $ins_rel, $req_rel ) ) { NodeUtils->message('V', 'IMsgRPM_ALREADY_INSTALLED', "conserver"); return 0; } } # Set 2 if ( ArchiveUtils->testVersion($curr_ver, ">", $req_ver, $curr_rel, $req_rel) ) { if ( ArchiveUtils->testVersion( $curr_ver, ">", $ins_ver, $curr_rel, $ins_rel ) ) { if ( ArchiveUtils->testVersion( $ins_ver, "<", $req_ver, $ins_rel, $req_rel ) ) { $conserverSpecialinstallflag = 1; goto CONSER; } else { return 1; } } else { NodeUtils->message('V', 'IMsgRPM_ALREADY_INSTALLED', "conserver"); return 0; } } elsif ( ArchiveUtils->testVersion( $curr_ver, "<", $req_ver, $curr_rel, $req_rel ) ) { NodeUtils->message('E1', 'EMsgMinConserverNot', $myConserverPathName); } elsif ( ArchiveUtils->testVersion( $curr_ver, "=", $req_ver, $curr_rel, $req_rel ) ) { if ( ArchiveUtils->testVersion( $curr_ver, "<", $ins_ver, $curr_rel, $ins_rel ) ) { $conserverSpecialinstallflag = 1; goto CONSER; } else { NodeUtils->message('V', 'IMsgRPM_ALREADY_INSTALLED', "conserver"); return 0; } } # Set 3 if ( ArchiveUtils->testVersion($req_ver, ">", $ins_ver, $req_rel, $ins_rel) ) { if ( ArchiveUtils->testVersion( $req_ver, ">", $curr_ver, $req_rel, $curr_rel ) ) { NodeUtils->message('E1', 'EMsgMinConserverNot', $myConserverPathName); } else { $conserverSpecialinstallflag = 1; goto CONSER; } } elsif ( ArchiveUtils->testVersion( $req_ver, "<", $ins_ver, $req_rel, $ins_rel ) ) { if ( ArchiveUtils->testVersion( $curr_ver, ">", $ins_ver, $curr_rel, $ins_rel ) ) { return 1; } else { NodeUtils->message('V', 'IMsgRPM_ALREADY_INSTALLED', "conserver"); return 0; } } elsif ( ArchiveUtils->testVersion( $req_ver, "=", $ins_ver, $req_rel, $ins_rel ) ) { if ( ArchiveUtils->testVersion( $req_ver, "<", $curr_ver, $req_rel, $curr_rel ) ) { return 1; } else { NodeUtils->message('V', 'IMsgRPM_ALREADY_INSTALLED', "conserver"); return 0; } } } CONSER: if ($conserverSpecialinstallflag == 1) { my $conSerRandomNumber; my $conserver_config_copy_flag = 0; if (-f "/etc/opt/conserver/conserver.cf") { #generating a unique random number file/directory naming purpose $conSerRandomNumber = int(rand(2000)) + 1000; while (-d "/tmp/$conSerRandomNumber") { $conSerRandomNumber = int(rand(2000)) + 1000; } mkpath("/tmp/$conSerRandomNumber", $::VERBOSE, 0755); NodeUtils->runcmd( "$::COPY /etc/opt/conserver/conserver.cf /tmp/$conSerRandomNumber/" ); $conserver_config_copy_flag = 1; } NodeUtils->runcmd("$::RPMCMD -e conserver --nodeps"); if ($conserver_config_copy_flag == 1) { mkpath("/etc/opt/conserver", $::VERBOSE, 0755); NodeUtils->runcmd( "$::COPY /tmp/$conSerRandomNumber/conserver.cf /etc/opt/conserver/" ); NodeUtils->runcmd("$::RM -rf /tmp/$conSerRandomNumber/"); } return 1; } } #-------------------------------------------------------------------------------- =head3 checkPreviousInstallation Notes: empty subroutine =cut #-------------------------------------------------------------------------------- sub checkPreviousInstallation { } #-------------------------------------------------------------------------------- =head3 Main Notes: =cut #-------------------------------------------------------------------------------- { # main my ($rc) = 0; my ($returncode) = 0; $::IGNORE_SIS = 0; # load the packagedefs and intialize globs &initialize(); # process command line &getArgs; # start logging MessageUtils->start_logging($::INSTALLMSLOG); # set and verify local variables &set_variables; # determine which rpms are already installed InstallUtils->createRPMVersionListAlreadyInstalled(); # verify that the rpm tool is present. ArchiveUtils->checkForRpmTool(); # create install directory ServerUtils->create_directory_structure(); # copy the appropriate rpms to /csminstall if (!$::DONT_COPY_RPMS) # not don't copy { # update the rpms in the install dir ArchiveUtils->update_rpm_packages_to_csminstall; # Verify the current installation &checkPreviousInstallation; # empty sub } # Install the packages. $rc = &install_packages_Linux; $returncode = $rc if ($rc > $returncode); # Set global cluster attributes in the dmsctrl resource class $rc = &set_cluster_attrs; $returncode = $rc if ($rc > $returncode); # copy the csm command binaries. NodeUtils->message('I', 'IMsgCOPYING_CSMBINARIES'); ServerUtils->copyBinaries; # copy customization scripts ServerUtils->copy_csm_scripts(0); # create tftp user, configure and secure tftpboot NetworkUtils->createTftpUser(); NetworkUtils->configureTftp(); NetworkUtils->verifyTftp(1); NodeUtils->message('I', 'IMsgSecureFiles', '/tftpboot'); NetworkUtils->secureFilePermissions('/tftpboot', '0110', '0440'); # notify success or failure if ($returncode == 0) { NodeUtils->message('I', 'IMsgINSTALLMS_SUCCESSFUL'); } else { NodeUtils->message('E', 'EMsgINSTALLMS_UNSUCCESSFUL', $returncode); } # stop logging MessageUtils->stop_logging(); # exit exit $returncode; } q_v kt0PB7u7!q@!q@!q@ 7./opt/csm/bin/lscmtmss#!/usr/bin/perl # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # Restricted Materials of IBM # # (C) COPYRIGHT International Business Machines Corp. 2002,2003 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # # "@(#)75 1.5 src/csm/core/cmds/lscmtms.perl, sysman, csm_rveg, rveg0414a 7/10/02 14:33:26" # ##################################################################### # Module: lscmtms # # Description: Display the pSeries Cluster mtms Identification Number # # Inputs and Parameters: None # # Output: MT:xxxx-yyy MS:zzzzzzzzz # where xxxx is the 4 digit cluster machine type # yyy is the 3 digit cluster model number # zzz is up to 9 digit cluster serial number # If they are not found, NULL (empty string) will be displayed, # as in MT: MS: # # Return Codes: # 0 Successful # 1 Error, cmtm or csn is NULL # 2 Error, Internal call returned error. # There are no error messages # # External Ref: # SDRGetObjects # lsrsrc # lssrc # mgmtsvr # ##################################################################### # # This module is called by Inventory Scout or Diagnostics on AIX. # lscmtms is shipped by PSSP and CSM, and is identical in both. # The initial value of the cluster mtm is 9078-160. # It determines if PSSP is running by checking # that the sdr is active. If so, the values are retrieved from the SDR # or NULL are returned. # If CSM is running, then lsrsrc is called for the cmtms, and the # values or NULL are returned. # ##################################################################### use strict; my ($SDRGO,$LSSRC,$LSRSRC_API,$cmtm,$csn,$output,$null,$rc); my (@DMS_ACTIVE,@CSMAgent_ACTIVE,$subsystem,$group,$PID,$DMSstate,$NodeState); $cmtm = ""; $csn = ""; $SDRGO = "/usr/lpp/ssp/bin/SDRGetObjects"; $LSSRC = "/usr/bin/lssrc"; $LSRSRC_API ="/usr/bin/lsrsrc-api"; &pssp_check(); # returns 0 if SDR running, 2 if not running $rc = $?; if ($rc) { &csm_check(); # returns 0 if CSM running, 2 if not running $rc = $?; if ($rc) { # if neither is running, quit now. print "MT:$cmtm MS:$csn\n"; exit 2; } } &endgame(); # displays results, exits 0 if both fields have data # exits 1 if one or more of the fields are blank # -------------------------------------------------------------------------- sub csm_check { # if IBM.DMSRM (ms) or IBM.CSMAgentRM (node) is active then csm may be running. # IBM.CSMAgentRM is shipped with csm.clients in AIX so it will be active on # a PSSP system also. # lssrc produces a header row and the data row, we want the state which # is active or inactive, in the data row. # chop(@DMS_ACTIVE=`$LSSRC -s IBM.DMSRM 2>/dev/null`); foreach (@DMS_ACTIVE) { s/^\s*//; # remove blanks ($subsystem, $group, $PID, $DMSstate) = split(/\s+/); } chop(@CSMAgent_ACTIVE=`$LSSRC -s IBM.CSMAgentRM 2>/dev/null`); foreach (@CSMAgent_ACTIVE) { s/^\s*//; # remove blanks ($subsystem, $group, $PID, $NodeState) = split(/\s+/); } if ($DMSstate eq "active") { # # it is a mgmt server # run mgmt server version of lsrsrc # chop($output = `$LSRSRC_API -s IBM.DmsCtrl::::ClusterTM::ClusterSNum 2>/dev/null`); if ($? > 0) { return 2; # lsrsrc-api call failed } # # parse the output. it has the form xxxx-yyy::zzzzz, cmtm::csn # ($cmtm, $null, $csn) = split(/:/,$output); # print later } elsif ($NodeState eq "active") { # # it is not a ms, see if it is a node # chop($output = `$LSRSRC_API -s IBM.ManagementServer::"ManagerType=='CSM'"::ClusterTM::ClusterSNum 2>/dev/null`); if ($? > 0) { return 2; # lsrsrc-api call failed } # # parse the output. it has the form xxxx-yyy::zzzzz, cmtm::csn # ($cmtm, $null, $csn) = split(/:/,$output); # print later } else { return 2;} # neither DMSstate or NodeState active. return 0; } # -------------------------------------------------------------------------- sub pssp_check { # # determine if PSSP is running by checking if the SDR call returns 0 # while getting the cmtm from the sdr chop($cmtm = `$SDRGO -x SP Cluster_type_model 2>/dev/null`); $cmtm =~ s/\s*//g; # remove blanks if ($? > 0) { return 2; # SDR call failed, not running } if ($cmtm eq "\"\"") {$cmtm = "";} # convert SDR version of NULL # get the csn from the sdr chop($csn = `$SDRGO -x SP Cluster_serial_number 2>/dev/null`); $csn =~ s/\s*//g; # remove blanks if ($? > 0) { return 2; # SDR call failed, not running } if ($csn eq "\"\"") {$csn = "";} # convert SDR version of NULL return 0; } # -------------------------------------------------------------------------- sub endgame { # # either csm or pssp found the cmtms, so display it # print "MT:$cmtm MS:$csn\n"; if (($cmtm eq "") || ($csn eq "") ) { exit 1; } exit 0; } k(v0PBm7u(!q@!q@!q@ (./opt/csm/bin/mgmtsvrsm#!/usr/bin/perl # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2000,2003 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # @(#)85 1.20 src/csm/core/cmds/mgmtsvr.perl, csmcore, csm_rveg, rveg0414a 8/18/03 16:08:29 use strict; use locale; BEGIN { # this enables us to redirect where it looks for other CSM files during development $::csmroot = $ENV{'CSM_ROOT'} ? $ENV{'CSM_ROOT'} : '/opt/csm'; $::csmpm = "$::csmroot/pm"; $::csmbin = "$::csmroot/bin"; } use lib $::csmpm; use Getopt::Std; require NodeUtils; # For the usage, see nodecmds.msg sub usage { NodeUtils->message('I', 'IMsgMgmtsvrUsage'); exit (scalar(@_) ? $_[0] : 1); } $::MSGCAT = 'nodecmds.cat'; $::MSGMAPPATH = "$::csmroot/msgmaps"; # Parse the cmd line args and check them if (! getopts('n:NhvVdkx') ) { &usage; } if ($::opt_h) { &usage(0); } if (scalar(@ARGV) > 1) { &usage; } #Now allow -d & -N to be used with ARGV #if (scalar(@ARGV) > 0 && ($::opt_d||$::opt_N)) { &usage; } if (scalar(@ARGV) == 0 && defined($::opt_n)) { &usage; } if ( defined($::opt_n) ) { &waitForCTRMC( ); } $::VERBOSE = $::opt_v || $::opt_V ; $ENV{'CT_MANAGEMENT_SCOPE'} = 1; # set local scope because we only want the local Management Server class delete $ENV{'CT_CONTACT'}; if (scalar(@ARGV) > 0) # they are setting the mgmt svr { my $ms = shift @ARGV; if(!$ENV{'CSM_MAKENODE_RUNNING'}){ # Should we do this or not? If this name came from the mgmt svr, it might be better to use it # exactly. If it came from the cmd line on the node, we should try name resolution. $ms = NodeUtils->tryHost($ms); } #my $ms = shift @ARGV; #print "opt_n=$::opt_n\n"; if($::opt_d){ #just delete this ms &rmMgmtSvr($ms); } elsif($::opt_n){ &setMgmtSvr($ms, $::opt_n); } else{ #just display ms &displayMS($ms); } } elsif ($::opt_d) # they are removing the mgmt svr { &rmMgmtSvr(); } elsif (!$::opt_d) # display ALL mgmt svrs { &displayMS(); } exit; # Return true if this machine is the mgmt svr for itself. sub isOwnMgmtSvr { my ($ms, $lhn) = @_; # If this is a mgmt svr for itself then we should be able to look up the $lhn in the ManagedNode # class and the ManagementServer attribute should match $ms. my $outref = NodeUtils->runrmccmd('lsrsrc-api', "-i -D ':|:'", qq(-s IBM.ManagedNode::"Hostname='$lhn'"::ManagementServer)); if (scalar(@$outref) == 0) { return 0; } return $$outref[0] eq $ms; } # Return the mgmt svr and local hostname from the IBM.ManagementServer resource class. # This function assumes we are on a node. sub getMgmtSvr { my ($name) = @_; #if they specify a ms name my $outref; my %MgmtSvrs; if($name){ $outref = NodeUtils->runrmccmd('lsrsrc-api', "-i -D ':|:'", qq(-s IBM.ManagementServer::"ManagerType='CSM' && Hostname='$name'"::LocalHostname)); } else{ $outref = NodeUtils->runrmccmd('lsrsrc-api', "-i -D ':|:'", qq(-s IBM.ManagementServer::"ManagerType='CSM'"::Hostname::LocalHostname)); } if (scalar(@$outref) == 0) { return; } foreach my $line (@$outref){ #there can be multiple ms defined my ($ms, $lhn) = split(/:\|:/, $line); $MgmtSvrs{$ms}=$lhn; } return (\%MgmtSvrs); } sub setMgmtSvr { my ($ms, $lhn) = @_; if (!NodeUtils->isNode()) { NodeUtils->message('E41','EMsgNOT_A_NODE'); } my $cmd; my $changedHostname = 1; # used to know if we need to refresh at the end if(!$::opt_x){ # See if there is already an entry - if so, replace it my $MgmtSvrs = &getMgmtSvr(); my @servers = keys %$MgmtSvrs; foreach my $prevms (@servers){ my $prevlhn = $$MgmtSvrs{$prevms}; if ($ms ne $prevms) # the Hostname has changed { # Undefine the resource and recreate it. This is necessary to get the DMSRM to go # through the full processing in the case that this is really a new mgmt svr. In the # case in which this is the same mgmt svr with a name change, this will also be ok. NodeUtils->runrmccmd('rmrsrc-api', '', qq(-s IBM.ManagementServer::"Hostname='$prevms'")); my $attr2 = length($lhn) ? qq(::LocalHostname::"$lhn") : ''; NodeUtils->runrmccmd('mkrsrc-api', '', qq(IBM.ManagementServer::Hostname::"$ms"::ManagerType::"CSM"$attr2)); } elsif (length($lhn) && $lhn ne $prevlhn) # Hostname did not change, but LocalHostname did { # Note: we don't need to process the -k option in this case because the # ManagementServer resource class will exchange keys if either attribute # changed. NodeUtils->runrmccmd('chrsrc-api', '', qq(-s IBM.ManagementServer::"Hostname='$prevms'"::LocalHostname::"$lhn")); #my $opflag = '0'; #NodeUtils->runrmccmd('runact', '', qq(-c IBM.ManagementServer RefreshNodeInfo MgmtSvrHostname=$ms OperationFlag=$opflag)); #todo: handle the no resources found error in case the resource was deleted after we checked it above. } elsif($::opt_k) # no need to change the resource but need to run the refresh action { $changedHostname = 0; my $opflag = '0'; #NodeUtils->runrmccmd('runact', '', qq(-c IBM.ManagementServer RefreshNodeInfo MgmtSvrHostname=$ms OperationFlag=$opflag)); NodeUtils->runrmccmd('runact-api', '', qq(-c IBM.ManagementServer::::RefreshNodeInfo::MgmtSvrHostname::"$ms"::OperationFlag::"$opflag")); } } if(scalar (keys %$MgmtSvrs) ==0) # create the entry { my $attr2 = length($lhn) ? qq(::LocalHostname::"$lhn") : ''; NodeUtils->runrmccmd('mkrsrc-api', '', qq(IBM.ManagementServer::Hostname::"$ms"::ManagerType::"CSM"$attr2)); } } else{ #-x so just add as an additional management server #create the entry my $attr2 = length($lhn) ? qq(::LocalHostname::"$lhn") : ''; NodeUtils->runrmccmd('mkrsrc-api', '', qq(IBM.ManagementServer::Hostname::"$ms"::ManagerType::"CSM"$attr2)); } # Refresh the rmc daemon so it picks up the acl file that was possibly modified as a # result of changing the management server if ($changedHostname) { NodeUtils->runrmccmd('refresh', '-s ctrmc'); } } sub rmMgmtSvr { my ($server) = @_; if (!NodeUtils->isNode()) { NodeUtils->message('E41','EMsgNOT_A_NODE'); } #my ($ms, $lhn) = &getMgmtSvr(); my $MgmtSvrs = &getMgmtSvr(); foreach my $ms (keys %$MgmtSvrs){ if($server && $ms ne $server){ next; } if (length($ms)){ NodeUtils->runrmccmd('rmrsrc-api', '-i', qq(-s IBM.ManagementServer::"Hostname='$ms'")); } } } # This is not currently used #sub checkMgmtSvr # { # my ($class, $force) = @_; # my $ms = NodeUtils->getMgmtSvr($force); # if (length($ms)) # we are on a node # { # # Set the environment var so RMC will connect remotely # NodeUtils->msg($msgs, 'V', 'CONNECTING_REMOTELY', $ms); # $ENV{'CT_CONTACT'} = $ms; # } # } sub isCTRMCrunning { my @output = NodeUtils->runcmd("LANG=C /usr/bin/lssrc -s ctrmc", -1); if ($::RUNCMD_RC) { return 0; } # maybe we should try to catch real errors here my ($subsys, $group, $pid, $status) = split(' ', $output[1]); if (defined($status) && $status eq 'active') { #now check to see if IBM.CSMAgentRM is up @output = NodeUtils->runcmd("LANG=C /usr/bin/lssrc -s IBM.CSMAgentRM", -1); if ($::RUNCMD_RC) { return 0; } # maybe we should try to catch real errors here ($subsys, $group, $pid, $status) = split(' ', $output[1]); if (defined($status) && $status eq 'active') { return 1; } else { return 0; } } else { return 0; } } sub waitForCTRMC { # Wait for the ctrmc and IBM.CSMAgentRM daemons to start. ctrmc will start CSMAgentRM # This is important during the first boot of a machine when ctrmc must # get started from /etc/inittab before mgmtsvr is successful. my $i; for ($i=1; $i<=15; $i++) { if (&isCTRMCrunning()) { last; } sleep 2; } if ($i > 14) { NodeUtils->message('W', 'EMsgDAEMON_NOT_STARTED', "ctrmc" ); } } sub displayMS{ # These are the various cases: # - only a node, mgmt svr set - rc=0, display: foo.com # - only a node, mgmt svr not set - rc=11, display: This node does not currently have.... # - mgmt svr/node, mgmt svr set to self - rc=21, display: foo.com (This node is the mgmt svr for itself.) # - mgmt svr/node, mgmt svr set to other mgmt svr - rc=22, display: foo.com (This node is also a mgmt svr for other nodes.) # - mgmt svr/node, mgmt svr not set - rc=23, display: This machine is a CSM mgmt svr and a node, but the node does not currently... # - only a mgmt svr - rc=31, display: This machine is a CSM management server. # - more than 1 mgmt svr defined on this node - rc=31, display: This machine has multiple management servers:\nfoo.com\nbar.com # - neither a mgmt svr or a node - rc=101, display: This machine is neither a CSM mgmt svr or node. my ($ms) = @_; if (NodeUtils->isNode()) { my $MgmtSvrs = &getMgmtSvr($ms); my $numkeys = keys %$MgmtSvrs; if(keys %$MgmtSvrs <= 1){ #only 1 MS defined my @all = keys %$MgmtSvrs; my $ms = $all[0]; my $lhn = $$MgmtSvrs{$ms}; if ($::opt_N) { NodeUtils->message('O','IMsgMS_AND_LHN', $ms, $lhn); } elsif (!NodeUtils->isMgmtSvr()) { if (length($ms)) { print "$ms\n"; } else { NodeUtils->message('I11','IMsgNOT_SET'); } } else # also a mgmt svr { if (length($ms)) { if (&isOwnMgmtSvr($ms, $lhn)) { NodeUtils->message('I21','IMsgBOTH_ITSELF', $ms); } else { NodeUtils->message('I22','IMsgBOTH_OTHER', $ms); } } else { NodeUtils->message('I23','IMsgBOTH_NOT_SET'); } } } else{ #more than 1 MS defined my @servers = keys %$MgmtSvrs; print "There are multiple management servers defined for this node:\n"; foreach my $ms (@servers){ if($::opt_N){ my $lhn = $$MgmtSvrs{$ms}; NodeUtils->message('O','IMsgMS_AND_LHN', $ms, $lhn); } else{ print "$ms\n"; } } exit 41; } } elsif (NodeUtils->isMgmtSvr()) # only a mgmt svr { NodeUtils->message('I31','IMsgMGMT_SVR'); } else # neither a node or mgmt svr (must only have csm.core installed) { NodeUtils->message('E101','EMsgNEITHER'); } } T_A kx0PB7u9@@@ 9./opt/csm/bin/sprcvrs#!/usr/bin/perl # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # @(#)09 1.8 src/csm/samples/sbin/sprc.perl, setup, csm_rveg, rvegs001a 5/5/04 16:11:44 # # Module: Simple Platform-independent Resource Controller (SPRC) # # # Purpose: The purpose of this script is to supply a simple platform independent # interface to system daemons. These are often refered to as resources. # # sprc provides users with an common command line interface that can handle # typical resource managment tasks on both AIX and Linux cluser nodes. # # When used with CFM, sprc simplifies managing daemons across a hetrogenous # cluster. # # # Source: /opt/csm/samples/sbin/sprc.perl # # Installed: /opt/csm/bin/sprc # # # # Exceptions: This tool supports exceptions to the variety of names found with known # resources. sprc has the reponsibility for resolving the name correctly # for a given platform ( see aixExceptionHandler for example- and yes it is # a hack ) # # If you add an exception to this tool, please update the list. # # . autofs = automountd # . ntpd = xntpd # #-------------------------------------------------------------------------------- =head1 sprc.perl Development notes: The html view of the pod headers in this file can be updated by running the command: pod sprc.perl The html veiw of the pod headers will be in the file sprc.perl.html =cut #-------------------------------------------------------------------------------- =head3 use staements =cut #-------------------------------------------------------------------------------- use strict; #use lib $::csmpm; use FindBin qw($Bin); use lib "$Bin"; use Getopt::Long; #-------------------------------------------------------------------------------- =head3 file scope data =cut #-------------------------------------------------------------------------------- # remote shell vairables my $aix_rsh; my $linux_ssh; my $AIX_AUTOFS_CMD = "/usr/sbin/automount"; #-------------------------------------------------------------------------------- =head3 messages =cut #-------------------------------------------------------------------------------- my $EMsgAIXOnly = "the -g flag is only appropriate for AIX hosts. \n"; my $EMsgNoResource = "sprc: need a resource for this command - try: sprc --help \n"; my $EMsgUnsupporteOS = "sprc: unsupported Operating System \n"; my $IMsgNoParameters = "sprc: parmeters needed for this command - try: sprc --help\n"; my $IMsgUsage = "Usage: sprc [[-h?vV]|{[--cycle|-c]|[--kill|-k]|[--list|-l]|[--start|-s]|[--stop]}][[--remote|-r]{name|ipaddr}]{res|-g group}\n"; #-------------------------------------------------------------------------------- =head3 sub usage =cut #-------------------------------------------------------------------------------- sub usage () { print $IMsgUsage; exit; } #-------------------------------------------------------------------------------- =head3 sub help =cut #-------------------------------------------------------------------------------- sub help() { print "\n"; print "--------------------------------------------------------------------------------\n"; print "\n"; print "sprc: simple platform independent resource controller\n"; print "\n"; print $IMsgUsage; print "\n"; print "Options: \n"; print " -c | --cycle - kill and restart a running resource.\n"; print " -g - apply operation to a resource group (AIX only)\n"; print " -h | ? - print short usage message. \n"; print " --help - print this help message. \n"; print " -k | --kill - stop a resource (same as --stop). \n"; print " -l | --list - list the status of a resource. \n"; print " -r | --remote - execute operation on a remote host.\n"; print " -s | --start - start a resource. \n"; print " --stop - stop a resource (same as -k,--kill). \n"; print " -v | -V - verbose output. \n"; print "\n"; print "Examples: \n"; print "\n"; print " Kill and start a running instance of ntpd on the local host. \n"; print "\n"; print " sprc -c ntpd \n"; print "\n"; print " Kill and start ntpd on the remote host, validHostName. \n"; print "\n"; print " sprc --cycle --remote validHostName ntpd \n"; print "\n"; exit; } #-------------------------------------------------------------------------------- =head3 sub getArgs =cut #-------------------------------------------------------------------------------- sub getArgs { # Checks case in GetOptions $Getopt::Long::ignorecase = 0; # Allows opts to be grouped (e.g. -avx) Getopt::Long::Configure("bundling"); if ( !@ARGV ) { print $IMsgNoParameters; exit; } GetOptions( 'c' => \$::CYCLE, 'cycle' => \$::CYCLE, 'h|?' => \$::USAGE, 'g' => \$::GROUP, 'group' => \$::GROUP, 'help' => \$::HELP, 'k' => \$::KILL, 'kill' => \$::KILL, 'l' => \$::LIST, 'list' => \$::LIST, 'r' => \$::RHOST, 'remote' => \$::RHOST, 's' => \$::START, 'start' => \$::START, 'stop' => \$::KILL, 'v' => \$::VERBOSE, 'V' => \$::VERBOSE, ); if ( $::USAGE ) { print $IMsgUsage; } if ( $::HELP ) { &help(); } if ( $::RHOST ) { $aix_rsh = " rsh "; $linux_ssh = " ssh "; } } #-------------------------------------------------------------------------------- =head3 sub getPlatform Returns a testable OS Platform string. =cut #-------------------------------------------------------------------------------- sub getPlatform { my $platform = qx ' uname -s '; chomp ( $platform ); if ( $platform eq "AIX" ) { return "AIX"; } elsif ($platform eq "Linux") { if (-f "/etc/redhat-release") { return "Redhat"; } elsif ( -f "/etc/SuSE-release" ) { if ( !system( "grep SLES-7 /etc/SuSE-release " ) ) { return "SLES-7"; } elsif ( !system( "grep SLES- /etc/SuSE-release " ) || !system( "grep 'SuSE Linux' /etc/SuSE-release") ) { return "Not_SLES-7"; # SLES but not SLES-7 } } } else # error, unsupported platform { print " $EMsgUnsupporteOS \n"; exit; } } #-------------------------------------------------------------------------------- =head3 sub aixExceptionHandler - put special daemon-specific hacks here =cut #-------------------------------------------------------------------------------- sub aixExceptionHandler { my ( $resource ) = @_; # switch on $resource if ( $resource eq "autofs" ) { if ( $::GROUP ) { return "autofs"; } return "automountd"; } if ( $resource eq "automount" ) { if ( $::GROUP ) { return "autofs"; } return "automountd"; } if ( $resource eq "automountd" ) { if ( $::GROUP ) { return "autofs"; } return "automountd"; } if ( $resource eq "ntpd" ) { return "xntpd"; } return $resource; } #-------------------------------------------------------------------------------- =head3 sub redhatExceptionHandler - put special daemon-specific hack here. =cut #-------------------------------------------------------------------------------- sub redhatExceptionHandler { my ( $resource ) = @_; # switch on $resource if ( $resource eq "automountd" ) { return "autofs"; } if ( $resource eq "xntpd" ) { return "ntpd"; } return $resource; } #-------------------------------------------------------------------------------- =head3 sub sles7ExceptionHandler - put special daemon-specific hacks here =cut #-------------------------------------------------------------------------------- sub sles7ExceptionHandler { my ( $resource ) = @_; # switch on $resource if ( $resource eq "automountd" ) { return "autofs"; } if ( $resource eq "ntpd" ) { return "xntpd"; } return $resource; } #-------------------------------------------------------------------------------- =head3 sub notSles7ExceptionHandler - put special daemon-specific hacks here =cut #-------------------------------------------------------------------------------- sub notSles7ExceptionHandler { my ( $resource ) = @_; # switch on $resource if ( $resource eq "automountd" ) { return "autofs"; } if ( $resource eq "ntpd" ) { return "xntpd"; } return $resource; } #-------------------------------------------------------------------------------- =head3 sub aixRsourceHandler Handles AIX Unix resource requirements Notes: =cut #-------------------------------------------------------------------------------- sub aixResourceHandler { my $scope; my ( $resource, $host ) = @_; # $scope is either -s or -g if ( $::GROUP ) { $scope = " -g "; } else { $scope = " -s "; } if ( $::CYCLE) { # recycle the daemon system ( "$aix_rsh $host stopsrc $scope $resource " ); system ( "$aix_rsh $host startsrc $scope $resource " ); # start the autofs subsystem system ( $AIX_AUTOFS_CMD ); } if ( $::KILL ) { system ( "$aix_rsh $host stopsrc $scope $resource " ); } if ( $::LIST) { system ( "$aix_rsh $host lssrc $scope $resource " ); } if ( $::START) { # start the daemon system ( "$aix_rsh $host startsrc $scope $resource " ); # start the autofs subsystem system ( $AIX_AUTOFS_CMD ); } } #-------------------------------------------------------------------------------- =head3 sub redhatResourceHandler Handles Redhat Linux resource requirements Notes: =cut #-------------------------------------------------------------------------------- sub redhatResourceHandler { my ( $resource, $host ) = @_; # set absolute path to linux resource ( in init.d ) my $abs_resource = "/etc/init.d/$resource"; if ( $::CYCLE) { system ( "$linux_ssh $host $abs_resource stop " ); system ( "$linux_ssh $host $abs_resource start " ); } if ( $::KILL ) { system ( "$linux_ssh $host $abs_resource stop " ); } if ( $::LIST) { system ( "$linux_ssh $host $abs_resource status " ); } if ( $::START) { system ( "$linux_ssh $host $abs_resource start " ); } } #-------------------------------------------------------------------------------- =head3 sub sles7ResourceHandler Handles SuSE 7 Linux resource requirements Notes: =cut #-------------------------------------------------------------------------------- sub sles7ResourceHandler { my ( $resource, $host ) = @_; # set absolute path to linux resource ( in init.d ) my $abs_resource = "/etc/init.d/$resource"; if ( $::CYCLE) { system ( "$linux_ssh $host $abs_resource stop " ); system ( "$linux_ssh $host $abs_resource start " ); } if ( $::KILL ) { system ( "$linux_ssh $host $abs_resource stop " ); } if ( $::LIST) { system ( "$linux_ssh $host $abs_resource status " ); } if ( $::START) { system ( "$linux_ssh $host $abs_resource start " ); } } #-------------------------------------------------------------------------------- =head3 sub notSles7ResourceHandler Handles SuSE 8 Linux resource requirements Notes: =cut #-------------------------------------------------------------------------------- sub notSles7ResourceHandler { my ( $resource, $host ) = @_; # set absolute path to linux resource ( in init.d ) my $abs_resource = "/etc/init.d/$resource"; if ( $::CYCLE) { system ( "$linux_ssh $host $abs_resource stop " ); system ( "$linux_ssh $host $abs_resource start " ); } if ( $::KILL ) { system ( "$linux_ssh $host $abs_resource stop " ); } if ( $::LIST) { system ( "$linux_ssh $host $abs_resource status " ); } if ( $::START) { system ( "$linux_ssh $host $abs_resource start " ); } } #-------------------------------------------------------------------------------- =head3 Main MAIN main process comand line then switch on $platform. =cut #-------------------------------------------------------------------------------- { # main block - controls scope of data # values from cmd line my $resource; my $host; # get arguments &getArgs(); # get $platform my $platform = &getPlatform(); if ( $platform == -1 ) { exit; } # get the hostname if remote shell flag is set if ( $::RHOST ) { $host = shift @::ARGV; } # get resource if ( @::ARGV ) { $resource = shift @::ARGV; } else { print $EMsgNoResource; } # handle AIX only condition if ( $::GROUP && $platform != "AIX" ) { print $EMsgAIXOnly; exit; } # switch on $platform { if ( $platform eq "AIX" ) { $resource = &aixExceptionHandler ( $resource ); &aixResourceHandler( $resource, $host ); } elsif ( $platform eq "Redhat" ) { $resource = &redhatExceptionHandler ( $resource ); &redhatResourceHandler( $resource ); } elsif ( $platform eq "SLES-7" ) { $resource = &sles7ExceptionHandler ( $resource ); &sles7ResourceHandler( $resource ); } elsif ( $platform eq "Not_SLES-7" ) { $resource = ¬Sles7ExceptionHandler ( $resource ); ¬Sles7ResourceHandler( $resource ); } } } head3 k*Y|0PB7utIFq@Fq@Fq@ tI./opt/csm/bin/uninstallmsdefau#!/usr/bin/perl # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2002,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # @(#)40 1.32 src/csm/install/uninstallms.perl, setup, csm_rveg, rveg0414a 3/30/04 14:00:43 #-------------------------------------------------------------------------------- =head1 uninstallms.perl Development notes: The html view of the pod headers in this file can be updated by running the command: tidypod The html veiw of the pod headers will be in the file ./.html and can be viewed with a browser. The tidy formatted file will be in .tdy Be sure to run tidypod and copy the .tdy file to before checking in changes. =cut #-------------------------------------------------------------------------------- use strict; BEGIN { $::csmpm = $ENV{'CSM_PM'} ? $ENV{'CSM_PM'} : '/opt/csm/pm'; } use lib $::csmpm; use Getopt::Std; use NodeUtils; use CSMDefs; use InstallUtils; # sets local scope - we only want classes on the Managment Server # though it's not clear that classes are being used ...? $ENV{'CT_MANAGEMENT_SCOPE'} = 1; # message service $::MSGCAT = 'csmInstall.cat'; $::MSGMAPPATH = $ENV{'CSM_MSGMAPS'} ? $ENV{'CSM_MSGMAPS'} : '/opt/csm/msgmaps'; $::MSGSET = 'csminstall'; #-------------------------------------------------------------------------------- =head3 initialize Notes: globals only get the definitions we need for this command in this case get_OSDefs uses the attrs of the management server to identify the correct definitions =cut #-------------------------------------------------------------------------------- sub initialize { # setup the global os define variables InstallUtils->get_OSDefs(); @::My_NodeList = (); $::rsct_basic_Flg = 0; $::csm_client_Flg = 0; # gather the variables $::ATTRS{'InstallCSMVersion'} = InstallUtils->get_CSMVersion("csm\.core"); $::ATTRS{'InstallOSName'} = InstallUtils->get_OSName; $::ATTRS{'InstallDistributionName'} = InstallUtils->get_DistributionName; $::ATTRS{'InstallDistributionVersion'} = InstallUtils->get_DistributionVersion; $::ATTRS{'InstallPkgArchitecture'} = InstallUtils->get_PkgArchitecture; $::osTypeVersion = $::ATTRS{'InstallOSName'} . $::ATTRS{'InstallDistributionName'} . $::ATTRS{'InstallDistributionVersion'}; # # get the appropriate lists of filesets/packages # # for the management server %::Svrpkgdefs = InstallUtils->get_pkgdefs( $::ATTRS{'InstallOSName'}, $::ATTRS{'InstallDistributionName'}, $::ATTRS{'InstallDistributionVersion'}, $::ATTRS{'InstallPkgArchitecture'}, "MgmtServer", $::ATTRS{'InstallCSMVersion'} ); # get the list of log files @::csm_logfilelist = (@{$::Svrpkgdefs{logfiles}}); # get the CSM uninstall list @::csm_uninstall_packages = (@{$::Svrpkgdefs{csm_unpackages}}); @::csm_uninstall_packages = reverse @::csm_uninstall_packages; # get the rsct uninstall list @::rsct_uninstall_packages = (@{$::Svrpkgdefs{rsct_unpackages}}); @::rsct_uninstall_packages = reverse @::rsct_uninstall_packages; # get the list of uninstall directories @::csmUninstallList_Directories = (@{$::Svrpkgdefs{csm_uninstall_dirs}}); # get list of packages that shouldn't be uninstalled @::csmUninstallList_Packages = (@{$::Svrpkgdefs{csm_nouninstall_pkgs}}); } #-------------------------------------------------------------------------------- =head3 usage Notes: =cut #-------------------------------------------------------------------------------- sub usage { NodeUtils->message('I', 'IMsguninstallmsUsage'); exit 1; } #-------------------------------------------------------------------------------- =head3 getArgs Notes: =cut #-------------------------------------------------------------------------------- sub getArgs { if (!getopts('fuvVh')) { &usage; } if ($::opt_h) { &usage } if ($::opt_v) { $::VERBOSE = $::opt_v; } if ($::opt_V) { $::VERBOSE = $::opt_V; } # check if the Machine is Management Server if (!NodeUtils->isMgmtSvr()) { NodeUtils->message('E2', 'EMsgNOManagementServer'); } if ((!($::opt_f)) && ($::opt_u)) { NodeUtils->message('P', 'IMsgUNINSTALLMS_VERIFY_U'); my $input = getc; if (($input !~ /^y/) and ($input !~ /^Y/)) { NodeUtils->message('I', 'IMsgUNINSTALLMS_NOT_UNINSTALLING'); exit 0; } } if ((!($::opt_f)) && (!($::opt_u))) { NodeUtils->message('P', 'IMsgUNINSTALLMS_VERIFY'); my $input = getc; if (($input !~ /^y/) and ($input !~ /^Y/)) { NodeUtils->message('I', 'IMsgUNINSTALLMS_NOT_UNINSTALLING'); exit 0; } } } #-------------------------------------------------------------------------------- =head3 remove_files_dir Notes: =cut #-------------------------------------------------------------------------------- sub remove_files_dir { my ($file_name, undef) = @_; NodeUtils->runcmd("$::RM -rf $file_name", -1); if ($::RUNCMD_RC != 0) { NodeUtils->message('W', 'EMsgCannotDelete', $file_name); } } #-------------------------------------------------------------------------------- =head3 check_valid_sisdir Notes: Check whether the specified directory looks like an SIS directory return: 0 for false 1 for true =cut #-------------------------------------------------------------------------------- sub check_valid_sisdir { my ($sisdir) = @_; my @sis_subdir = ("images", "scripts", "overrides"); if (!(-d $sisdir) || (-l $sisdir)) { return 0; } foreach my $subdir (@sis_subdir) { return 0 if (!(-d $sisdir . "/" . $subdir)); } return 1; } #-------------------------------------------------------------------------------- =head3 move_sis_directory Notes: =cut #-------------------------------------------------------------------------------- sub move_sis_directory { my ($sis_csmdir, $sis_origdir); my ($cmd, $rc); $sis_csmdir = "/var/lib/systemimager"; $sis_origdir = "/csminstall/Linux/SIS"; my $sis_origdir_back = $sis_origdir . ".csmback"; my $sis_csmdir_back = $sis_csmdir . ".csmback"; # if /csminstall/Linux/SIS directory doesn't exist, there must be # something wrong while install SIS packages if (!(-d $sis_origdir)) { NodeUtils->message('E', 'EMsgERROR_INSTALLED_SIS'); return -1; } if (check_valid_sisdir($sis_csmdir)) { if (-l $sis_origdir) { # Check whether the /var/lib/systemimager link to # /csminstall/Linux/SIS directory my $target_dir = readlink($sis_origdir); if ( ($target_dir eq $sis_csmdir) || ($target_dir eq $sis_csmdir . "/")) { return 0; } } # Back the directory of /var/lib/systemimager to # /var/lib/systemimager.csmback and create a new link. NodeUtils->message('I', 'IMsgMOVE_DIRECTORY', $sis_origdir, $sis_origdir_back); if (!rename($sis_origdir, $sis_origdir_back)) { NodeUtils->message('E', 'EMsgERROR_MOVE_DIRECTORY', $sis_origdir, $sis_origdir_back); return -1; } $cmd = "$::LN -fs $sis_csmdir $sis_origdir"; $rc = NodeUtils->runcmd($cmd, 0); print $rc if $::VERBOSE; return $::RUNCMD_RC; } else { if (check_valid_sisdir($sis_origdir)) { if (-d $sis_csmdir) { # Back the directory of /csminstall/Linux/SIS to # /csminstall/Linux/SIS.csmback. NodeUtils->message('I', 'IMsgMOVE_DIRECTORY', $sis_csmdir, $sis_csmdir_back); if (!rename($sis_csmdir, $sis_csmdir_back)) { NodeUtils->message('E', 'EMsgERROR_MOVE_DIRECTORY', $sis_csmdir, $sis_csmdir_back); return -1; } } # Move the directory of /var/lib/systemimager to # /csminstall/Linux/SIS, and make symbol link for it. $cmd = "$::MOVE $sis_origdir $sis_csmdir"; $rc = NodeUtils->runcmd($cmd, 0); print $rc if $::VERBOSE; if ($::RUNCMD_RC) { NodeUtils->message('E', 'EMsgERROR_MOVE_DIRECTORY', $sis_origdir, $sis_csmdir); return -1; } $cmd = "$::LN -fs $sis_csmdir $sis_origdir"; $rc = NodeUtils->runcmd($cmd, 0); print $rc if $::VERBOSE; return $::RUNCMD_RC; } } return -1; } #-------------------------------------------------------------------------------- =head3 Main Programmers note: Basically there are 2 conditions: AIX or Linux. If this is AIX, then the first big "if" will be done, otherwise, go to the other "if" InstallOSName eq Linux. =cut #-------------------------------------------------------------------------------- { # main # initialize global variables &initialize; # parse the arguments &getArgs; my $runoption = "-1"; if ($::VERBOSE) { $runoption = "0"; } # if backup data is available in /var/opt/csm/csmdata then copy it to # /tmp so that it is not removed, and then mv it back so that it is not # removed. if (-d "/var/opt/csm/csmdata") { my $cmd = "mv -f /var/opt/csm/csmdata /tmp/csmdata.uninstallms"; NodeUtils->runcmd($cmd, -1); } # bad InstallOSName value if ( ($::ATTRS{'InstallOSName'} ne "Linux") && ($::ATTRS{'InstallOSName'} ne "AIX")) { NodeUtils->message('E1', 'EMsgUnsupportedOS'); } # AIX if ($::ATTRS{'InstallOSName'} eq "AIX") { # Remove the members of a Node Group NodeUtils->runcmd( "/usr/bin/chrsrc-api -i -s IBM.NodeGroup::\"MemberList!=''\"::\"MemberList::\"{}\"\"", $runoption, 0 ); if ($::RUNCMD_RC != 0) { NodeUtils->message('W', 'EMsgCannotRemoveNodegrpMembers'); } # Before we remove the nodes, we need to see if the license has been # installed yet. We can do this by checking to see if the "receipt" # file exists. Their are two places we can check: # /var/opt/csm/1.3/tryandbuy/license/status.dat # or # /var/opt/csm/1.3/full/license/status.dat # where 1.3 is the csmversion. my $statusDir = "/var/opt/csm/"; # now get the CSM version. We only take the version and mod. # so 1.3.0.1 -> 1.3 # and 1.3.2 -> 1.3 # and 1.5.0 -> 1.5 my $ver = $::ATTRS{'InstallCSMVersion'}; $ver =~ /(\d+)\.(\d+)/; $ver = "$1.$2"; $statusDir .= "$ver/"; my $tabStatusFile = $statusDir . "tryandbuy/license/status.dat"; my $fullStatusFile = $statusDir . "full/license/status.dat"; # if one of the above status files exist, then the license has been accepted. # this implies that there may be nodes defined. if ((-f $tabStatusFile) || (-f $fullStatusFile)) { # Remove the Node groups from the system NodeUtils->runcmd( "/usr/bin/rmrsrc-api -i -s IBM.NodeGroup::\"Name!=''\"", $runoption, 0); if ($::RUNCMD_RC != 0) { NodeUtils->message('W', 'EMsgCannotRemoveNodegrp'); } # get the node list my $myresult = NodeUtils->listNodeAttrs([], "Hostname"); foreach my $my_node (@$myresult) { push(@::My_NodeList, $my_node); } my $rm_cmd = "$::RMNODE"; $rm_cmd .= " -v" if ($::VERBOSE); $rm_cmd .= " -u" if ($::opt_u); foreach my $my_node (@::My_NodeList) { # Running the rmnode command my $mycmd = "$rm_cmd $my_node"; $myresult = NodeUtils->runcmd("$mycmd", $runoption); if ($::RUNCMD_RC != 0) { NodeUtils->message('W', 'EMsgCANT_RUN_CMD', $mycmd); } } } # the enclosed is only done if the lic has been accepted. # Now remove the CSM packages my ($my_package, $my_logfile, $my_cmd, $my_result); # remove the pre-defined-condresposes # this is done in csmserveruncfg # remove the CSM packages foreach $my_package (@::csm_uninstall_packages) { $my_cmd = "$::INSTALLPCMD -u $my_package"; $my_result = NodeUtils->runcmd("$my_cmd", $runoption); if ($::RUNCMD_RC != 0) { NodeUtils->message('W', 'EMsgCANT_RUN_CMD', $my_cmd); } } # remove the RSCT packages foreach $my_package (@::rsct_uninstall_packages) { $my_cmd = "$::INSTALLPCMD -u $my_package"; $my_result = NodeUtils->runcmd("$my_cmd", $runoption); NodeUtils->message('W', 'EMsgCANT_RUN_CMD', $my_cmd) if ($::RUNCMD_RC); } } # LINUX if ($::ATTRS{'InstallOSName'} eq "Linux") { # For Linux we just remove the CSM packages # We don't remove any nodes, because they will get removed with # the packages. # Exit if csm.director.agent is installed, because it has # a prereq on rsct.core.utils. NodeUtils->runcmd("$::RPMCMD -q csm.director.agent", -1); if ($::RUNCMD_RC == 0) { NodeUtils->message('I', 'IMsgUNINSTALLMS_NOT_UNINSTALLING'); NodeUtils->message('E1', 'EMsgUNINSTALLMS_RUN_RMLCSEXT'); exit 1; } # If -u option is used than than run rmnode command if ($::opt_u) { # get the node list my $myresult = NodeUtils->listNodeAttrs([], "Hostname"); foreach my $my_node (@$myresult) { push(@::My_NodeList, $my_node); } my $rm_cmd = "$::RMNODE"; $rm_cmd .= " -v" if ($::VERBOSE); $rm_cmd .= " -u" if ($::opt_u); foreach my $my_node (@::My_NodeList) { # Running the rmnode command my $mycmd = "$rm_cmd $my_node"; $myresult = NodeUtils->runcmd("$mycmd", $runoption); if ($::RUNCMD_RC != 0) { NodeUtils->message('W', 'EMsgCANT_RUN_CMD', $mycmd); } } } # remove the packages my (@uninstall_packages, $my_cmd, $my_package, $my_result); foreach (@::csm_uninstall_packages) { push @uninstall_packages, $_; } #don't remove rsct if rsct.basic is installed NodeUtils->runcmd("$::RPMCMD -q rsct.basic", -1); if ($::RUNCMD_RC == 0) { $::rsct_basic_Flg = 1; } else { #don't remove rsct if csm.client is installed NodeUtils->runcmd("$::RPMCMD -q csm.client", -1); if ($::RUNCMD_RC == 0) { $::csm_client_Flg = 1; } else { foreach (@::rsct_uninstall_packages) { push @uninstall_packages, $_; } } } foreach $my_package (@uninstall_packages) { $my_cmd = "$::RPMCMD -q $my_package 2>&1 > /dev/null"; $my_result = NodeUtils->runcmd("$my_cmd", $runoption); if ($::RUNCMD_RC == 0) { # If it is installed, uninstall it $my_cmd = "$::RPMCMD -e $my_package"; $my_result = NodeUtils->runcmd("$my_cmd", $runoption); NodeUtils->message('W', 'EMsgCANT_RUN_CMD', $my_cmd) if $::RUNCMD_RC; } } } # Both AIX and Linux # Is rsct.core installed? my $rsct_pkg = "rsct.core"; my $cmd = "$::RPMCMD -q $rsct_pkg 2>&1 > /dev/null"; NodeUtils->runcmd("$cmd", -1); # Clean the rmsr table if rsct.core is still installed if ($::RUNCMD_RC == 0) { # not adding messages - runcmd should show in the log. my $RMSRTBL = "/usr/bin/rmsrtbl-api"; # ManagedNode $cmd = "$RMSRTBL /IBM/ManagedNode/Resources"; NodeUtils->runcmd("$cmd", 0); # DmsCtrl $cmd = "$RMSRTBL /IBM/DmsCtrl/Resources"; NodeUtils->runcmd("$cmd", 0); # NodeGroup $cmd = "$RMSRTBL /IBM/NodeGroup/Resources"; NodeUtils->runcmd("$cmd", 0); } # remove the log files package foreach my $my_logfile (@::csm_logfilelist) { &remove_files_dir($my_logfile); } # Display a list of the files, Directories and packages that were not # uninstalled (because they were not installed by installms) NodeUtils->message('I', 'IMsgDidnotRemoveDir', join(', ', @::csmUninstallList_Directories)); NodeUtils->message('I', 'IMsgDidnotRemovePkgs', join(', ', @::csmUninstallList_Packages)); NodeUtils->message('I', 'IMsgDidnotUninstallOpenSrcPkgs'); if ($::rsct_basic_Flg == 1 || $::csm_client_Flg == 1) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgDidnotUninstallRsct'); } NodeUtils->message('I', 'IMsgDidnotUnconfigureRemoteShellServer'); # put csmdata back if (-d "/tmp/csmdata.uninstallms") { NodeUtils->runcmd("mkdir -p /var/opt/csm/", -1); NodeUtils->runcmd("mv -f /tmp/csmdata.uninstallms /var/opt/csm/csmdata", -1); } exit 0; } k~0PB7u4pp~App~App~A 4./opt/csm/codebase/WebSMCSMcore.jarAppCPKT]Z1 META-INF/PKPKT]Z1META-INF/MANIFEST.MFMLK-. K-*ϳR03r.JM,IMu *hx:*8%jrrPK7.=>PKA1*com/ibm/csm/bundles/guiCSMAppsBundle.classUmSW~V^vY7|FT /MX@+h$% t RX:6;:13i'~lgڞ,v‡<9gsι˻8DQ(BD|&pf<xD<#5dž^ؒbM[6'v|[qprQ?Ij%a]flɅ*±d*MBL"dRY<ش X<%ax~mEWCZ"\&,gO&k};;MeAdJEsJU-PjĪjq7wɥ+jJZ*唜eAF?Z|vkj`+(8;zZ3y5|VkHRy2&|pdžbAw=peUcyxS݅\j4;@e~JJZs0%&9b@J15@%X&rSJk>ǬY mǞ<'!*V{{JY}E/lGfMnŨeBb(e%$Z3kb$6Hb`XԊz+thTjj:zj/W!)(Ri*yzp)rqގ0UĬO]4>nTR]ӾU"0Miy!ſH3J@H@Sy=$Pi-Н`u-N;mɴ;ue.\'mnH&_.K4{:H}'KPKz@ywA PKA10com/ibm/csm/bundles/guiCSMMonitoringBundle.classx[u%DEQ|$5)QӒb"a  0IQbx$acd#{8p;N8pd);VҴ[7MMG:ґt#I[;wA\$?߹^z oR[Q.m.N n pJxK$|P‡$|XG$<(>&OHxD'%|J£>-3Y KK/JxB—$\+JH&) %|Url[ nSTjrvbw{ȩsL4#$}4JDRwkh+RtH)>)Kq@RtI-ERI/ŀRCRǤ8. )NJq8-)^!R"ŭR KqV)FHq8/Wۥ ŘRK1!+HbLLiUԌm.Q30L'#*GTڌhz.Nz'ɷfǼ ȟ:6Q`=^ߤ'zǼ3NFKJz|Al'5Joqn5w]\?5 DTbq;g6Zo Bdޏ[!zFI]ChbczgS(d{> jtlG"Ogq[!ڍQzgo]FI1MMOri\=aIGLD%vFp`p3;McN!]۠TjNz.nQd϶8{O3?,"z%T`$[H6(U`=SF.zqR{7Vi7ov8>PH)5:צjR*1VphFމItd8殙 1)|6x:MtI;{sw[4=fc+$CL<3Htp} JDd+I1j,|؜4稐 Vz9V͝ }x*ۻTxGI4x-B]WŹc`L%7V8қQl,(h85]Ig]۠XPl,WD}p`S&rي-@$orGfkX^2wp%sgkXޚaѶA~ [VGi@UlnJoyo0{uxõw{`!;Fۨ$77"* nsUp6O];뺺 1ЍƭT\@qkAɞ'ph gOS;/1x3:ANp[2D;P!+ xY@< 7J"sP*60g ܯ7 qTZymZJG x 3UL\:EB̊S=:sx9U~/ a# aM쳪ctÿl%# ^pVR1 ;7sLz`1SD4dh%aF^9Ē4"HzG‹b[1tbs1n4vt7Ç:qԮsDf =`{N40#5rOv=l~öl3c3fA5a$iijix VzC;䰂pxm|t5/ôT+X2LĶӋJSTg[{`pO[Ux纾:ʪYe6bTNG +̭+,MHj)j㛽hJQy3^1A[x25͛BWBM~'1.+e-;ZqU"f k,:ӔmZWVȾѥl0l@aV,Ǻcks(D**o2FڼfI!E^DrֱV h:۞f4+qw"׃cQk#Zc>*G7 asf c#1ˮ"l$o>; 2n(Q+W=u##Ku돇-˖,x}F0=7垌aӧm]޲c gD D}#,R7:ZR7_4mi ;BzPco[WI N`)TeNgm/&kd6&7ȝK<~ @;7A ތ7淠r)oմ 4].AMOeߩi].GnMQG;P߯ t%iz'k 4]MBAMנwkQD{P?:^t=k{HӍtOh#nAIMP?i5ݎ3@;QVP???部._t7'4݃KE}Y}t?+@}UӃCèizS>~ZQ?8o篢jz{(y ēCgmuxNn:]c [̰/# [&Ö2,-aiJE--gXZpͰnmP~a+2l%dXǰU K [Ͱ}Ű" [ðdǰvdak֏1Dag˰w"}gʰ 1l#Ɛsmb$ aE/a__1lþٿfXaCoaG  ɰ"w aFv?>?0}1A}d.?1l7^GaE_a ǰ# ϰBva3 ~`C }d̰'1/=°?B(þ011?a dʰ'%daOnd]EmU|n'+奵RTE5LSڧkc2F޷þQn O\- 69lgTj{J.vһ^,!*jo5y-֫p&wIŻ@TN@(N=7hhfxFPS<4~bOy xfp kb[ގ\7 фB986:;t 0ԸBk]p]q\ EIE/&=VfJWpOeGD%dLQR2^F2!!Q)'gl)rY;ș&\9\$ǭJr grv3CNry9ʩ&9;WSr^CNrv1SKΝ(g9VN9wSQN=9s)9{HNz4cӠfriTN 9 4)ErFNMNrɹ6t%PN'91rڕ89ONN g}9Hϑ_9]$9nrRTN9irKNnLNrY!W9伖> JNr:rs'gP9CK!!9"9C9F/sD9er*sL9'y}0xn+~ۮ2DPK Z.PKA1com/ibm/csm/apps/Cluster.classSkO`~^(˼\mv !D:kui;bb4 I9yyzN Eí~ % CZ E2rG[HߛLn6kZ9ڢlì@v<. з4@t6zN^i7nVkvP]HNDdZ}_v@~Cm+X2nlzdTl[v+pP`PJɲ6 00nHdTV_ڞMYO{Ѫ3B2?kn۳NXo8.@R1F)@;|8(0|\kYn l|c:v 7~XUY SOQ"Qr*/h'4v Co7d]xh>ص&l!W0\lN](/dZҊWxZfs(;lp ٔj8u=wٓlc¬0+& ` Co=H~_(m1ފG ҉g'D>8>.@/ILj]B'rEC-a3KџP^!VI|#](mX :dq^H}Z:MI=bU{8W9(G sc{dqd}/Ho9`IM|hgDh 1PKxiPKA1'com/ibm/csm/apps/ClusterContainer.classX x'>vYFA RlBV$ccky-+jĴ-P(-wi))9-p\ Rz}7+Y|_xw{o޼7yՇfvbZ%&a. J؊wx\KĻ%z_> +pBĕq'}@"A\ˉqKQ|LQ:׸Y-"nc26|?nI|J;D33w >E|V9}ܻ/I%lC|rN<,<|@$|xBxJėixVl438)՝PS1wX7C/jR9Ms utfZ& 34fT]K͆դePtKwhc٤[3!-ju{|7_5E&56 GXc&tʘԌxx*np{sjcz|<#Z6O˦36Q-ϏtBsgX<7C5rK&[}q!Oi\rLձQiFoux`Xrx.'ѡ9DLx]dZAL=l&Ns Rܹ+_$wFAN e mCZ*TǴPJKSS .t:bUɇǦF|bfOZJ2WyUnotÚEA9ܪMw[串IҦ2tV 񬠯lQIU BO&0ҮH:G-q+"&0TJy5xAWLa8mlIRl"xg Mmb.EKqC 6U"Vac6Wq_Klб(0@j"pba1UqMk&l ƾMA*bGZl{@4 GF#^o4 yiØУ8Ř>Ȩhp?~@ࡒlaظp9;I]SIF/COd?sB/e E M YzMEH%ޞm*?2?o"CY A2O bDV'b7WoEP'0If)l0'=^q3R@C餑ڂ ͺy'^Rɖ\;"ZNQNfEQsX.}XLkWxF˖3 /v?7ylrwmvoR:;=T;W跔!ҵqc; _ɛHI.#5Ɓ dӋasSx +ܤr1+iKZrzHRT /7P?lP1'^[MrȠ`'zGFސt Q%!xM^UNpOIU4Vb;5İ '-(oY`BۂjZoN:rJ^Yω8W $*VDIdTRgIM5B}`&j,)hc9ڤ825$k,y!; mYAt.S8++NPF~^Bpqū'-TP;£m]eGitHLvpTHJ`s.B:ֶr&l(kbHu?O}JU~*<*(-Ȟ\io?qvt0oau4oe-Z{Mk /ڃԲXU`z'(K\lPU"0%7l[4{9B _@jmkpVϢv/4lBN#Жق*sfY}{ )#Q D<=E}+H89M8oEݨ5gsXA:shqYjkQJ8*t'L8Ĭ.rKf{ E.Dn ȅ126F(bތ$ZkMJ*I-395i@rfLO#Eʏ/c)WͩbkfW}y u,Fh}XV1ݏ4ú h@p)tkp-)c]HNٿu<5 ĉ<=Ozge7*bv8h1 +=>ọk:I)d ^ Na8uu0HBnS1.,n`HWd]$&D 4YO>9HB$Ǩf$ҜDbKrW%ZBɀ(HL۶v%{ƾՍFM[]Q[a4Pto4MQ03kv(-2јrU (\tv8;eW[vF$^~nxުa#UU0o`V+[*"7b˷&Džb͡ɛC$Z4QCI)YU[;UlGiϟWrРzIĒݬ6N5[+u`|5((N#q`]9hMg4 _5=[5MO%MK(|)OP~ǀ<BNKO瘤1!<2(@ ;woC P"|^St>bqz(RIH?0p0/9(/( t4eH~G>'R;rx]=؜PK(PDPKA1(com/ibm/csm/apps/NodeHostContainer.classW|<,DB";xJDJ^ g󠀇O(a_A3>$z\|Tģ1; 8,2`VO)$seQO Xq x$O'[%N.$9@[1M}L?e7K/Ҕy{kO\6:hLQ5LT`Ee"t3tztٸD?-^feil6&=hr gͮȚ2f2AQmD R}CcxOЌAkt.6m(2w6.@0 qT:y c@yᔼ >>TV'2B; Yٳ!Rt:cVt7TXؐͪMǙ|\jL+QOfD'.5xmC?rW*[3Pԧe+.M\s a$](6 7bq}ykf!9#4-i2]NQEA^Gt@CD od+u.`V;kH8g3(*~uCE r'0F?ϢcŷɌow^Z^Zw&yOt .".1rdfp(3<O^@PCt.I.1rW14pUC(|cX\ 'a:9r7dzK"{ *Yi:L*zjX-Ep+kc+8"SA^EYC- b,~O uxzD2I|"N/;RVݬ0/e-mAֆ.L콹`T%Px|;-vrσ^@%;հLI%YRqW q0=ߛk< :J+טPKґ PKT]Z1 META-INF/PKT]Z17.=>=META-INF/MANIFEST.MFPKA1z@ywA *com/ibm/csm/bundles/guiCSMAppsBundle.classPKA1 Z.0com/ibm/csm/bundles/guiCSMMonitoringBundle.classPKA1xiCcom/ibm/csm/apps/Cluster.classPKA1r G'com/ibm/csm/apps/ClusterContainer.classPKA1(PD#com/ibm/csm/apps/NodeHost.classPKA1ґ (&com/ibm/csm/apps/NodeHostContainer.classPKw1(HL kP0PB7u2b@2b@2b@ ./opt/csm/csmbin/add_KRB5principalsAppC@b2H FT) /`( | /1L.text((FT(|z .data | |)G|w@.bss 1X 1X.loader !qX"(|nx|#x|+x|1B,9 e)-*@H`HDHA|nxAA| QN!AL9}sx}{x~xH` ,Ab$HEA| @__start!|bA,H ,A <cA|CN!Ab,Ac|CN!Ab,Ac|CN!Ab,Ac|CN!Ab,Ac|CN!AH8!@}N 8!@N A__threads_init@b0|!cHHEAH8!@}N A,call_pthread_init84A L| N HA L| N |AP!aD8``8HmA88HA\`~HAhBl8hecCH49`,c@aDH||yz@ H `|z,@;H`z~888H9A`dcccH:AzH8qAch8!`A}N hAH8!`}N A(main!|P`;!@a@8@8aH8`8D8aH8`8ap88LHAq`8a88LHA]`b<DHcac8pH8a88@Hm`8a8@(/@dH `8@8aHA,8aA@HA`z88a8H `8a8HA,AH;|@88a8Ap8`8!!}H8!!}N aKAb\8 d88 cHaA`da8HuA8`K A checkpath|!0`;8`[H At8a8H`8aH I`8L8aH 9`8,8aH )`88aHy`8aH `8T8aH `8(8aH `8@8aHAA\<8,| 8a8LDBAH UA,808a@pHA,@8`8!л}N Kb\8 8c8H݀A`dc8HA8`H(8a84HyA,@;c8!л}N ASetupLogpA L| N xA L| N |A L| N A L| N A L| N A L| N A L| N b8qA||+|"*AH|8@@@@|A LHp|+|*A$0|8@@@|+@P@D|*@|, TA|0|0|8@H|8@|0}0@@@ LAA 8`N 8`N 8`N 8c8,|0@A@,|0@KAA8`N 8`N 8`N @strcmpA L| N A L| N A L| N A L| N A L| N b8 qA(||"+|*M |+|*0 @N p=@!k9J}i|exA ,8M 8B0|P8})P},P@4} P8})P},P@,|P8})P},PA})8})PyAH})@})PyA}Cx8tT@>@N @strcpyA L| N A L| N A L| N A L| N ĐA L| N ȐA L| N ̐A L| N АA L| N b8qA||+A|+0@|0|8|4@|"+|*80@N 4A$||"+|*M |8|)N |N T`,/|fxA80AA,A`,AT,AH0}@Py=`01k@&}*X8}JX}@XK}JH}JXyA}L4U|`/T,/|M 00AHAA,,M B@$, &M B@D, FM B@x$D,,/ /M B@LM B@@&M B@4FM B@($D,,/ /K8N @strncatԐA L| N  A| KkN @_ptrglܐA L| N A L| N A L| N A L| N A L| N b8 qAH||+A|+0 @|0|8 ||"+|*8 0 @N pk=@!k9J}i8A,AP8B8} P8})P},P@} P8})P},PA})@})PyA}+4Uk|Xp!k}iA ,8M 8B耤0|P8})P},P@4} P8})P},P@,|P8})P},PA})(})PyAH})@})PyA}Cx8tT@>@N @xstrcatb8q8A||04@T|+|*@0|||(8|894@|*0K0||*N 0||+|*AN /T,/|M 00AHAA,,N@ A,N@ A$, %N@ A$,,//N@ ALN@ ALN@ AL%N@ AL$,,//KBN BN BN %BN @strncpyA L| N A L| N A L| N H @memsetA L| N A L| N АA L| N ԐA L| N @(#)23 1.4 src/bos/usr/ccs/lib/libpthreads/init.c, libpth, bos520 8/19/99 12:20:14@(#)61 1.14 src/bos/usr/ccs/lib/libc/__threads_init.c, libcthrd, bos520 7/11/00 12:04:14 / /tr@:/w-h-h QUIETWRFILEWRFILEWRFILENOQUIETdefaultdefault.keytabcsmKRB5.catkadmin/adminkrb5_kt_closedefaultkeytablekrb5_kt_resolvedefaultkeytablekrb5_init_contextkrb5_init_contextkrb5_kt_add_entryadd_KRB5principalskadm5_get_principalkrb5_kt_default_namekrb5_get_default_realmkadm5_create_principalkadm5_modify_principalkadm5_randkey_principalkadm5_init_with_password%1$s principal created. Usage: add_KRB5principals [-h] 2657-035 The %1$s file is empty. /var/ct/IW/sec/krb5/csm/k5keytabsThe %1$s principal already exists. Enter the KRB5 administrator password:2657-014 Could not open file = %1$s. 2657-014 Could not open file = %1$s. 2657-028 The %1$s file does not exist. Creating %1$s principal with no policy. Enter the KRB5 administrator principal name:Creating %1$s principal with default policy. 2657-001 This command invoked as : %1$s %2$s 2657-001 This command invoked as : %1$s %2$s Please enter a valid KRB5 administrator name: 2657-005 %1$s exiting with return code = %2$d. 2657-002 Not valid argument : %1$s was entered. 2657-002 Not valid argument : %1$s was entered. Please enter a valid KRB5 administrator password: /var/ct/IW/sec/krb5/csm/k5keytabs/addprincipals.tmp/var/ct/IW/sec/krb5/csm/k5keytabs/addprincipals.tmp/var/ct/IW/sec/krb5/csm/k5keytabs/addprincipals.tmp/var/ct/IW/sec/krb5/csm/k5keytabs/addprincipals.tmp/var/ct/IW/sec/krb5/csm/k5keytabs/addprincipals.tmp/var/ct/IW/sec/krb5/csm/k5keytabs/addprincipals.tmp2657-034 chmod command on file %1$s did not succeed. 2657-049 %1$s The principal name or password may not be correct. 2657-038 Could not establish a writable operations routine for krb5_kt_add function. The key for the Management Server is stored in the default keytab as defined in krb5.conf. @(#)41 1.12 src/csm/krb5/api/add_KRB5principals.c, setup, csm_rveg, rvegs002a 5/21/04 11:59:092657-050 The contents of the %1$s file are not in the correct format. Run csmconfig -K with your option to regenerate the file. 2657-051 The keytab file %1$s for the %2$s principal is missing. You must delete the principal from the KRB5 database and run definenode or csmconfig -K with your option to recreate the principal and keytab file. 2657-052 The keytab file %1$s for the %2$s principal is empty. You must remove the empty keytab file, delete the principal from the KRB5 database and run definenode or csmconfig -K with your option to recreate the principal and keytab file. ####################################################################### # Licensed Materials - Property of IBM # # # # 5765-E61 # # # # (C) COPYRIGHT International Business Machines Corp. 1996,2001 # # All Rights Reserved # # # # US Government Users Restricted Rights - Use, duplication or # # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # # ####################################################################### aar#r+ 'L.log.bak%1$d QUIET[libs]libkrb5%15.15s libkrb5*hdb_kt_opslibkadm5clnt/var/log/csm//var/log/csm/krb5_kt_closekrb5_kt_closekrb5_kt_closekrb5_cc_closekrb5_kt_resolvekrb5_kt_resolvekrb5_parse_namekrb5_parse_namekrb5_cc_resolvekrb5_cc_resolvekrb5_cc_destroykrb5_cc_defaultkrb5_cc_defaultkrb5_kt_defaultkrb5_kt_defaultlibkrb5admclnt*krb5_svc_get_msgkrb5_svc_get_msgkrb5_free_stringkrb5_free_stringkrb5_kt_registerkrb5_svc_get_msgkrb5_svc_get_msgkadm5_get_policykrb5_init_contextkrb5_init_contextkrb5_kt_get_entrykrb5_kt_get_entrykrb5_free_contextkrb5_free_contextkrb5_kt_add_entrykrb5_kt_add_entrykrb5_kt_next_entrykrb5_cc_store_credkrb5_cc_store_credkrb5_cc_initializekrb5_kt_free_entrykrb5_kt_free_entrykrb5_kt_end_seq_getkrb5_free_principalkrb5_free_principalkadm5_get_principalkadm5_get_principalkrb5_cc_default_namekrb5_cc_default_namekrb5_kt_default_namekrb5_kt_default_namekrb5_kt_default_namekrb5_kt_start_seq_getkrb5_ktf_writable_opskadm5_free_policy_entkrb5_get_default_realmkrb5_get_default_realmkadm5_create_principalkadm5_create_principalkadm5_modify_principalkadm5_modify_principal/usr/krb5/lib/libkrb5.a/usr/krb5/lib/libkrb5.akrb5_sname_to_principalkrb5_sname_to_principalkrb5_free_cred_contentskrb5_free_cred_contentskadm5_randkey_principalkadm5_randkey_principalkrb5_build_principal_extkrb5_build_principal_extkrb5_kt_read_service_keykrb5_kt_read_service_keykadm5_init_with_passwordkadm5_init_with_passwordkadm5_free_principal_entkadm5_free_principal_ent/etc/opt/csm/csmkrb5.conf/etc/opt/csm/csmkrb5.conf/etc/opt/csm/csmkrb5.confkrb5_get_init_creds_keytabkrb5_get_in_tkt_with_keytabkrb5_get_in_tkt_with_keytabkrb5_free_keyblock_contentskrb5_free_keyblock_contentskrb5_get_init_creds_opt_init/usr/krb5/lib/libkadm5clnt.a/usr/krb5/lib/libkadm5clnt.a/usr/lib/libkrb5.a(libkrb5.a.so)/etc/opt/csm/csmkrb5.conf.default/etc/opt/csm/csmkrb5.conf.default/etc/opt/csm/csmkrb5.conf.default2657-014 Could not open file = %1$s. 2657-026 Call to %1$s returned: %2$i. 2657-024 Call to %1$s returned: %2$s 2657-013 Call to %1$s had error: %2$s krb5_get_init_creds_opt_set_default_flags/usr/lib/libkadm5clnt.a(libkadm5clnt.a.so)2657-004 Could not create backup log: %1$s 2657-007 Call to %1$s had error return: %2$i. 2657-007 Call to %1$s had error return: %2$i. 2657-007 Call to %1$s had error return: %2$d. 2657-011 Could not create the directory: %1$s 2657-009 Error on dlopen of library: %1$s errno=%2$d 2657-009 Error on dlopen of library: %1$s errno=%2$d 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. @(#)48 1.11 src/csm/krb5/api/k5utils.c, setup, csm_rveg, rveg0414a 3/25/04 13:01:162657-036 The file %1$s line $2$s has syntax error. Full path to library is not provided. 2657-032 The %1$s and the %2$s configuration files do not exist. Cannot determine the path to the KRB5 api libraries. 2657-031 Could not find the %1$s shared library.For Linux, check path to library named configured in /etc/opt/csm/csmkrb5.conf.default. For AIX, check /usr/krb5/lib directory. If missing, install the KRB5 api library. 2657-031 Could not find the %1$s shared library.For Linux, check path to library named configured in /etc/opt/csm/csmkrb5.conf.default. For AIX, check /usr/krb5/lib directory. If missing, install the KRB5 api library. 2657-031 Could not find the %1$s shared library. For Linux, check path to library named configured in /etc/opt/csm/csmkrb5.conf.default. For AIX, check /usr/krb5/lib directory. If missing, install the KRB5 api library. 2657-031 Could not find the %1$s shared library. For Linux, check path to library named configured in /etc/opt/csm/csmkrb5.conf.default. For AIX, check /usr/krb5/lib directory. If missing, install the KRB5 api library. ####################################################################### # Licensed Materials - Property of IBM # # # # 5765-E61 # # # # (C) COPYRIGHT International Business Machines Corp. 1996,2001 # # All Rights Reserved # # # # US Government Users Restricted Rights - Use, duplication or # # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # # ####################################################################### ( / / / /h 1X   4 @ 1\ 1` 1d 1h ( 1p 5p 7p 9p 9t 9x 9| 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 : : : : : : : : : :$ :( ?( ?, ?0 C0.wb  f@errno@chmod@ mkdir@ rename@ @ umask@ @_iob@_Errno@ exit@ strlen@ fopen@ strchr@ fprintf@ catopen@ catgets@ 4@ B@ fclose@ sprintf@ strncmp@ strrchr@ fputc@ fgets@ isspace@ getpid@ fgetc@ stat@ fputs@ ctime@ time@ N@ setbuf@ Z@ f@ dlopen@ dlsym@ ctermid@ feof@ r@ __crt0v@@@@ __start /`! 4 8  p /` /d /h /l /t /x / / /, /. // / /- / / /+ / / /# / / / / / / /) / / /$ 0 0 0 0 % 0  0& 0  0 0  0$ 0( 0, 00 04 08 0< 0@* 0D 0H 0L 0P 0T 0X 0\" 0`! 0d' 0h  0l( 0p 0t 0x 0| 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1  1 1 1 1 1  1$ 1(  1, 10 14 18 1< 1@ 1D 1H 1L  1P 1T /usr/lib:/lib:/usr/ibmcxx/liblibc_r.ashr.olibpthread.ashr_comm.olibpthread.ashr_xpg5.o ___memset sigprocmask_system_configuration sigemptyset sigaddset setlocale tcgetattr tcsetattr __mod_init__malloc_user_defined_name__pthread_trace pthread_init*^>@BBJ``Pnlp(pfDF- Vh:X^Z\^j bZfbdnr27xz< ~`|AFKr,<Pdn!"$&x@XAlF"!AF"!0ADFTPhAFAF&֏<!Trď!AFΏ  (A 8F Z& n  !  ʏ !   !  0 :ڏ L! dU | Z     ڏ !  ڏ !  (  8  H  Rڏ d! |   Ə !   , h!  !    0 @  L_      d A$FLFXKhiAFr 0@PZ,dr.|"&PxAF<FxXAlF؏!.8!P^d!x0AnA,FHhAxnAF ȏ@!Xd|AF!$"̏6ЏH!^ҏp!dAFsx0_H`}}   x,_D\}} 8ALFdsK !!"rLh xAzFAF"04AHFxx0AFAzFBtjv|dș$4DXl͙ҙ4Hҙ\hKr P4DdXPpdxAFsx0xD_Xh}}}4L}|PUU U 0U Hs d ~x A F  x A! F!6x!HA!`F!zx!A!F"&"4!"Bx"F"`A"xF"A"F"A"F#>#L!#Zx#^#xA#F#A#F#A#F$PÙ$\$f$tF$~x$A$~$F$% %P%*%4%Hי%jx%|A%%F%x%A%F&ܙ&&:x&LA&dF&ܙ&ď&x&A&F&ܙ'Ə'"x'4A'LF'lܙ'vȏ'x'A'F'ܙ'ʏ'̏(Ώ(ܙ("Џ(<ܙ(Fҏ(`ܙ(jԏ(x(A(F(ܙ(֏(x)A) F)))P)))י)x* A**0F*Zx*lA*F*ܙ*؏*x*A*F+ܙ+&ڏ+>x+PA+hF+ܙ+܏+ܙ+ޏ+ܙ++ܙ++ܙ+,ܙ,ܙ,0ܙ,Dܙ,N,fx,xA,F,ܙ,,x,A-F-,ܙ-6-Nx-`A-xF-ܙ--x-A-F.ܙ..6x.HA.`F.ܙ..ܙ..ܙ..ܙ.ܙ./x/A/0F/Xܙ/b/zx/A/F/ܙ//ܙ//ܙ00ܙ00,ܙ060Nx0`A0xF0ܙ00x0A0F1ܙ116x1HA1`F1ܙ11x1A1F1ܙ2 2x20A2HF2pܙ2z 2x2A2F2ܙ23x3A30F3Xܙ3b3zx3A3F3ܙ33x4A4F4@ܙ4J4bx4tA4F4ܙ44x4A5F5(ܙ525Jx5\A5tF5ܙ55Ώ5ܙ55x5A6F6666_747P 7`P7t_777x8A8$F8t8~88 8 8 88 8 8 9P949Ld9x9A9F9d::::b:::;;@;BJ>r>>>??:?b??AABB>BfBBB BDDF:FbF FFF(G*G.2GV4 4@ 8T n p /`8 /d\ /h /l\ /tP /x\ / /H /X / / / /Z /R /> /V / /n /F /$ /r /t /: /v /x /R / / /H 0( 0* 0 0 J 0 0L 0@ 0  0 < 0$4 0(, 0, 00 04> 08& 0<" 0@T 0D6 0H 0L2 0P8 0T0 0X 0\D 0`B 0dN 0h 0lP 0p~ 0t 0x 0| 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0z 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1  1 1 1 1 1  1$  1( 1, 10p 14| 18 1<  1@  1D 1H 1L 1P. 1T !+errnochmod mkdir rename 6 umask B_iob_Errno exit strlen fopen strchr fprintf catopen catgets X d fclose sprintf strncmp strrchr fputc fgets isspace getpid fgetc stat fputs ctime time n setbuf x  dlopen dlsym ctermid feof  __crt0vTOC /k /k__crt0v /k /k /k_$STATIC /k /k_$STATIC /k /k /kerrno /k_$STATIC /kn /kcatopen /kcatfd /kprogname /kgetpid /kpid /k /kctermid /k_$STATIC /kfopen /ksetbuf /kX 0kd 0k6 0kx 0 kB 0k 0kfputs 0k 0kfgetc 0 kfputc 0$kfclose 0(k 0,k 00kstat 04kcatgets 08kfprintf 0<kfeof 0@kfgets 0Dkstrlen 0Hkstrrchr 0Lkisspace 0Pkstrncmp 0Tk 0Xktime 0\kctime 0`kdlopen 0dk_Errno 0hkdlsym 0lk 0pk0 0tkI 0xk_ 0|kz 0kpolicy 0k 0k 0k 0k 0k 0k 0k 0k 0k1 0kF 0kZ 0kp 0k 0k 0k 0k 0k 0k 0k 0k 0k) 0kC 0kZ 0ko 0k 0k 0k 0k 0k 0k 0k1 1kD 1k_ 1kq 1 k 1k 1k 1k 1k 1 kmkdir 1$kumask 1(krename 1,k 10k 14k 18kstrchr 1<kchmod 1@k 1Dkkeyname 1Hk_iob 1Lksprintf 1Pkexit 1Tk 7g'J g.__start(k.__start(8__start /` 4k p_xargc /p_xargv /p_xrcfg /p_xrc / 1X.file`g2qk N_$STATIC kZ /t   / / / / /.fileg1fk.main d d d d_$STATIC @k  :(kcatfd 1\progname 1`pid 1d 1h 9 ?( 9t 90 9x 9 ?, : :$z 9q : 9I 9| : ?0keyname C0 9 9 9_ 9policy 9 9 91 : 7p 5p 9 :  : 9 9o 9Z 9C 9D : 9p : 9 9 9) 9 9 9 9 9 9_ : p 9F 91 9Z 9 9.filegkX _$STATIC kU /h   /.file g0ZkXt ~ " # $8 $ ) 6p 8T _$STATIC (k7 1pkstrcat.s g.strcatB)strcpy.s g.strcpy=@)strcmp.s g.strcmp;@0) g.strncat?) g.strncpyD)memset.s g.memsetF)ptrgl.s% g._ptrglAk0._ptrglA.$PTRGLAglink.s* gk(&glink.s/ g.exitGTk(.exitGT+glink.s4 g@k(@0glink.s9 g.catopenhk(.catopenh5glink.s> g.getpidk(.getpid:glink.sC g.catgets>pk(.catgets>p?glink.sH g.fprintf>k(.fprintf>Dglink.sM g.fclose=k(.fclose=Iglink.sR g.stat>Hk(.stat>HNglink.sW g.strncmpAk(.strncmpASglink.s\ g.strchrFk(.strchrFXglink.sa g.strlen?k(.strlen?]glink.sf g.fopen:8k(.fopen:8bglink.sk g.chmodGk(.chmodGgglink.sp g.sprintfG,k(.sprintfG,lglink.su g.feof>k(.feof>qglink.sz g.fgets>k(.fgets>vglink.s g.isspace?`k(.isspace?`{glink.s g`k(`glink.s g.mkdirF8k(.mkdirF8glink.s g.renameFk(.renameFglink.s g+:k(+:glink.s g.umaskF`k(.umaskF`glink.s g._ErrnoBk(._ErrnoBglink.s g8:k(8:glink.s gE:k(E:glink.s g.strrchr?8k(.strrchr?8glink.s g.fputc<k(.fputc<glink.s g.fgetc<k(.fgetc<glink.s g.fputs<k(.fputs<glink.s g.ctimeB<k(.ctimeB<glink.s g.timeBk(.timeBglink.s g.setbuf:`k(.setbuf:`glink.s gP;k(P;glink.s g[get_OSDefs(); $::pkgname=""; $::pkg_name=""; $::PREREQS_ATTR{'OSName'} = InstallUtils->get_OSName; #AIX/Linux $::PREREQS_ATTR{'DistributionName'} = InstallUtils->get_DistributionName; $::PREREQS_ATTR{'DistributionVersion'} = InstallUtils->get_DistributionVersion; #5.1.0/7.1/7.2 $::PREREQS_ATTR{'PkgArchitecture'} = InstallUtils->get_PkgArchitecture; $::PREREQS_ATTR{'OSTypeVer'} = $::PREREQS_ATTR{'OSName'}.$::PREREQS_ATTR{'DistributionVersion'}; $::PREREQS_ATTR{'CsmCoreVersion'} = InstallUtils->get_CSMVersion("csm\.core"); if (length($::PREREQS_ATTR{'CsmCoreVersion'})==0) { NodeUtils->message('E2', 'EMsgNO_CORE'); } if ($::PREREQS_ATTR{'OSName'} eq "AIX") { my $temp_distro = $::PREREQS_ATTR{'OSName'}.$::PREREQS_ATTR{'DistributionVersion'}; if (!grep(/^$temp_distro$/,@::VALID_AIX_DISTROS)) { NodeUtils->message('W', 'EMsgUNSUPPORTED_AIX_DISTRO', $temp_distro, join(', ',@::VALID_AIX_DISTROS)); } else { NodeUtils->message('V', 'IMsgDETECTED_AIX_DISTRO', $temp_distro); } if (!grep(/^$::PREREQS_ATTR{'CsmCoreVersion'}$/,@::VALID_CSM_DISTROS)) { NodeUtils->message('E5', 'EMsgUNSUPPORTED_CSM_DISTRO', "CSM".$::PREREQS_ATTR{'CsmCoreVersion'}, join(', ',@::VALID_CSM_DISTROS)); } else { NodeUtils->message('V', 'IMsgDETECTED_CSM_DISTRO', "CSM".$::PREREQS_ATTR{'CsmCoreVersion'}); } } ##################################################################### # Subroutines: # # # # # # usage getArgs # # # # # # # ##################################################################### sub usage { NodeUtils->message('I', 'IMsgcheckrpmprereqsUsage'); exit 1; } sub getArgs { if (! getopts('p:vVh') ) { &usage; } if ($::opt_h) { &usage; } $::VERBOSE = $::opt_v || $::opt_V ; if (!($::opt_p) ) { &usage; } else { $::pkgname=$::opt_p; } } ####################################### # # Main # ###################################### my $rc = 0; my @checkopensrcrpms = (); &getArgs; if ($::PREREQS_ATTR{'OSName'} eq "AIX") { my %Svrpkgdefs = InstallUtils->get_pkgdefs($::PREREQS_ATTR{'OSName'}, $::PREREQS_ATTR{'DistributionName'}, $::PREREQS_ATTR{'DistributionVersion'}, $::PREREQS_ATTR{'PkgArchitecture'}, "MgmtServer", $::PREREQS_ATTR{'CsmCoreVersion'}); @checkopensrcrpms=(@{$Svrpkgdefs{opensrc_prereqs}}); } foreach $::pkg_name (@checkopensrcrpms) { # make sure that the * isn't a part of the package name: $::pkg_name =~ s/\*//g; NodeUtils->runcmd("$::RPMCMD -q $::pkg_name", -1); $rc=$::RUNCMD_RC; if ($rc!=0) { NodeUtils->message('E', 'EMsgRpmNotInstalled', $::pkgname, $::pkg_name); exit $rc; } } exit $rc; rials - kl0PB7u0q@q@q@ 0./opt/csm/csmbin/cloggerprereqs@qH !(,  ( H1L.text!( .data ( (,"(@.bss T T .loader(T"(|nx|#x|+x|1Bh9 e)-*@H `HH)A|nxAA| QN!A9}sx}{x~xH` ,Ab$H A| @__start|b,0!;8 `?\XHՀA8`PHA8;@DH@D8`PHAH,@dH A, @4@H AD8D`PHA@HH H,@8`cHAH,A@D8`PKtL@H8LdTTd6@|!n8@P8TH TLP<8 T|).|*8 PHUTPX<@,@ЀP *}|(.Tg8|:}e8.| @AD, AH9A}8c}Tf8|2}e0.| @@̃<T;| <@,P *}|(.Tg8|:}e8.KH(H8`cHA8`HA0T8d XH̀AT|@P H`@H!A!}N (!X0 X|!֐|Hd 8,A4`f|c"8| .,A`f|c"8| .,K`N H|```}!b\;:b \$ARGS{QUIET_MODE}, # if set, keep quiet "keepgoing" => \$ARGS{KEEP_GOING}, # if set, dont stop on the first error "verbose" => \$ARGS{VERBOSE}, # if set, be more verbose in whatever we are doing "displayonly" => \$ARGS{DISPLAY_ONLY}, # if set, just show what would be tested, but dont perform actual tests "target=s" => \$ARGS{TARGETS}, # the name of the remote target to investigate "password:s" => \$ARGS{REMOTE_PASSWORD}, # password of user to use in rexec to $ARGS{TARGETS} # "user=s" => \$ARGS{REMOTE_USER}, # user name to use in rexec to $ARGS{TARGETS} "action=i" => \$ARGS{ACTION_MODE}, # 0 - no action, 1 - ask, 2 - just doit "trace" => \$ARGS{TRACE_ON}, # if set, log each step to $ARGS{TRACE_FILE} "tracefile=s" => \$TRACE_FILE, # name of trace file "exportdata" => \$ARGS{EXPORT_DATA}, # only used internally # "version" => \$ARGS{VERSION} # "help" => \$ARGS{HELP}, # display usage ) or usage(); $Text::Wrap::columns = GetTermWidth(); if ( $> != 0 ) { Show(message=>"$ME must be run as root - you are running as user ".getpwuid($>)."\n"); exit 1; } checkArgs(); if ( $ARGS{TRACE_ON} ) { open TRACEFILE, ">>$TRACE_FILE" || die $!; } main(); if ( $ARGS{TRACE_ON} ) { close TRACEFILE; } use POSIX qw(tmpnam); ################################################################################ # ;config ################################################################################ sub config { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); my $suffix = ""; if ( $DATA{OSNAME} eq "Linux" ) { $suffix = "linux"; } else { if ( $DATA{OSNAME} eq "MCPLinux" ) { $suffix = "mcplinux"; } else { $suffix = "aix"; } } my $command_file = ""; LINE: while ( ) { # start of a new command section if ( $_ =~ /begin (\d+) (.*)\.$suffix/ ) { my $mode = $1; my $command_name = $2; TRACE($input{indent},$space,"creating command $command_name with mode $mode\n"); # if we have already processed a prior command, close the current file and reopen another file if ( $command_file ne "" ) { close(OUT); } $command_file = tmpnam().".$command_name"; TRACE($input{indent},$space,"COMMANDS{$command_name} = $command_file\n");#.$command_name\n"); open(OUT,">$command_file"); binmode(OUT); chmod oct($mode), $command_file or die "can't chmod $command_file to mode $mode: $!"; # print OUT "begin 755 $command_file.$command_name\n"; $COMMANDS{"$command_name"} = "$command_file";#.$command_name"; next; } if ( $_ =~ /^end/ ) { close(OUT); $command_file = ""; next; } if ( $command_file ne "" ) { next LINE if /[a-z]/; next LINE unless int((((ord() - 32) & 077) + 2) / 3) == int(length() / 4); print OUT unpack("u", $_) or die "can't write $command_file: $!"; } } } ################################################################################ # ;unconfig ################################################################################ sub unconfig { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); foreach my $file ( keys %COMMANDS ) { TRACE($input{indent},$space,"unlinking $COMMANDS{$file}\n"); unlink("$COMMANDS{$file}"); } } ################################################################################ # ;main ################################################################################ sub main { my %input = @_; TRACE($0,(caller(0))[3]," called on ".`date`); setOSName(indent=>"$input{indent}$space"); config(indent=>"$input{indent}$space"); # Perhaps will start elsewhere in the future, but for now this is it ... my $rc = 0; if ( $ARGS{EXPORT_DATA} ) { $rc = CollectExportData(); dumpDATA(); unconfig(indent=>"$input{indent}$space"); return $rc; } $rc = root(); PrintReport(); # dumpDATA(); unconfig(indent=>"$input{indent}$space"); return $rc; } ################################################################################ # ;root ################################################################################ sub root { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); my @subtasks = ( \&checkLocalRMC ); if ( $DATA{TYPE} eq "HMC" ) { push (@subtasks, \&checkDMSRM); push ( @subtasks, \&checkLparCmdRM ); } else { push (@subtasks, \&checkCSMAgentRM); if ( $DATA{OSVERSION} eq "5.2" || $DATA{OSVERSION} eq "5.3") { push ( @subtasks, \&checkDRM ); } } push ( @subtasks, \&checkSFP ); if ( $ARGS{TARGETS} ) { push (@subtasks, \&checkRemoteTarget ); } my $rc = 0; foreach my $subtask ( @subtasks ) { my $rc |= &$subtask(); if ( $rc != 0 && !$ARGS{KEEP_GOING} ) { return 1; } } return $rc; } ################################################################################ # ;checkLocalRMC ################################################################################ sub checkLocalRMC { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); my @subtasks = ( \&getInstalledPackageLevels, \&getLocalHostName, \&getFreeSpaceInVar, \&checkRegistry, \&checkNodeID, \&checkCTSecFiles, \&areDaemonsResponding, \&checkCTRMCACLSFile, \&getRemoteClientConnectionStatus, ); Display(indent=>$input{indent}, shortdesc=>"Check local RMC subsystem.", desc=> "Look at the RSCT system on the local machine. This is only to verify that ". "basic setup is OK, ie, daemons are running, responsive, security files are ". "present, etc."); my $rc = 0; foreach my $subtask ( @subtasks ) { $rc |= &$subtask(indent=>"$input{indent}$space"); if ( $rc != 0 && !$ARGS{KEEP_GOING} ) { return 1; } } return $rc; } ################################################################################ # ;getInstalledPackageLevels ################################################################################ sub getInstalledPackageLevels { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Get the installed versions of RMC packages.", desc=>"Collect installed package information and verify ". "all required packages are installed."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } my $rc =0; if ( $DATA{TYPE} eq "LPAR" ) { my @packages = ("rsct.core.utils","rsct.core.sec","csm.client"); if ( $DATA{OSVERSION} eq "5.2" || $DATA{OSVERSION} eq "5.3") { push @packages, "devices.chrp.base.rte","csm.core"; } foreach $package ( @packages ) { if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space",message=>"Checking for $package: "); } my $ver = `LC_ALL=C lslpp -qL $package 2>&1 | head -1 | awk '{print \$1"-"\$2}'`; chomp $ver; if ( $ver !~ /0504-132/ ) { $DATA{PKGS}{$package} = $ver; if ( $ARGS{VERBOSE} ) { Show(indent=>"",message=>" ok\n"); } } else { if ( $ARGS{VERBOSE} ) { Show(indent=>"",message=>" not installed\n"); } addToReport(message=>"$package is not installed"); $rc |= 1; } } } else { my @packages =("src","rsct.core","rsct.core.utils","csm.core", "csm.server.hsc","csm_hmc.server","hsc.lparcmd"); foreach $package ( @packages ) { if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space",message=>"Checking for $package: "); } my $ver = `LC_ALL=C rpm -q $package`; chomp $ver; if ( $ver !~ /is not installed/ ) { $DATA{PKGS}{$package} = $ver; $DATA{PKGS}{$package} = $ver; if ( $ARGS{VERBOSE} ) { Show(indent=>"",message=>" ok\n"); } } else { if ( $ARGS{VERBOSE} ) { Show(indent=>"",message=>" not installed\n"); } addToReport(message=>"$package is not installed"); $rc |= 1; } } } return $rc; } ################################################################################ # ;getLocalHostName ################################################################################ sub getLocalHostName { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check the primary hostname of the local machine.", desc=>"Get the local hostname of the machine as returned by ". "gethostbyname(gethostname()). Be sure that this name looks ". "like a valid hostname."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } if ( !-x "$COMMANDS{getLocalHostName}" ) { Show(indent=>"$input{indent}$space", message=>"missing file $COMMANDS{getLocalHostName}\n"); addToReport(message=>"The file $COMMANDS{getLocalHostName} is missing. Reinstall $PackageName"); return 1; } my $hn = `LC_ALL=C $COMMANDS{getLocalHostName} 2>&1 | awk '{print \$7}'`; chomp $hn; if ( $? != 0 || $hn eq "" ) { Show(indent=>"$input{indent}$space", message=>"Error in fetching local hosts primary hostname"); addToReport(message=>"Error in fetching local hosts primary hostname. Be sure that ". "the command $COMMANDS{getLocalHostName} runs."); return 1; } $DATA{LOCALHOSTNAME} = $hn; if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space",message=>"Local hostname is $DATA{LOCALHOSTNAME}\n"); } if ( $hn eq "localhost.localdomain" || $hn eq "localhost" || $hn eq "loopback" ) { Show(indent=>"$input{indent}$space", message=>"$hn appears to be a local host name"); addToReport(message=>"The primary hostname appears to be unconfigured since the hostname is '$hn'."); return 1; } return 0; } ################################################################################ # ;getFreeSpaceInVar ################################################################################ sub getFreeSpaceInVar { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check the amount of free space in /var.", desc=>"This should be large enough for new trace files and core files to be saved. While an ". "exact amount of free space is hard to know, this script uses $REQUIRED_FREE_SPACE". "MB as a minimum amount of free space before its considered an error."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } my $k_blocks=0; if ( $DATA{OSNAME} eq "AIX" ) { $k_blocks = `LC_ALL=C df -k /var | grep dev | awk '{print \$3}'`; } else { $k_blocks = `LC_ALL=C df -k /var | grep dev | awk '{print \$4}'`; } chomp $k_blocks; TRACE($input{indent},$space,"k_blocks=[$k_blocks]\n"); $DATA{VAR_SPACE} = int( ($k_blocks*1024)/524288 ) / 2; if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space", message=>"/var has $DATA{VAR_SPACE}MB free.\n"); } if ( $DATA{VAR_SPACE} < $REQUIRED_FREE_SPACE ) { Show(indent=>"$input{indent}$space", message=>"/var has only $DATA{VAR_SPACE}MB free. Free some space\n"); addToReport(message=>"/var has only $DATA{VAR_SPACE}MB free. Free some space", action=> sub { my $TOP="/tmp/var/ct"; print "Deleting core and trace files from $TOP\n"; use File::Find; sub process_file { # print "checking $_\n"; if ( $_ =~ /trace(\.\d+)?|core/ ) { print "deleting file $File::Find::name\n"; # unlink($File::Find::name); } } print "Stoping rmc\n"; system("LC_ALL=C /usr/sbin/rsct/bin/rmcctrl -z"); find (\&process_file,$TOP); print "Starting rmc\n"; system("LC_ALL=C /usr/sbin/rsct/bin/rmcctrl -s"); } ); return 1; } return 0; } ################################################################################ # ;getRemoteClientConnectionStatus ################################################################################ sub getRemoteClientConnectionStatus { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check that remote RMC clients connections are enabled.", desc=>"If this is not enabled, then no remote systems can invoke actions, ". "list resources, etc, on this machine."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } if ( $DATA{DAEMONS}{ctrmc}{pid} >= 0 ) { my $filter = "Logical Connection Information for Remote Clients"; my $ret = `LC_ALL=C /usr/bin/lssrc -ls ctrmc | grep \"$filter\"`; if ( $ret =~ /$filter/ ) { Show(indent=>"$input{indent}$space", message=>"Remote clients are currently enabled.\n"); $DATA{REMOTE_CLIENTS_ENABLED}=1; return 0; } else { Show(indent=>"$input{indent}$space", message=>"Remote clients are NOT currently enabled.\n"); addToReport(message=>"Remote clients are NOT currently enabled.\n", action=> sub { print "running 'rmcctrl -p' to enable remote RMC clients.\n"; system("LC_ALL=C /usr/sbin/rsct/bin/rmcctrl -p"); } ); $DATA{REMOTE_CLIENTS_ENABLED}=0; return 1; } } elsif ( -f "/var/ct/cfg/ctrmc.rpe" ) { my $ctrmc_status = "ctrmc's status with SRC subsystem is not known"; if ( $DATA{DAEMONS}{ctrmc}{pid} = -1 ) { $ctrmc_status= "ctrmc is not running"; } Show(indent=>"$input{indent}$space", message=>"Remote clients should be enabled but unable to determine for sure since $ctrmc_status.\n"); addToReport(message=>"Unable to determine if remote clients are currently enabled since $ctrmc_status.". " However, the file /var/ct/cfg/ctrmc.rpe exists show they should be enabled.", action=>\&action_enableRemoteRMCClients); return 0; } else { my $ctrmc_status = "ctrmc's status with SRC subsystem is not known"; if ( $DATA{DAEMONS}{ctrmc}{pid} = -1 ) { $ctrmc_status= "ctrmc is not running"; } Show(indent=>"$input{indent}$space", message=>"Remote clients do not appear to be enabled since /var/ct/cfg/ctrmc.rpe does not exist.\n"); addToReport(message=>"Remote clients do not appear to be enabled since /var/ct/cfg/ctrmc.rpe does not exist.", action=>\&action_enableRemoteRMCClients); return 0; } } ################################################################################ # ;areDaemonsResponding ################################################################################ sub areDaemonsResponding { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check local RSCT daemons.", desc=>"Check that base RSCT daemons are active and responding."); my @subtasks = ( \&is_ctrmc_responsive, \&is_ctcasd_responsive, \&is_AuditRM_responsive); my $rc = 0; foreach my $subtask ( @subtasks ) { $rc |= &$subtask(indent=>"$input{indent}$space"); if ( $rc != 0 && !$ARGS{KEEP_GOING} ) { return 1; } } return $rc; } ################################################################################ # ;is_ctrmc_responsive ################################################################################ sub is_ctrmc_responsive { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check the ctrmc subsystem.", desc=>"Ensure that ctrmc is active and responding. ". "We check this by running 'lsrsrc'. If this responds, then ". "we can be sure that the local ctrmc is working."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } if ( getSRCDaemonPID(indent=>"$input{indent}",subsystem=>"ctrmc") != 0 ) { # the function will have reported errors already, so we dont need to report more. return 1; } # now try to run lsrsrc my $ret = `LC_ALL=C /usr/sbin/rsct/bin/lsrsrc 2>&1`; if ( $? != 0 ) { Show(indent=>"$input{indent}$space", message=>"lsrsrc command returned an erorr.\n"); addToReport(message=>"lsrsrc command returned an error.\n"); $DATA{DAEMONS}{ctrmc}{responding}=0; return 1; } $DATA{DAEMONS}{ctrmc}{responding}=1; return 0; } ################################################################################ # ;getSRCDaemonPID ################################################################################ sub getSRCDaemonPID { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); # untill we know otherwise.... $DATA{DAEMONS}{$input{subsystem}}{pid} = -666; # "unknown status" my $pid = `LC_ALL=C /usr/bin/lssrc -s $input{subsystem} 2>&1 | tail -1`; if ( $? != 0 ) { Show(indent=>"$input{indent}$space", message=>"lssrc command returned an error.\n"); addToReport(message=>"lssrc -s $input{subsystem} command returned an error.\n"); return 1; } elsif ( $pid =~ /0513-085/ ) { Show(indent=>"$input{indent}$space", message=>"$input{subsystem} is not registered with src.\n"); addToReport(message=>"$input{subsystem} is not registered with src. Run 'lssrc -s $input{subsystem}' to verify this."); return 2; } elsif ( $pid =~ /inoperative/ ) { if ( $input{can_be_inoperative} != 1) { Show(indent=>"$input{indent}$space", message=>"$input{subsystem} is not running.\n"); addToReport(message=>"$input{subsystem} is not running. Ensure that $SRCName2BinName{$input{subsystem}} ". "is present and executable.\nTry to start $input{subsystem} by running:\n". "\tstartsrc -s $input{subsystem}", action=>sub { print "Starting $input{subsystem}\n"; system("LC_ALL=C startsrc -s $input{subsystem}"); } ); } $DATA{DAEMONS}{$input{subsystem}}{pid} = -1; return 3; } elsif ( $pid =~ /\s*$input{subsystem}\s+(\w+)\s*(\d+)/ ) { $DATA{DAEMONS}{$input{subsystem}}{pid} = $2; } else { Show(indent=>"$input{indent}$space", message=>"Unexpected output from lssrc command\n"); addToReport(message=>"Unexpected output from lssrc command of $pid\n". "This is an internal error to $ME.\n"); return 666; } return 0; } ################################################################################ # ;is_ctcasd_responsive ################################################################################ sub is_ctcasd_responsive { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check the ctcasd subsystem.", desc=>"Ensure that ctcasd is responding if its active."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } my $ctcasd_optional = 0; if ( -e "/usr/sbin/rsct/bin/ctstrtcasd" ) { $ctcasd_optional = 1; } my $ret = getSRCDaemonPID(indent=>"$input{indent}",subsystem=>"ctcas", can_be_inoperative=>$ctcasd_optional ); if ( $ret == 3 && $ctcasd_optional == 1 ) { return 0; } elsif ( $ret != 0 ) { # the function will have reported errors already, so we dont need to report more. return 1; } # if it has a PID, try the ctcasd test program my $ret = `LC_ALL=C $COMMANDS{check_ctcasd} -v 2>&1`; if ( $? != 0 ) { Show(indent=>"$input{indent}$space", message=>"command check_ctcasd returned an error.\n"); addToReport(message=>"command check_ctcasd returned error code ".($?>>8).":$ret"); $DATA{DAEMONS}{ctcas}{responding}=0; return 1; } if ( $ret !~ /is ready to receive requests/ ) { Show(indent=>"$input{indent}$space", message=>"ctcas is not responding.\n"); addToReport(message=>"ctcas is not responding.\n"); $DATA{DAEMONS}{ctcas}{responding}=0; return 1; } $DATA{DAEMONS}{ctcas}{responding}=1; return 0; } ################################################################################ # ;is_AuditRM_responsive ################################################################################ sub is_AuditRM_responsive { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent},shortdesc=>"Check the AuditRM subsystem.", desc=>"Ensure that AuditRM is active and responding."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } if ( getSRCDaemonPID(indent=>"$input{indent}",subsystem=>"IBM.AuditRM") != 0 ) { # the function will have reported errors already, so we dont need to report more. return 1; } # if it has a PID, try the lsaudrec command `LC_ALL=C /usr/bin/lsaudrec 2>&1 > /dev/null`; if ( $? != 0 ) { Show(indent=>"$input{indent}$space", message=>"IBM.AuditRM not responding.\n"); addToReport(message=>"IBM.AuditRM not responding.\n"); $DATA{DAEMONS}{"IBM.AuditRM"}{responding}=0; return 1; } $DATA{DAEMONS}{"IBM.AuditRM"}{responding}=1; return 0; } ################################################################################ # ;checkNodeID ################################################################################ sub checkNodeID { my %input = @_; # Node ID is only used on AIX 5.1D+/5.2 # TODO - what AIX 5.1 level first uses node ids? D or F return 0 unless ( $DATA{TYPE} eq "HMC" || $DATA{OSVERSION} eq "5.2" || $DATA{OSVERSION} eq "5.3" || ($DATA{OSVERSION} eq "5.1" && $DATA{FIX_LEVEL} ge "02") ); TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check node ID information.", desc=>"Check if the node id is consistant between that stored in the ctrmc ". "configuration files as well as the ID stored in the resource handles of ". "resources stored in the registry."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } use File::Compare; if ( !-f "/etc/ct_node_id" && !-f "/var/ct/cfg/ct_node_id" ) { Show(indent=>"$input{indent}$space", message=>"No Node ID files found.\n"); if ( $DATA{RSCT_VERSION} ) { addToReport(message=> "No Node ID files found.". "/etc/ct_node_id and /var/ct/cfg/ct_node_id files do not exist.". "RSCT is installed at version $DATA{RSCT_VERSION} so these files ". "should be present. Unknown why they are missing. Run /usr/sbin/rsct/bin/XXXX -k ". "to regenerate these files. You will need to account for the new node ID ". "which may mean 'lost' entries in the registry, if any exist", ); } else { addToReport(message=> "No Node ID files found. ". "/etc/ct_node_id and /var/ct/cfg/ct_node_id files do not exist. ". "RSCT is not installed so these files will not normally be present. ". "Install rsct.core.* packages."); } return 1; } elsif ( -f "/etc/ct_node_id" && !-f "/var/ct/cfg/ct_node_id" ) { Show(indent=>"$input{indent}$space", message=>"/var/ct/cfg/ct_node_id file is missing.\n"); addToReport(message=> "/var/ct/cfg/ct_node_id file is missing. ". "/etc/ct_node_id exits but /var/ct/cfg/ct_node_id does not exist."); return 1; } elsif ( !-f "/etc/ct_node_id" && -f "/var/ct/cfg/ct_node_id" ) { Show(indent=>"$input{indent}$space", message=>"/etc/ct_node_id file is missing.\n"); addToReport(message=> "/var/ct/cfg/ct_node_id exits but /etc/ct_node_id does not exist."); return 1; } elsif (compare("/etc/ct_node_id","/var/ct/cfg/ct_node_id") != 0) { Show(indent=>"$input{indent}$space", message=>"Mismatched Node IDs files found.\n"); addToReport(message=> "Mismatched Node IDs found.\n". "/etc/ct_node_id and /var/ct/cfg/ct_node_id files are different.\n"); return 1; } if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space", message=>"/etc/ct_node_id are consistant with each other /var/ct/cfg/ct_node_id\n"); } my $node_id_file = "/etc/ct_node_id"; $DATA{NODEID} = `LC_ALL=C cat $node_id_file 2>&1 | head -1`; chomp $DATA{NODEID}; my @ClassNames = ("ServiceEvent","AuditLog","AuditLogTemplate"); if ( $DATA{OSNAME} eq "AIX" ) { push @ClassNames,"ManagementServer", } else { push @ClassNames,"ManagedNode"; } my $rc = 0; foreach $class_name ( @ClassNames ) { if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space", message=>"Checking resources of class $class_name: "); } my @RH = `LC_ALL=C /usr/sbin/rsct/bin/lssrtbl-api -s /IBM/$class_name/Resources::::ResourceHandle 2> /dev/null| grep 0x | awk '{print \$3\$4}'`; if ( -f "core" ) { unlink("core"); } if ($#RH == -1) { if ( $ARGS{VERBOSE} ) { Show(message=>"no resources found\n"); } next; } if ( !$ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space", message=>"Checking resources of class $class_name: "); } my %uniq=(); map { $uniq{$_}=1; } @RH; foreach my $resource_hndl ( keys %uniq ) { # Show("$input{indent}".$spacea.$space."$resource_hndl\n"); $resource_hndl =~ s/\s*|0x//g; if ( $DATA{NODEID} ne $resource_hndl ) { Show(indent=>"$input{indent}$space$space", message=>"\nThe node id in $node_id_file does not match that in the registry for a resource of class $class_name.\n"); addToReport(message=> "The node id in $node_id_file does not match that in the\n". "registry for a resource of class $class_name.\n"); $rc |= 1; if ( !$ARGS{KEEP_GOING} ) { return 1; } } Show(message=>"ok\n"); } } return $rc; } ################################################################################ # ;checkRegistry ################################################################################ sub checkRegistry { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check that the RSCT registry data is not corrupted.", desc=>"Run the lssrtbl-api command and ensure that it does not generate an error."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } my @ClassNames = ("ServiceEvent","AuditLog","AuditLogTemplate"); if ( $DATA{OSNAME} eq "AIX" ) { push @ClassNames,"ManagementServer", } else { push @ClassNames,"ManagedNode"; } my $rc = 0; if ( -f "/usr/sbin/rsct/bin/lssr-api" ) { system("LC_ALL=C /usr/sbin/rsct/bin/lssr-api /IBM/ 2>&1 > /dev/null"); } else { system("LC_ALL=C /usr/sbin/rsct/bin/lssr /IBM/ 2>&1 > /dev/null"); } if ( $? != 0 ) { # this returned 139 for SEGV a core dump - maybe we want to # test explicitly for that value? Show(indent=>"$input{indent}$space", message=>"Registry Topology table appears to be corrupted.\n"); addToReport(message=>"Registry Topology table appears to be corrupted.\n". "You will need to remove the entire registry and restart all RMs.\n". "Use these commands to try to fix this problem:\n\n". " /usr/sbin/rsct/bin/rmcctrl -z\n". " mv /var/ct/IW/registry/local_tree /var/ct/IW/registry/local_tree.corrupted\n". " /usr/sbin/rsct/bin/rmcctrl -s\n", action=> sub { print "Stopping RMC\n"; system("/usr/sbin/rsct/bin/rmcctrl -z"); print "Renaming the registry directory\n"; system("mv /var/ct/IW/registry/local_tree /var/ct/IW/registry/local_tree.corrupted"); print "Starting RMC\n"; system("/usr/sbin/rsct/bin/rmcctrl -s"); }); if ( -f "core" ) { unlink("core"); } # always return at this point - no need to look at individual tables below # since we know those operations will fail if lssrtbl did. return 1; } foreach $class_name ( @ClassNames ) { if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space", message=>"Checking registry for class $class_name\n"); } if ( -f "/usr/sbin/rsct/bin/lssrtbl-api" ) { system("LC_ALL=C /usr/sbin/rsct/bin/lssrtbl-api -s /IBM/$class_name/Resources::::ResourceHandle 2>&1 > /dev/null"); } else { system("LC_ALL=C /usr/sbin/rsct/bin/lssrtbl -s /IBM/$class_name/Resources ResourceHandle 2>&1 > /dev/null"); } if ( $? != 0 ) { $? = $? / 256; if ( $? == 5 ) { next; # no such resource - this may be an error, but for this function at least, # the table is not corrupted. } Show(indent=>"$input{indent}$space", message=>"$? Registry table for $class_name appears to be corrupted.\n"); addToReport(message=>"Registry table for $class_name appears to be corrupted.\n". "Running 'rmsrtbl /IBM/$class_name/Resources /IBM/$class_name/Class'\n". "may clear the corruption, but any data in those tables will be lost.", action=> sub { print "Running rmsrtbl /IBM/$class_name/Resources /IBM/$class_name/Class\n"; system("rmsrtbl /IBM/$class_name/Resources /IBM/$class_name/Class"); }); if ( -f "core" ) { unlink("core"); } if ( !$ARGS{KEEP_GOING} ) { return 1; } } } } ################################################################################ # ;checkCTSecFiles ################################################################################ sub checkCTSecFiles { # - check for ":wq" in the THL file - it may be the result of a user trying to edit # it in vi! my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check that the CT security files look ok.", desc=>"Check if the security files in /var/ct/cfg are present, not 0 sized, ". "have correct permissions, etc."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } $DATA{THL_VALID} = "false"; my %CT_SEC_Files = ("/var/ct/cfg/ct_has.pkf", "0444", "/var/ct/cfg/ct_has.qkf", "0400", "/var/ct/cfg/ct_has.thl", "0444"); my $rc = 0; foreach $file ( sort keys %CT_SEC_Files ) { Show(indent=>"$input{indent}$space", message=>"checking $file: "); if ( !-f $file ) { Show(message=>"$file does not exist\n"); addToReport(message=>"$file does not exist\n"); $rc |= 1; next; } my @info = stat($file); if ( $info[7] == 0 ) { Show(message=>"$file exists, but its empty\n"); addToReport(message=>"$file exists, but its empty.\n"); $rc |= 1; next; } my $perm = oct($CT_SEC_Files{$file}); if ( ($info[2]&0777) != $perm ) { Show(message=>"$file has wrong permissions - should be $CT_SEC_Files{$file}.\n"); addToReport(message=>"$file exists, has the wrong permissions.\n"); $rc |= 1; next; } Show(message=>"ok\n"); } if ( $rc ) { return $rc; } # now slurp in the THL and public key files into $DATA @THL = `LC_ALL=C /usr/sbin/rsct/bin/ctsthl -l 2>&1`; if ( $? !=0 ) { Show(indent=>"$input{indent}$space", message=>"ctsthl -l reports an error. See report\n"); addToReport(message=>"ctsthl -l reports this error:\n @THL\n"); $DATA{THL_VALID} = "false"; if ( !$ARGS{KEEP_GOING} ) { return 1; } $rc = 1; } else { $DATA{THL_VALID} = "true"; } #Host Identity: localhost.localdomain #Identifier Generation Method: rsa512 #Identifier Value: #120200b1cb9311aef4c97221c1021d83667d3fe33df7bc52ce0b47a2ed48824a86469287e24983852a369b5d1183c5da5626e21abed19960f4258d6f6437d6619b10d30103 my $index = -1; foreach $line ( @THL ) { $index++; if ( $line =~ /Host.*:\s+(.*)\s*/ ) { $hn = $1; $THL[$index+1] =~ s/.*:\s+(.*)\s*//g; $meth = $1; $pk = $THL[$index+3]; chomp $pk; $DATA{THL}{$hn}{meth} = $meth; $DATA{THL}{$hn}{key} = $pk; } } # fetch my own public key from the official files, not the THL file. my @PK = `LC_ALL=C /usr/sbin/rsct/bin/ctskeygen -d 2>&1`; if ( $? !=0 ) { Show(indent=>"$input{indent}$space", message=>"ctskeygen -d reports an error. See report\n"); addToReport(message=>"ctskeygen -d reports this error:\n @PK\n"); $rc = 1; } else { chomp $PK[0]; chomp $PK[1]; $PK[1] =~ s/\(generation method: (.*)\).*/$1/g; $DATA{PK}{meth} = $PK[1]; $DATA{PK}{key} = $PK[0]; } # A list of possible names that we may have for ourselved in the THL file. my @Names = ( $DATA{LOCALHOSTNAME}, "localhost", "localhost.localdomain", "loopback"); my %Seen; my $found_key = 0; foreach my $name ( @Names ) { if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space", message=>"Looking for an entry under the name $name in the THL file.\n"); } # does our official public key match the entry in the THL? if ( exists $DATA{THL}{$name} ) { if ( $DATA{PK}{key} eq $DATA{THL}{$name}{key} && $DATA{PK}{meth} eq $DATA{THL}{$name}{meth} ) { $found_key = 1; } # Add an entry to the Seen hash - like this Seen{_} = hostname # Later we will look for more than one entry in %Seen - if we have more than one key, # Then we found more than one PK. In that case Seen{PK} will be a list of hostnames # that share that PK. if ( $DATA{THL}{$name}{key} && exists $DATA{THL}{$name}{meth} ) { push @{$Seen{"$DATA{THL}{$name}{key}_$DATA{THL}{$name}{meth}"}},$name; } } } if ( (keys %Seen) > 1 ) { Show(indent=>"$input{indent}$space", message=>"The THL file has conflicting entries for itself.\n"); my @LIST=(); foreach $key ( keys %Seen ) { push @LIST, @{$Seen{$key}}; } addToReport(message=> "The THL file has conflicting entries for itself.\n\n". "Multiple THL entries exist for the local machine under the names ".commafy("and",@LIST).", but they do not all ". "have the same public key value. You can check these entries using the command '/usr/sbin/rsct/bin/ctsthl -l'", type=>"Warning"); return 1; } if ( $found_key == 1 ) { return $rc; } Show(indent=>"$input{indent}$space", message=>"Public key does not appear in the THL file.\n"); addToReport(message=> "Public key for this machine does not appear in the THL file.\n\n". "No entry for ".commafy("or",@Names)." was found in the THL file.\n". "This could be the result of starting ctcasd when no hostname was set.\n". "\nRun the following command to add the public key to the THL file (on a single line)\n". "\t/usr/sbin/rsct/bin/ctsthl -a -n $DATA{LOCALHOSTNAME} -m $DATA{PK}{meth} -p $DATA{PK}{key}\n", action=> sub { print "Running\n\t/usr/sbin/rsct/bin/ctsthl -a -n $DATA{LOCALHOSTNAME} -m $DATA{PK}{meth} -p $DATA{PK}{key}\n"; system("LC_ALL=C /usr/sbin/rsct/bin/ctsthl -a -n $DATA{LOCALHOSTNAME} -m $DATA{PK}{meth} -p $DATA{PK}{key}"); }); return 1; } ################################################################################ # ;commify ################################################################################ sub commafy { # see Cookbook, page 94 my $tag = shift; if (@_ == 0) { return ''; } elsif (@_ == 1) { return $_[0]; } elsif (@_ == 2) { return join (" $tag ", @_); } else { return join (", ", @_[0..($#_ -1)], "$tag $_[-1]"); } } ################################################################################ # ;checkCTRMCACLSFile ################################################################################ sub checkCTRMCACLSFile { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check that the CTRMC ACL file looks ok.", desc=> "Check that the RMC ACL file is present, not empty, and is ". "valid. Does not check for specific entries, just correct ". "syntax. It tests for correct syntax by running 'refresh -s ". "ctrmc' which will cause ctrmc to re-read the acl file. It ". "will return an error if the file is invalid. Note that ". "this may have a side effect if ctrmc had not read the file ". "previously and that was the cause of some problem. So, ". "running this test may correct this as a side effect"); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } if ((! -f "/var/ct/cfg/ctrmc.acls" ) && (! -f "/usr/sbin/rsct/cfg/ctrmc.acls" )) { Show(indent=>"$input{indent}$space", message=>"Neither /var/ct/cfg/ctrmc.acls nor ". "/usr/sbin/rsct/cfg/ctrmc.acls exists.\n"); addToReport(message=>"Neither /var/ct/cfg/ctrmc.acls nor ". "/usr/sbin/rsct/cfg/ctrmc.acls exists.\n"); $DATA{ACLS_FILE_VALID}=0; return 1; } if ( -z "/var/ct/cfg/ctrmc.acls" ) { Show(indent=>"$input{indent}$space", message=>"/var/ct/cfg/ctrmc.acls file is 0 sized."); addToReport(message=>"/var/ct/cfg/ctrmc.acls file is 0 sized.\n"); $DATA{ACLS_FILE_VALID}=0; return 1; } if ( -z "/usr/sbin/rsct/cfg/ctrmc.acls" ) { Show(indent=>"$input{indent}$space", message=>"Warning: /usr/sbin/rsct/cfg/ctrmc.acls file is 0 sized."); addToReport(message=>"Warning: /usr/sbin/rsct/cfg/ctrmc.acls file is 0 sized.\n"); } if ( $DATA{DAEMONS}{ctrmc}{pid} == -1 ) { $DATA{ACLS_FILE_VALID} = 0; Show(indent=>"$input{indent}$space", message=>"Cannot determine if CTRMC ACL file is valid". " since ctrmc is not running.\n"); addToReport(message=>"Cannot determine if CTRMC ACL file is valid". " since ctrmc is not running.\n"); return 1; } # Have ctrmc read the ACL file - look for any error messages my $before_wc = `LC_ALL=C grep 2610 /var/ct/IW/log/mc/default | wc -l`; system("LC_ALL=C refresh -s ctrmc 2>&1 > /dev/null"); if ( $? != 0 ) { Show(indent=>"$input{indent}$space", message=>"CTRMC ACL file appears to be invalid.\n"); my $after_wc = `LC_ALL=C grep 2610 /var/ct/IW/log/mc/default | wc -l`; if ( $before_wc != $after_wc ) { my $message = `LC_ALL=C grep 2610 /var/ct/IW/log/mc/default | tail -1`; chomp $message; addToReport(message=>"CTRMC ACL file appears to be invalid.\n". "Last message from ctrmc was:\n". "$message\n"); } else { addToReport(message=>"CTRMC ACL file appears to be invalid.\n". "Unknown reason why - maybe /var/ct/IW/log/mc/default will ". "contain some hints as to the reason.\n"); } $DATA{ACLS_FILE_VALID}=0; return 1; } $DATA{ACLS_FILE_VALID} = 1; if ( slurpCTRMC_ACLS(indent=>$input{indent}) == 3 ) { $DATA{ACLS_FILE_VALID}=0; } return 0; } ################################################################################ # ;checkDMSRM ################################################################################ sub checkDMSRM { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check DMSRM.", desc=>"See if DMSRM is active and responding"); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } if ( getSRCDaemonPID(indent=>"$input{indent}",subsystem=>"IBM.DMSRM") != 0 ) { # the function will have reported errors already, so we dont need to report more. return 1; } # if it has a PID, try the lsaudrec command `LC_ALL=C /usr/sbin/rsct/bin/lsrsrc IBM.ManagedNode 2>&1 > /dev/null`; if ( $? != 0 ) { Show(indent=>"$input{indent}$space", message=>"IBM.DMSRM is active but not able to list ManagedNode resources.\n"); addToReport(message=>"IBM.DMSRM is active but not able to list ManagedNode resources.\n"); $DATA{DAEMONS}{"IBM.DMSRM"}{responding}=0; return 1; } $DATA{DAEMONS}{"IBM.DMSRM"}{responding}=1; return 0; } ################################################################################ # ;checkCSMAgentRM ################################################################################ sub checkCSMAgentRM { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check CSMAgentRM", desc=>"See if CSMAgentRM is active and responsive."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } if ( getSRCDaemonPID(indent=>"$input{indent}",subsystem=>"IBM.CSMAgentRM") != 0 ) { # the function will have reported errors already, so we dont need to report more. return 1; } # if it has a PID, try the lsaudrec command `LC_ALL=C /usr/sbin/rsct/bin/lsrsrc IBM.ManagementServer 2>&1 > /dev/null`; if ( $? != 0 ) { Show(indent=>"$input{indent}$space", message=>"IBM.CSMAgentRM not responding.\n"); addToReport(message=>"IBM.CSMAgentRM not responding.\n"); $DATA{DAEMONS}{"IBM.CSMAgentRM"}{responding}=0; return 1; } $DATA{DAEMONS}{"IBM.CSMAgentRM"}{responding}=1; return 0; } ################################################################################ # ;slurpCTRMC_ACLS ################################################################################ sub slurpCTRMC_ACLS { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); my $user_file = "/var/ct/cfg/ctrmc.acls"; my $default_file = "/usr/sbin/rsct/cfg/ctrmc.acls"; my $effective_file = $user_file; if (!-f $user_file) { $DATA{ACLS}{FILE_NAME} = $default_file; } else { $DATA{ACLS}{FILE_NAME} = $user_file; } my @ACLS = `LC_ALL=C cat $effective_file 2> /dev/null`; if ( @ACLS == 0 ) { TRACE($input{indent},$space,"$effective_file is empty, returning.\n"); return 2; } my $comment_re= '^[\s\#]*\Z'; my $stanza_re = '^([\w\.]+)\s*'; my $entry_re = '^\s+([@\w\.]+)\s+([\*\w]+)\s+([\*\w]+)\s*.*'; my %CTRMC_ACLS=(); foreach my $line ( @ACLS ) { $lineno++; if ( $line =~ /$comment_re/ ) { next; } if ( $line =~ /$stanza_re/ ) { $current_stanza = $1; if ( $stanza_header == 1 ) { TRACE("$current_stanza is empty on line $line, returning\n"); return 3; } $stanza_header=$1; $DATA{ACLS}{$current_stanza}={}; next; } if ( $line =~ /$entry_re/ ) { $DATA{ACLS}{$current_stanza}{$1}{CR} = $2; $DATA{ACLS}{$current_stanza}{$1}{perm} = $3; next; } } } ################################################################################ # ;checkRemoteTarget ################################################################################ sub checkRemoteTarget { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Test setup against target(s) $ARGS{TARGETS}.", desc=>"This includes tests to confirm that authenticated RMC connections between ". "this machine and $ARGS{TARGETS} should work. To do this, we must collect some data from $ARGS{TARGETS}. ". "That data is collected by invoking $ME on $ARGS{TARGETS}. So, this means that rexec between these ". "machines must work and that the $PackageName package is installed on $ARGS{TARGETS}."); my @targets = split (/,/,$ARGS{TARGETS}); my $remote_hosts_count = 0; foreach $target ( @targets ) { $target =~ s/\s*//; Show(indent=>"$input{indent}$space", message=>"Checking remote target $target\n"); # Originally this script had a single target - $ARGS{TARGETS} and all functions # used that. When I moved to multiple targets, this was the quick, but dirty, way # to support this. Should really pass the target to each function as needed.... $ARGS{TARGETS}=$target; my $rc = 0; $rc = canPingTarget(indent=>"$input{indent}$space$space"); if ( $rc != 0 ) { Show(indent=>"$input{indent}$space$space", message=>"Since we cannot ping $ARGS{TARGETS}, no need to try to collect more data from it.\n"); addToReport(message=>"Unable to ping $ARGS{TARGETS}"); next; } $rc = collectRemoteData(indent=>"$input{indent}$space$space"); if ( $rc != 0 ) { Show(indent=>"$input{indent}$space$space", message=>"Since we cannot collect data from $ARGS{TARGETS}, no need to test further.\n"); next; } $remote_hosts_count++; my @subtasks = ( \&checkRemoteDaemons, \&checkRemotesRMCRemoteClientConnectionStatus, \&checkIfHostnamesMatch, \&checkRemoteTHL, \&checkRemoteACL, \&canDoRemoteLSRSRC, \&checkRemoteFindings); foreach my $subtask ( @subtasks ) { $rc |= &$subtask(indent=>"$input{indent}$space$space"); if ( $rc != 0 && !$ARGS{KEEP_GOING} ) { return 1; } } } if ( $remote_hosts_count >= 1 ) { my @subtasks = ( \&checkTargetNodeIDs ); foreach my $subtask ( @subtasks ) { $rc |= &$subtask(indent=>"$input{indent}$input{indent}$space"); if ( $rc != 0 && !$ARGS{KEEP_GOING} ) { return 1; } } } return 0; } ################################################################################ # ;canPingTarget ################################################################################ sub canPingTarget { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent},shortdesc=>"Can we ping $ARGS{TARGETS}?", desc=>"This is done just to verify that $ARGS{TARGETS} is reachable and alive."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } use Net::Ping; my $pingger = Net::Ping->new("icmp"); my $ret = $pingger->ping($ARGS{TARGETS}); $pingger->close(); if ( $ret ) { if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space",message=>"we can ping $ARGS{TARGETS}\n"); } $DATA{TARGETS}{"$ARGS{TARGETS}"}{PINGABLE}=1; return 0; } else { Show(indent=>"$input{indent}$space",message=>"we cannot ping $ARGS{TARGETS}\n"); $DATA{TARGETS}{"$ARGS{TARGETS}"}{PINGABLE}=0; return 1; } } ################################################################################ # ;CollectRemoteData ################################################################################ sub collectRemoteData { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent},shortdesc=>"Collect data from $ARGS{TARGETS}.", desc=>"Invoke $ME on $ARGS{TARGETS} and gather its output."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } if ( !$ARGS{TARGETS} || !$DATA{LOCALHOSTNAME} ) { Show(indent=>"$input{indent}$space",message=>"Missing some data, so cannot do this test.\n"); return 1; } my $command = "$DATA{REXECCMD} $ARGS{TARGETS} $BaseDIR/DiagnoseHMC --export --target=$DATA{LOCALHOSTNAME} 2>&1"; my $ret = ""; if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space",message=>"running $BaseDIR/DiagnoseHMC on $ARGS{TARGETS}\n"); } TRACE($input{indent},$space,"running $command\n"); Show(indent=>"$input{indent}$space",message=>"working "); open (RD, "LC_ALL=C $command |"); while ( ) { if ( $_ =~ /invalid login name or password/ ) { my $password = $ARGS{REMOTE_PASSWORD}?$ARGS{REMOTE_PASSWORD}:""; Show(indent=>"\n$input{indent}$space",message=>"$ARGS{REMOTE_USER}/$password is not valid username/password for $ARGS{TARGETS}\n"); addToReport(message=>"Unable to collect data from $ARGS{TARGETS} since $ARGS{REMOTE_USER}/$password is not a ". "valid username/password. Provide correct values and run this script again."); close (RD); return 1; } elsif ( $_ =~ /must be run as root/ ) { Show(indent=>"\n$input{indent}$space",message=>"Must run $ME on $ARGS{TARGETS} as root.\n"); addToReport(message=>"Unable to collect data from $ARGS{TARGETS} since we are not running $ME as root on $ARGS{TARGETS}. ". "Verify that rexec is setup to allow execution of programs on $ARGS{TARGETS} as user root. You can run this command ". "to check what id is used on the target machine:\n". "\t$DATA{REXECCMD} $ARGS{TARGETS} id"); close (RD); return 1; } elsif ( $_ =~ /Name \(.*:root\):/ ) { Show(indent=>"\n$input{indent}$space",message=>"Rexec appears to not be setup between this machine and $ARGS{TARGETS}.\n"); addToReport(message=>"Unable to collect data from $ARGS{TARGETS} since rexec appears to not be setup between this machine and $ARGS{TARGETS}. ". "Verify that rexec is setup to allow execution of programs on $ARGS{TARGETS} as user root. You can run this command - if you are ". "prompted for a name and a password, rexec is not setup correctly:\n\n". "\t$DATA{REXECCMD} $ARGS{TARGETS} ls\n\n". "You can check the HMC GUI - it has a way to enable rexec from the HMC to the LPARs..."); close (RD); return 1; } elsif ( $_ =~ /$BaseDIR\/DiagnoseHMC/ ) { Show(indent=>"\n$input{indent}$space",message=>"$BaseDIR/DiagnoseHMC is not installed on $ARGS{TARGETS}.\n"); addToReport(message=>"Unable to collect data from $ARGS{TARGETS} since $BaseDIR/DiagnoseHMC is not installed. ". "Install package $PackageName on $ARGS{TARGETS}."); close (RD); return 1; } elsif ( $_ =~ /Connection refused/ ) { Show(indent=>"\n$input{indent}$space",message=>"rexec connection to $ARGS{TARGETS} was refused.\n"); addToReport(message=>"Unable to collect data from $ARGS{TARGETS} since rexec connection was refused. ". "Verify that rexec is setup to allow execution of programs on $ARGS{TARGETS} as user root. You can run this command ". "to check what id is used on the target machine and verify rexec works to $ARGS{TARGETS}:\n". "\t$DATA{REXECCMD} $ARGS{TARGETS} id"); close (RD); return 1; } if ( $_ =~ /^\#/ ) { Show(message=>"."); } $ret .= $_; } close (RD); Show(message=>" done!\n"); eval $ret; if ( !defined $VAR1 ) { Show(indent=>"$input{indent}$space",message=>"Data returned from $ARGS{TARGETS} is not valid.\n"); addToReport(message=>"The data returned from $ARGS{TARGETS} was not valid.\n". "This should not happen unless the $ME script on $ARGS{TARGETS} is not working.\n" # "You can run this command to see what data was returned (it should be valid Perl code):\n$command" ); return 1; } $DATA{TARGETS}{"$ARGS{TARGETS}"} = $VAR1; $VAR1=undef; # push @{$DATA{TARGETS}},$VAR1; return 0; } ################################################################################ # ;checkRemoteDaemons ################################################################################ sub checkRemoteDaemons { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check that daemons are working on $ARGS{TARGETS}.", desc=>"This currently only checks that ctrmc and ctcasd are working on $ARGS{TARGETS}."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } my $rc = 0; if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space",message=>"Checking ctrmc status on $ARGS{TARGETS}\n"); } if ( !defined $DATA{TARGETS}{"$ARGS{TARGETS}"}{DAEMONS}{ctrmc} ) { Show(indent=>"$input{indent}$space", message=>"ctrmc is not registered with src on $ARGS{TARGETS}.\n"); if ( !defined $DATA{TARGETS}{"$ARGS{TARGETS}"}{PKGS}{"rsct.core.utils"} ) { addToReport(message=>"ctrmc is not registered with src on $ARGS{TARGETS}. ". "It appears that rsct.core.utils needs to be installed on $ARGS{TARGETS}."); } else { addToReport(message=>"ctrmc is not registered with src on $ARGS{TARGETS}. ". "Unknown reason why - check using 'lssrc -a | grep rsct' on $ARGS{TARGETS}."); } $rc |= 1; } elsif ( $DATA{TARGETS}{"$ARGS{TARGETS}"}{DAEMONS}{ctrmc}{pid} == -1 || $DATA{TARGETS}{"$ARGS{TARGETS}"}{DAEMONS}{ctrmc}{responding} != 1 ) { Show(indent=>"$input{indent}$space", message=>"ctrmc is not working on $ARGS{TARGETS}.\n"); addToReport(message=>"ctrmc is not running on $ARGS{TARGETS}. "); $rc |= 1; } if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space",message=>"Checking ctcas status on $ARGS{TARGETS}\n"); } if ( !defined $DATA{TARGETS}{"$ARGS{TARGETS}"}{DAEMONS}{ctcas} ) { Show(indent=>"$input{indent}$space", message=>"ctrmc is not registered with src on $ARGS{TARGETS}.\n"); if ( !defined $DATA{TARGETS}{"$ARGS{TARGETS}"}{PKGS}{"rsct.core.utils"} ) { addToReport(message=>"ctrmc is not registered with src on $ARGS{TARGETS}. ". "It appears that rsct.core.utils needs to be installed on $ARGS{TARGETS}."); } else { addToReport(message=>"ctrmc is not registered with src on $ARGS{TARGETS}. ". "Unknown reason why - check using 'lssrc -a | grep rsct' on $ARGS{TARGETS}."); } $rc |= 1; } elsif ( $DATA{TARGETS}{"$ARGS{TARGETS}"}{DAEMONS}{ctcas}{pid} != -1 && $DATA{TARGETS}{"$ARGS{TARGETS}"}{DAEMONS}{ctcas}{responding} != 1 ) { Show(indent=>"$input{indent}$space", message=>"ctcas is not responding on $ARGS{TARGETS}.\n"); addToReport(message=>"ctcas is not responding on $ARGS{TARGETS}. "); $rc |= 1; } return $rc; } ################################################################################ # ;checkRemotesRMCRemoteClientConnectionStatus ################################################################################ sub checkRemotesRMCRemoteClientConnectionStatus { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check that $ARGS{TARGETS} allows remote rmc connections."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } if ( !defined $DATA{TARGETS}{"$ARGS{TARGETS}"}{REMOTE_CLIENTS_ENABLED} ) { Show(indent=>"$input{indent}$space",message=>"$ARGS{TARGETS} did not report remote RMC clients status.\n"); addToReport(message=>"$ARGS{TARGETS} did not report remote RMC clients status. You can check this manually ". "by running 'lssrc -ls ctrmc' on $ARGS{TARGETS} and look for an line like ". "'Logical Connection Information for Remote Clients'. ". "If its present, then remote clients are enabled. If ctrmc is not running, check if /var/ct/cfg/ctrmc.rpe ". "exists - if it does, then remote clients will be enabled when ctrmc next starts up."); return 1; } elsif ($DATA{TARGETS}{"$ARGS{TARGETS}"}{REMOTE_CLIENTS_ENABLED} == 1 ) { return 0; } else { Show(indent=>"$input{indent}$space",message=>"Remote RMC clients are not enabled on $ARGS{TARGETS}.\n"); addToReport(message=>"Remote RMC clients are not enabled on $ARGS{TARGETS}. You can enable them by running on $ARGS{TARGETS} ". "these commands :\n". "\t/usr/sbin/rsct/bin/rmcctrl -z\n". "\t/usr/sbin/rsct/bin/rmcctrl -q\n". "\t/usr/sbin/rsct/bin/rmcctrl -s\n", action=>sub { print "Running rmcctrl -z on $ARGS{TARGETS}\n"; system("LC_ALL=C $DATA{REXECCMD} $ARGS{TARGETS} /usr/sbin/rsct/bin/rmcctrl -z"); print "Running rmcctrl -q on $ARGS{TARGETS}\n"; system("LC_ALL=C $DATA{REXECCMD} $ARGS{TARGETS} /usr/sbin/rsct/bin/rmcctrl -q"); print "Running rmcctrl -s on $ARGS{TARGETS}\n"; system("LC_ALL=C $DATA{REXECCMD} $ARGS{TARGETS} /usr/sbin/rsct/bin/rmcctrl -s"); }); return 1; } } ################################################################################ # ;checkIfHostnamesMatch ################################################################################ sub checkIfHostnamesMatch { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Verify hostnames resolve consistantly between this machine and $ARGS{TARGETS}."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } my $rc = 0; # Does my hostname match what the target resolves it to? if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space", message=>"Checking that $ARGS{TARGETS} resolves this machines name to $DATA{LOCALHOSTNAME}\n"); } if ( $DATA{LOCALHOSTNAME} && $DATA{TARGETS}{"$ARGS{TARGETS}"}{TARGETS}{RESOLVED_NAME} ) { if ( $DATA{LOCALHOSTNAME} ne $DATA{TARGETS}{"$ARGS{TARGETS}"}{TARGETS}{RESOLVED_NAME} ) { Show(indent=>"$input{indent}$space$space", message=>"$ARGS{TARGETS} does not resolve this machines name to $DATA{LOCALHOSTNAME}\n"); addToReport(message=>"This machines hostname is '$DATA{LOCALHOSTNAME}', yet $ARGS{TARGETS} resolves ". "it to '$DATA{TARGETS}{$ARGS{TARGETS}}{TARGETS}{RESOLVED_NAME}'. Change name resolution setup ". "so that these machines resolve names consistantly with each other.\n"); if ( !$ARGS{KEEP_GOING} ) { return 1; } $rc |= 1; } } # Is what we resolve the target to a hostname that it has for itself? if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space", message=>"Checking that what this machine resolves $ARGS{TARGETS} to is a hostname that it has for itself.\n"); } my $res = `LC_ALL=C $COMMANDS{getRemoteHostName} $ARGS{TARGETS} | awk '{print \$8}'`; if ( $? == 0 ) { chomp $res; my %TargetsHostnames = ( $DATA{TARGETS}{"$ARGS{TARGETS}"}{TARGETS}{CONNECTIVITY_NAME}, 1, $DATA{TARGETS}{"$ARGS{TARGETS}"}{LOCALHOSTNAME}, 1 ); my $found = 0; foreach my $hostname ( keys %TargetsHostnames ) { if ( $hostname eq $res ) { $found = 1; last; } } if ( $found == 0 ) { Show(indent=>"$input{indent}$space",message=>"$ARGS{TARGETS} does not think that $res is one of its hostnames.\n"); if ( $DATA{TARGETS}{"$ARGS{TARGETS}"}{OSNAME} eq "AIX" && ($DATA{TARGETS}{"$ARGS{TARGETS}"}{OSVERSION} eq "5.2" || $DATA{TARGETS}{"$ARGS{TARGETS}"}{OSVERSION} eq "5.3" || $DATA{TARGETS}{"$ARGS{TARGETS}"}{OSVERSION} eq "5.1F" ) ) { my $base_message = "$ARGS{TARGETS} does not consider '$res' to be one of the hostnames that RMC uses (which is/are ". commafy("and",sort keys %TargetsHostnames)."), so $ARGS{TARGETS} will reject connections ". "intended for '$res' (Note that '$res' is the hostname this machine resolves $ARGS{TARGETS} to.)"; if ( !defined $DATA{TARGETS}{"$ARGS{TARGETS}"}{DAEMONS}{"IBM.CSMAgentRM"} ) { addToReport(message=>"$base_message". "Since $ARGS{TARGETS} is running $DATA{TARGETS}{$ARGS{TARGETS}}{OSNAME} $DATA{TARGETS}{$ARGS{TARGETS}}{OSVERSION}, ". "you probably have changed some hostname settings for $ARGS{TARGETS}. CSMAgentRM on $ARGS{TARGETS} would normally ". "detect and adjust for this hostname change in a few minutes, however it appears to not be registerd with src on $ARGS{TARGETS}."); } elsif ( $DATA{TARGETS}{"$ARGS{TARGETS}"}{DAEMONS}{"IBM.CSMAgentRM"}{responding} == 1 ) { addToReport(message=>"$base_message". "Since $ARGS{TARGETS} is running $DATA{TARGETS}{$ARGS{TARGETS}}{OSNAME} $DATA{TARGETS}{$ARGS{TARGETS}}{OSVERSION}, ". "you probably have changed some hostname settings for $ARGS{TARGETS}. CSMAgentRM on $ARGS{TARGETS} should detect ". "and adjust for this hostname change in a few minutes. You can force it to try now by running ". "'refrsrc IBM.ManagementServer' on $ARGS{TARGETS}."); } elsif ( $DATA{TARGETS}{"$ARGS{TARGETS}"}{DAEMONS}{"IBM.CSMAgentRM"}{pid} == -1 ) { addToReport(message=>"$base_message". "Since $ARGS{TARGETS} is running $DATA{TARGETS}{$ARGS{TARGETS}}{OSNAME} $DATA{TARGETS}{$ARGS{TARGETS}}{OSVERSION}, ". "you probably have changed some hostname settings for $ARGS{TARGETS}. CSMAgentRM on $ARGS{TARGETS} would normally ". "detect and adjust for this hostname change in a few minutes, however it appears that its not running on $ARGS{TARGETS}."); } else { addToReport(message=>"$base_message". "Since $ARGS{TARGETS} is running $DATA{TARGETS}{$ARGS{TARGETS}}{OSNAME} $DATA{TARGETS}{$ARGS{TARGETS}}{OSVERSION}, ". "you probably have changed some hostname settings for $ARGS{TARGETS}. CSMAgentRM on $ARGS{TARGETS} would normally ". "detect and adjust for this hostname change in a few minutes, however it appears that its not for some reason. ". "Check the report for the findings on $ARGS{TARGETS} for any hints as to why its not."); } } else { addToReport(message=>"$base_message". "Correct the name resolution problems so that $ARGS{TARGETS} thinks one of its hostnames ". "is $res OR that we use some hostname for the remote target from its list of hostnames shown above."); } if ( !$ARGS{KEEP_GOING} ) { return 1; } $rc |= 1; } } if ( !$DATA{TARGETS}{"$ARGS{TARGETS}"}{TARGETS}{CONNECTIVITY_NAME} ) { Show(indent=>"$input{indent}$space",message=>"$ARGS{TARGETS} will use the ".$DATA{TARGETS}{"$ARGS{TARGETS}"}{TARGETS}{CONNECTIVITY_IP}. " adaptor to connect back to us, but it cannot resolve that IP address to a hostname.\n"); addToReport(message=>"$ARGS{TARGETS} will use the ".$DATA{TARGETS}{"$ARGS{TARGETS}"}{TARGETS}{CONNECTIVITY_IP}. " adaptor to connect back to this machine, but it cannot resolve that IP address to a hostname."); if ( !$ARGS{KEEP_GOING} ) { return 1; } $rc |= 1; } return 0; } ################################################################################ # ;checkRemoteTHL ################################################################################ sub checkRemoteTHL { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check THL file on $ARGS{TARGETS}.", desc=>"We look for an entry in $ARGS{TARGETS}'s THL file with our public key under our hostname."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } if ( defined $DATA{TARGETS}{"$ARGS{TARGETS}"} ) { if ( $DATA{TARGETS}{$ARGS{TARGETS}}{THL_VALID} ne "true" ) { Show(indent=>"$input{indent}$space", message=>"$ARGS{TARGETS} does not have a valid THL file.\n"); addToReport(message=>"$ARGS{TARGETS} does not have a valid THL file.\n"); return 1; } if ( ! defined $DATA{TARGETS}{$ARGS{TARGETS}}{THL}{$DATA{LOCALHOSTNAME}} ) { # no entry for us under $DATA{LOCALHOSTNAME} Show(indent=>"$input{indent}$space", message=>"$ARGS{TARGETS} does not have an entry in its THL file for $DATA{LOCALHOSTNAME}.\n"); if ( $DATA{PK}{meth} && $DATA{PK}{key} ) { addToReport(message=>"$ARGS{TARGETS} does not have an entry in its THL file for $DATA{LOCALHOSTNAME}.\n". "This could be a result of a recent hostname change of this machine and no CSM refresh having been completed ". "yet between this machine and $ARGS{TARGETS}. It could also be simply that no CSM setup has ever ". "been done between this machine and $ARGS{TARGETS}. Since there are many reasons this could occur, I will ". "not try to list them all nor dig deeper to see what it may be.\n". "However, if you just want to get this machines public key into the THL file on $ARGS{TARGETS}, run this command ". "on $ARGS{TARGETS} (on a single line!):\n". "\t/usr/sbin/rsct/bin/ctsthl -a -n $DATA{LOCALHOSTNAME} -m $DATA{PK}{meth} -p $DATA{PK}{key}\n", action=> sub { print "Running\n\t'/usr/sbin/rsct/bin/ctsthl -a -n $DATA{LOCALHOSTNAME} -m $DATA{PK}{meth} -p $DATA{PK}{key}'\non $ARGS{TARGETS}"; system("LC_ALL=C $DATA{REXECCMD} $ARGS{TARGETS} /usr/sbin/rsct/bin/ctsthl -a -n $DATA{LOCALHOSTNAME} -m $DATA{PK}{meth} -p $DATA{PK}{key}"); }); } else { # we are missing our own public key ! if ( $DATA{DAEMONS}{ctcas}{pid} == -1 ) { if ( $DATA{REMOTE_CLIENTS_ENABLED} != 1 ) { # ctcas is not running and remote RMC clients are *not* enabled addToReport(message=>"$ARGS{TARGETS} does not have an entry in its THL file for $DATA{LOCALHOSTNAME}.\n". "However, it seems that this machine has no public key anyway, so you need to fix that problem first. ". "Since ctcas is not running and remote RMC clients are not enabled, you can run these commands to try to ". "get things going again:\n". "\t/usr/sbin/rsct/bin/rmcctrl -z\n". "\t/usr/sbin/rsct/bin/rmcctrl -q\n". "\t/usr/sbin/rsct/bin/rmcctrl -s\n", action=>\&action_enableRemoteRMCClients); } else { # ctcas is not running and remote RMC clients are enabled addToReport(message=>"$ARGS{TARGETS} does not have an entry in its THL file for $DATA{LOCALHOSTNAME}.\n". "However, it seems that this machine has no public key anyway, so you need to fix that problem first. ". "Since ctcas is not running, you can starting it with this command:\n". "\tstartsrc -s ctcas\n", action=>sub {print "Running 'startsrc -s ctcas'\n"; system("LC_ALL=C startsrc -s ctcas"); }); } } else { # ctcas is running, so why dont we have a public key??? addToReport(message=>"$ARGS{TARGETS} does not have an entry in its THL file for $DATA{LOCALHOSTNAME}.\n". "However, it seems that this machine has no public key anyway, so you need to fix that problem first. ". "Since ctcas is running, the file should be present. Unknown reason why this machine has no public key. ". "Try running the command '/usr/sbin/rsct/bin/ctskeygen -d' to see if it gives any clues.", action=> sub { print "Running '/usr/sbin/rsct/bin/ctskeygen -d' to check why me seem to be missing a public key\n"; system("LC_ALL=C /usr/sbin/rsct/bin/ctskeygen -d"); }); } } } elsif ( $DATA{TARGETS}{$ARGS{TARGETS}}{THL}{$DATA{LOCALHOSTNAME}}{meth} ne $DATA{PK}{meth} ) { # generation method does not match addToReport(message=>"Out THL does not have the correct PK for $ARGS{TARGETS}."); } elsif ( $DATA{TARGETS}{$ARGS{TARGETS}}{THL}{$DATA{LOCALHOSTNAME}}{key} ne $DATA{PK}{key} ) { addToReport(message=>"Out THL does not have the correct PK for $ARGS{TARGETS}."); } } # TODO - be sure our THL has the correct PK from $ARGS{TARGETS} return 0; } ################################################################################ # ;checkRemoteACL ################################################################################ sub checkRemoteACL { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check RMC ACL file on $ARGS{TARGETS}.", desc=>"If $ARGS{TARGETS} is an LPAR (and therefore we are running on the HMC), we look for entries ". "that grant this machine read/write access to all needed resources. If $ARGS{TARGETS} is ". "an HMC (and therefore we are running on an LPAR), then we only look for a valid ACL file, ie, we dont care what entries are present."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } if ( $DATA{TYPE} eq "HMC" && $DATA{TARGETS}{"$ARGS{TARGETS}"}{TYPE} eq "LPAR" ) { if ( $DATA{TARGETS}{"$ARGS{TARGETS}"}{ACLS_FILE_VALID} == 0 ) { Show(indent=>"$input{indent}$space", message=>"$ARGS{TARGETS}'s RMC ACL file does not appear to be valid. This could be ". "the result of ctrmc being down on $ARGS{TARGETS}.\n"); addToReport(message=>"$ARGS{TARGETS}'s RMC ACL file does not appear to be valid. This could be ". "the result of ctrmc being down on $ARGS{TARGETS}.\n"); return 1; } my $stanza_name = "IBM.ServiceEvent"; if ( $DATA{TARGETS}{"$ARGS{TARGETS}"}{OSVERSION} eq "5.2" || $DATA{TARGETS}{"$ARGS{TARGETS}"}{OSVERSION} eq "5.3" || ($DATA{TARGETS}{"$ARGS{TARGETS}"}{OSVERSION} eq "5.1" && $DATA{TARGETS}{"$ARGS{TARGETS}"}{FIX_LEVEL} ge "03")) { $stanza_name = "DEFAULT"; } if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space", message=>"Checking for a 'root\@$DATA{LOCALHOSTNAME} * rw' entry in the $stanza_name stanza.\n"); } if ( !defined $DATA{TARGETS}{"$ARGS{TARGETS}"}{ACLS}{$stanza_name}{"root\@$DATA{LOCALHOSTNAME}"} ) { Show(indent=>"$input{indent}$space", message=>"$ARGS{TARGETS}'s RMC ACL file does not have an entry in the ". "$stanza_name stanza for 'root\@$DATA{LOCALHOSTNAME}'\n"); addToReport(message=>"$ARGS{TARGETS}'s RMC ACL file does not have an entry in the ". "$stanza_name stanza for 'root\@$DATA{LOCALHOSTNAME}'\n"); return 1; } if ( $DATA{TARGETS}{"$ARGS{TARGETS}"}{ACLS}{$stanza_name}{"root\@$DATA{LOCALHOSTNAME}"}{CR} ne "*" || $DATA{TARGETS}{"$ARGS{TARGETS}"}{ACLS}{$stanza_name}{"root\@$DATA{LOCALHOSTNAME}"}{perm} ne "rw" ) { Show(indent=>"$input{indent}$space", message=>"$ARGS{TARGETS}'s RMC ACL does have an entry in the $stanza_name stanza for 'root\@$DATA{LOCALHOSTNAME}', but its wrong!\n"); addToReport(message=>"$ARGS{TARGETS}'s RMC ACL does have an entry in the $stanza_name stanza for 'root\@$DATA{LOCALHOSTNAME}', but its wrong!\n". "The current entry is this:\n". "\troot\@$DATA{LOCALHOSTNAME}\t ". $DATA{TARGETS}{"$ARGS{TARGETS}"}{ACLS}{$stanza_name}{"root\@$DATA{LOCALHOSTNAME}"}{CR}."\t ". $DATA{TARGETS}{"$ARGS{TARGETS}"}{ACLS}{$stanza_name}{"root\@$DATA{LOCALHOSTNAME}"}{perm}." \n". "This entry should be:\n". "\troot\@$DATA{LOCALHOSTNAME}\t *\t rw\n"); return 1; } if ( $DATA{TARGETS}{"$ARGS{TARGETS}"}{OSVERSION} eq "5.2" || $DATA{TARGETS}{"$ARGS{TARGETS}"}{OSVERSION} eq "5.3" || ($DATA{TARGETS}{"$ARGS{TARGETS}"}{OSVERSION} eq "5.1" && $DATA{TARGETS}{"$ARGS{TARGETS}"}{FIX_LEVEL} ge "02")) { if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space", message=>"Checking for a 'root\@0x$DATA{NODEID} * rw' entry in the $stanza_name stanza.\n"); } if ( !defined $DATA{TARGETS}{"$ARGS{TARGETS}"}{ACLS}{$stanza_name}{"root\@0x$DATA{NODEID}"} ) { Show(indent=>"$input{indent}$space", message=>"$ARGS{TARGETS}'s RMC ACL file does not have an entry in the $stanza_name stanza for 'root\@0x$DATA{NODEID}'\n"); addToReport(message=>"$ARGS{TARGETS}'s RMC ACL file does not have an entry in the $stanza_name stanza for 'root\@0x$DATA{NODEID}'\n"); return 1; } if ( $DATA{TARGETS}{"$ARGS{TARGETS}"}{ACLS}{$stanza_name}{"root\@0x$DATA{NODEID}"}{CR} ne "*" || $DATA{TARGETS}{"$ARGS{TARGETS}"}{ACLS}{$stanza_name}{"root\@0x$DATA{NODEID}"}{perm} ne "rw" ) { Show(indent=>"$input{indent}$space", message=>"$ARGS{TARGETS}'s RMC ACL does have an entry in the $stanza_name stanza for 'root\@0x$DATA{NODEID}', but its wrong!\n"); addToReport(message=> "$ARGS{TARGETS}'s RMC ACL does have an entry in the $stanza_name stanza for 'root\@0x$DATA{NODEID}', but its wrong!\n". "The current entry is this:\n". "\troot\@0x$DATA{NODEID}\t ". $DATA{TARGETS}{"$ARGS{TARGETS}"}{ACLS}{$stanza_name}{"root\@0x$DATA{NODEID}"}{CR}."\t ". $DATA{TARGETS}{"$ARGS{TARGETS}"}{ACLS}{$stanza_name}{"root\@0x$DATA{NODEID}"}{perm}." \n". "This entry should be:\n". "\troot\@0x$DATA{NODEID}\t *\t rw\n"); return 1; } } # all tests passed, so return success. return 0; } elsif ( $DATA{TYPE} eq "LPAR" && $DATA{TARGETS}{"$ARGS{TARGETS}"}{TYPE} eq "HMC" ) { if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space", message=>"Checking for a syntactically correct RMC ACL file on HMC $ARGS{TARGETS}.\n"); } if ( defined $DATA{TARGETS}{"$ARGS{TARGETS}"}{ACLS_FILE_VALID} && $DATA{TARGETS}{"$ARGS{TARGETS}"}{ACLS_FILE_VALID} == 1 ) { return 0; } Show(indent=>"$input{indent}$space", message=>"$ARGS{TARGETS}'s RMC ACL file does seem to be valid.\n"); addToReport(message=>"$ARGS{TARGETS}'s RMC ACL file seem to be valid.\n"); return 1; } Show(indent=>"$input{indent}$space", message=>"Unsupported usage of $DATA{TYPE} to $DATA{TARGETS}{$ARGS{TARGETS}}{TYPE}.\n"); addToReport(message=>"Unsupported usage of $DATA{TYPE} to $DATA{TARGETS}{$ARGS{TARGETS}}{TYPE}.\n"); return 1; } ################################################################################ # ;canDoRemoteLSRSRC ################################################################################ sub canDoRemoteLSRSRC { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent},shortdesc=>"Can we do a remote lsrsrc to $ARGS{TARGETS}?", desc=>"Run 'CT_CONTACT=$ARGS{TARGETS} lsrsrc -s IBM.Host' and see what result we get. If this works without error, ". "then we know that RMC authentication is working from this machine to $ARGS{TARGETS}."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } TRACE($input{indent},$space,"running CT_CONTACT=$ARGS{TARGETS} lsrsrc\n"); my $ret = `LC_ALL=C CT_CONTACT=$ARGS{TARGETS} /usr/sbin/rsct/bin/lsrsrc 2>&1`; if ( $? != 0 ) { Show(indent=>"$input{indent}$space", message=>"Cannot run CT_CONTACT=$ARGS{TARGETS} lsrsrc\n"); addToReport(message=>"Cannot run CT_CONTACT=$ARGS{TARGETS} lsrsrc\n". "Error was [$ret]"); TRACE(indent=>"$input{indent}$space","got error from command [$ret]\n"); return 1; } TRACE($input{indent},$space,"got no errors from command\n"); if ( $DATA{TYPE} eq "HMC" ) { if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space",message=>"Can we run CT_CONTACT=$ARGS{TARGETS} lsrsrc IBM.ServiceEvent?\n"); } TRACE($input{indent},$space,"running CT_CONTACT=$ARGS{TARGETS} lsrsrc IBM.ServiceEvent\n"); my $ret = `LC_ALL=C CT_CONTACT=$ARGS{TARGETS} /usr/sbin/rsct/bin/lsrsrc IBM.ServiceEvent 2>&1`; if ( $? != 0 ) { Show(indent=>"$input{indent}$space", message=>"Cannot run CT_CONTACT=$ARGS{TARGETS} lsrsrcIBM.ServiceEvent \n"); addToReport(message=>"Cannot run CT_CONTACT=$ARGS{TARGETS} lsrsrcIBM.ServiceEvent \n". "Error was [$ret]"); TRACE($input{indent},$space,"got error from command [$ret]\n"); return 1; } TRACE($input{indent},$space,"got no errors from command\n"); } return 0; } ################################################################################ # ;checkRemoteFindings ################################################################################ sub checkRemoteFindings { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent},shortdesc=>"Were any errors reported by $ME when run on $ARGS{TARGETS}", desc=>"Check the output of $ME when it was run on $ARGS{TARGETS} for any reported findings."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } my $summary=""; foreach my $finding ( sort keys %{$DATA{TARGETS}{"$ARGS{TARGETS}"}{FINDINGS}} ) { # key will be of the "i" form - see end of CollectExportData() for how this data is set. my $type = $DATA{TARGETS}{"$ARGS{TARGETS}"}{FINDINGS}{$finding}{type}; if ($type){$type="($type)";} else {$type="";} $summary .= " [$finding]$type $DATA{TARGETS}{$ARGS{TARGETS}}{FINDINGS}{$finding}{message}\n"; } # TODO - the summary needs to be word wrapped in the Show() call. Its OK in the report since all findings # are wrapped. if ( $summary ne "" ) { Show(indent=>"$input{indent}$space", message=>"$ME on $ARGS{TARGETS} reports the following findings (some may be repeated above):\n$summary"); addToReport(message=>"$ME on $ARGS{TARGETS} reports the following findings:\n$summary"); } } ################################################################################ # ;checkTargetNodeIDs ################################################################################ sub checkTargetNodeIDs { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check that each machine has a unique node id.", desc=>"All OS images must have a unique node id. Verify that this is the case."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } my %NodeIDs={}; push @{$NodeIDs{$DATA{NODEID}}},$DATA{LOCALHOSTNAME}; if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space",message=>"Node id is $DATA{NODEID} on this machine.\n"); } my @matches=(); foreach my $target ( keys %{$DATA{TARGETS}} ) { if ( $ARGS{VERBOSE} ) { Show(indent=>"$input{indent}$space",message=>"Node is is $DATA{TARGETS}{$target}{NODEID} on $target.\n"); } push @{$NodeIDs{$DATA{TARGETS}{$target}{NODEID}}},$target; } foreach my $node_id ( keys %NodeIDs ) { if ( $#{$NodeIDs{$node_id}} > 0 ) { my $list = commafy("and",sort @{$NodeIDs{$node_id}}); Show(indent=>"$input{indent}$space", message=>"ct_node_id $node_id is the same on hosts $list\n"); addToReport(message=>"ct_node_id $node_id is the same on hosts $list. ". "Run /usr/sbin/rsct/install/bin/recfgct on all (save one) of these machines. ". "Note that you will loose all data in the registry if you do this.", action=>sub { shift @{$NodeIDs{$node_id}}; # dont need to run on one target, so skip the first one... foreach my $target ($NodeIDs{$node_id}) { print "Running /usr/sbin/rsct/install/bin/recfgct on $target\n"; print "Note that you will loose all data in the registry if you do this. Shall I try [y/n]"; my $YN = ; print "\n"; if ( $YN =~ /[Yy]/ ) { system("LC_ALL=C $DATA{REXECCMD} $target /usr/sbin/rsct/bin/install/recfgct"); } } }); } } } ################################################################################ # ;checkDRM ################################################################################ sub checkDRM { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check DRM.", desc=>"Verify that DRM is active."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } if ( getSRCDaemonPID(indent=>"$input{indent}",subsystem=>"IBM.DRM") != 0 ) { # the function will have reported errors already, so we dont need to report more. return 1; } # TODO - verify that DRM is responsive return 0; } ################################################################################ # ;checkLparCmdRM ################################################################################ sub checkLparCmdRM { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check LparCmdRM.", desc=>"Verify that LparCmdRM is active."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } if ( getSRCDaemonPID(indent=>"$input{indent}",subsystem=>"IBM.LparCmdRM") != 0 ) { # the function will have reported errors already, so we dont need to report more. return 1; } # TODO - verify that LparCmdRM is responsive return 0; } ################################################################################ # ;checkSFP ################################################################################ sub checkSFP { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); Display(indent=>$input{indent}, shortdesc=>"Check ServiceRM.", desc=>"Verify that ServiceRM is active."); if ( $ARGS{DISPLAY_ONLY} ) { return 0; } if ( getSRCDaemonPID(indent=>"$input{indent}",subsystem=>"IBM.ServiceRM") != 0 ) { # the function will have reported errors already, so we dont need to report more. return 1; } `LC_ALL=C /usr/sbin/rsct/bin/lsrsrc IBM.ServiceEvent 2>&1 > /dev/null`; if ( $? != 0 ) { Show(indent=>"$input{indent}$space", message=>"IBM.ServiceRM not responding.\n"); addToReport(message=>"IBM.ServiceRM not responding.\n"); $DATA{DAEMONS}{"IBM.ServiceRM"}{responding}=0; return 1; } $DATA{DAEMONS}{"IBM.ServiceRM"}{responding}=1; return 0; } ################################################################################ # ;CollectExportData ################################################################################ sub CollectExportData { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); checkLocalRMC(); my $ret = `LC_ALL=C $COMMANDS{getRemoteHostName} $ARGS{TARGETS} | awk '{print \$8}'`; if ( $? == 0 ) { chomp $ret; $DATA{TARGETS}{RESOLVED_NAME} = $ret; } $ret = `LC_ALL=C /opt/csm/csmbin/getSourceIP2Target $ARGS{TARGETS}`; if ( $? == 0 ) { chomp $ret; $DATA{TARGETS}{CONNECTIVITY_IP} = $ret; $DATA{TARGETS}{CONNECTIVITY_NAME} = gethostbyaddr(Socket::inet_aton($ret), Socket::AF_INET); } elsif ( $? == 2 ) { $DATA{TARGETS}{RESOLVABLE} = 0; } if ( $DATA{TYPE} eq "HMC" ) { checkDMSRM(); checkLparCmdRM(); } else { checkCSMAgentRM(); if ( $DATA{OSVERSION} eq "5.2" || $DATA{OSVERSION} eq "5.3" ) { checkDRM(); } } checkSFP(); $DATA{SCRIPT_VERSION}=$VERSION; # append any found error or warning messages to $DATA foreach $finding ( @Report ) { $count++; my ($message, $action, $type) = @$finding; if ( $type ) {$type = "($type)";} $DATA{FINDINGS}{$count}{type}=$type; $DATA{FINDINGS}{$count}{message}=$message; } } ################################################################################ # ;usage ################################################################################ sub usage { print "\n", "Version $VERSION\n\n", "Usage: $ME [options]\n\n", "Options:\n", "--quiet : do not print steps as they are taken\n", "--verbose : be more verbose than usual\n", "--keepgoing : dont stop as errors are found, ie, keep going\n", "--displayonly : just show what tests would be done, but dont actually do\n", " them\n", "--action= : corrective action mode - 1 means ask, 9 means just do it.\n", " Default is dont take any corrective actions\n", "--trace : turn trace on. Trace info will be sent to $TRACE_FILE by\n", " default.\n", "--tracefile= : location to send trace information. This option does not\n", " enable the trace file: use the --trace option for that.\n", "--target= : name(s) of remote machine to test connection with\n", " Note: If a target is provided, a password must also be\n", " provided. This can be done either with the --password\n", " option or via the REXEC_PASS environment variable.\n", " For remote testing to be done, rexec must be enabled\n", " between this machine and the target. Also, this script\n", " must be installed on the remote target in $BaseDIR with\n", " a name of 'DiagnoseHMC'.\n", " You can pass multiple targets, each separted by a comma, but\n", " if you do, put quotes around the list of target names.\n", "--password= : password for user root each target - used in calls to rexec\n", " on the target.\n"; # Future work - get the wrap() idea working... # print wrap("\t--quiet : ",$id,"do not print steps as they are taken\n"); # print wrap("\t--verbose : ",$id,"be more verbose than usual\n"); # print wrap("\t--keepgoing : ",$id,"dont stop as errors are found, ie, keep going\n"); # print wrap("\t--displayonly : ",$id,"just show what tests would be done, but dont actually do them\n"); # print wrap("\t--action= : ",$id,"corrective action mode - 1 means ask, 2 means just do it. Default is dont take any corrective actions\n"); # print wrap("\t--trace : ",$id,"turn trace on. Trace info will be sent to $TRACE_FILE by default.\n"); # print wrap("\t--tracefile= : ",$id,"location to send trace information.\n"); # print wrap("\t--target= : ",$id,"name of remote machine to test connection with\n"); # print wrap($id,$id,"Note: If the target is provided, a password must also be provided. This can be done either with\n". # "the --password option or via the REXEC_PASS environment variable. ". # "For remote testing to be done, rexec must be enabled between this machine and the target.\n". # "Also, the $PackageName package must be installed on the remote target.\n"); # print wrap("\t--password= :",$id,"password for user root on target - used in calls to rexec on the target.\n"); print "\n", "example: Diagnose local system only\n", "\n\t$ME\n\n", "example: Diagnose local system and test connection with 'LPAR1'\n", "\n\t$ME --target=LPAR1 --password=passw0rd\n\n", ""; exit 1; } ################################################################################ # ;checkArgs ################################################################################ sub checkArgs { TRACE((caller(0))[3]," called\n"); $ARGS{REMOTE_USER} = "root"; # hard coded for now.... # foreach $arg (sort keys %ARGS ) { print "\$ARGS{$arg}=[$ARGS{$arg}]\n";} if ( $ARGS{EXPORT_DATA} ) { # $ARGS{QUIET_MODE} = 1; $ARGS{REMOTE_PASSWORD} = " "; $ARGS{KEEP_GOING} = 1; $CommentChar ="#"; } if ( $ARGS{EXPORT_DATA} && !$ARGS{TARGETS} ) { print "Must provide a target when using the exportdata option\n"; usage(); } my $PASSWORD = $ARGS{REMOTE_PASSWORD} ? $ARGS{REMOTE_PASSWORD} : $ENV{REXEC_PASS}; if ( $ARGS{TARGETS} && !$PASSWORD ) { TRACE("no REXEC_PASSWORD passed - using NULL\n"); $ARGS{REMOTE_PASSWORD} = ""; } else { $ARGS{REMOTE_PASSWORD} = $PASSWORD; } if ( $ARGS{VERBOSE} && $ARGS{QUIET_MODE} ) { print "Cant be verbose and quiet at the same time.\n"; usage(); } if ( defined $ARGS{ACTION_MODE} && !($ARGS{ACTION_MODE} == 1 || $ARGS{ACTION_MODE} == 9) ) { print "$ARGS{ACTION_MODE} is not a valid value for the action option.\n"; usage(); } if ( defined $ARGS{QUIET_MODE} && defined $ARGS{DISPLAY_ONLY} ) { print "Cant be quiet and display tasks at the same time.\n"; usage(); } } ################################################################################ # ;setOSName # Get the OS name and confirm its one we know about ################################################################################ sub setOSName { my %input = @_; TRACE($input{indent},(caller(0))[3]," called\n"); my $OS = `LC_ALL=C uname -a`; if ( $OS =~ /Linux/ ) { $DATA{TYPE} = "HMC"; if (-f "/etc/redhat-release" ) { $DATA{OSNAME} = "Linux"; $DATA{REXECCMD} = "REXEC_USER=$ARGS{REMOTE_USER} REXEC_PASS=$ARGS{REMOTE_PASSWORD} rexec"; # $DATA{OSVERSION} = `LC_ALL=C cat /etc/redhat-release | awk '{print \$5}'`; # chomp $DATA{OSVERSION}; # $DATA{OSVENDOR} = `LC_ALL=C cat /etc/redhat-release | awk '{print \$1" "\$2}'`; # chomp $DATA{OSVENDOR}; } else { $DATA{OSNAME} = "MCPLinux"; $DATA{REXECCMD} = "rexec -l $ARGS{REMOTE_USER} -p $ARGS{REMOTE_PASSWORD}"; } # Currently, OSVERSION only matters for LPAR, not for # the HMC. So we will just set it to 0. $DATA{OSVERSION} = "0"; } elsif ( $OS =~ /AIX/ ) { $DATA{TYPE} = "LPAR"; $DATA{OSNAME} = "AIX"; $DATA{REXECCMD} = "None"; # $DATA{OSVENDOR} = "IBM"; $OS = `LC_ALL=C oslevel 2>&1`; if ( $OS =~ /(\d+)\.(\d+)\.(\d+)\.(\d+)/ ) { $DATA{OSVERSION} = "$1.$2"; } $OS = `LC_ALL=C oslevel -r 2>&1`; if ( $OS =~ /(\d+)-(\d+)/ ) { $DATA{FIX_LEVEL} = "$2"; } } else { abort("Unknown OS type $OS - cannot continue",1); } } ################################################################################ # Action sub routines - called by auto-fix code. Dont call these directly! ################################################################################ sub action_enableRemoteRMCClients { print "Enabling remote RMC clients:\n"; print "Stopping rsct\n"; system("LC_ALL=C /usr/sbin/rsct/bin/rmcctrl -z"); print "Enabling remote clients\n"; system("LC_ALL=C /usr/sbin/rsct/bin/rmcctrl -q"); print "Starting rsct\n"; system("LC_ALL=C /usr/sbin/rsct/bin/rmcctrl -s"); } ################################################################################ # ;Show ################################################################################ sub Show { my %input = @_; if ( !$ARGS{QUIET_MODE} ) { print wrap ("$CommentChar$input{indent}","$CommentChar$input{indent}", $input{message} ); } } ################################################################################ # ;Display ################################################################################ sub Display { my %input = @_; if ( !$ARGS{QUIET_MODE} ) { my $desc = $input{shortdesc}; if ( $ARGS{VERBOSE} ) { $desc .= " $input{desc}"; } print wrap("$CommentChar$input{indent}- ","$CommentChar$input{indent} ",$desc); print "\n"; } } ################################################################################ # ;GetTermWidth ################################################################################ sub GetTermWidth { #until we get one of the below methods to work.... return 80; # die "no TIOCGWINSZ " unless defined &TIOCGWINSZ; # open(TTY, "+; print "\n"; if ( $YN =~ /[Yy]/ ) { $doit = 1; } } elsif ( $ARGS{ACTION_MODE} == 9 ) { $doit = 1; } if ( $doit == 1 ) { &$action(); } } print "------------------------------------------------------\n"; } } ################################################################################ # ;TRACE ################################################################################ sub TRACE { if ( $ARGS{TRACE_ON} == 1 ) { print TRACEFILE @_; } } # TODO # Get AIX level set to 5.1F, 5.1D, etc # Check that we are running as root # Collect time on LPAR and HMC - cannot be more than 90 days different # uuencoded Sub-commands - edit at your own peril! __DATA__ # begin 755 getLocalHostName.linux M?T5,1@$!`0````````````(``P`!````4(0$"#0````X"P```````#0`(``& M`"@`&@`9``8````T````-(`$"#2`!`C`````P`````4````$`````P```/0` M``#T@`0(](`$"!,````3````!`````$````!``````````"`!`@`@`0(@`<` M`(`'```%`````!````$```"`!P``@)<$"("7!`@@`0``.`$```8`````$``` M`@```-@'``#8EP0(V)<$",@```#(````!@````0````$````"`$```B!!`@( M@00((````"`````$````!````"]L:6(O;&0M;&EN=7@N6#[`CHW0```)#H6#[`B+%8R7!`B%TG5)BQ6(EP0(BP*%P'0:C70F M`(U"!*.(EP0(_Q*+%8B7!`B+"H7)=>JXU(,$"(7`=!"#[`QHD)<$".CH_O__ M@\00N`$```"CC)<$"(GL7<.-=@!5B>6#[`B)[%W#C;8`````5;BT@P0(B>6# M[`B%P'05@^P(:*"8!`AHD)<$".B#_O__@\00B>Q=PY"-M"8`````58GE@^P( MB>Q=PXVV`````%6)Y8'L&`$``(/L!&@``0``:@"-A?C^__]0Z,7^__^#Q!#' MA?3^__\`````@^P(:``!``"-A?C^__]0Z(3^__^#Q!"`O?C^__\`=&R#[`R- MA?C^__]0Z'G^__^#Q!")P(F%]/[__X.]]/[__P!T(8/L"(N%]/[___\P:,"& M!`CH(/[__X/$$+@`````ZU")]H/L"(/L".C9_?__@\0(B<")P/\P:`"'!`CH M]OW__X/$$+@"````ZR:#[`B#[`CHL?W__X/$"(G`B<#_,&A`AP0(Z,[]__^# MQ!"X`0```,G#58GE4X/L!*&4EP0(NY27!`B#^/]T%HUV`(V\)P````"#ZP3_ MT(L#@_C_=?186UW#58GE@^P(B>Q=PXVV`````%6)Y5-2Z`````!;@<,J$0`` MC78`Z!?^__^+7?S)PP````````````````````````,````!``(````````` M````````````````````````4E-#5"!#=%-E8R!N86UE(&9O"`W M+C$@,BXY-BTY-RD``$=#0SH@*$=.52D@,BXY-B`R,#`P,#"`W+C$@,BXY-BTY M."D``$=#0SH@*$=.52D@,BXY-B`R,#`P,#"`W M+C$@,BXY-BTY-RD`"``````````!````,#$N,#$````(``````````$````P M,2XP,0````@``````````0```#`Q+C`Q````"``````````!````,#$N,#$` M```(``````````$````P,2XP,0````@``````````0```#`Q+C`Q`````"YS M>6UT86(`+G-T6YS>6T`+F1Y;G-T<@`N9VYU+G9E6X`+G)E;"YP;'0`+FEN:70`+G!L=``N=&5X=``N9FEN M:0`NP````$````&````I(,$"*0# M``"@```````````````$````!````(`````!````!@```%"$!`A0!```(`(` M````````````$`````````"&`````0````8```!PA@0(<`8``!X````````` M``````0`````````C`````$````"````H(8$"*`&``#@```````````````@ M`````````)0````!`````P```("7!`B`!P``$```````````````!``````` M``":`````0````,```"0EP0(D`<```0```````````````0`````````I``` M``$````#````E)<$")0'```(```````````````$`````````*L````!```` M`P```)R7!`B````````````````0`````` J```1`````P``````````````7`H``-H```````````````$````````` ` end begin 755 getRemoteHostName.linux M?T5,1@$!`0````````````(``P`!````X(,$"#0```!P"@```````#0`(``& M`"@`&@`9``8````T````-(`$"#2`!`C`````P`````4````$`````P```/0` M``#T@`0(](`$"!,````3````!`````$````!``````````"`!`@`@`0(P`8` M`,`&```%`````!````$```#`!@``P)8$","6!`@8`0``,`$```8`````$``` M`@```!`'```0EP0($)<$",@```#(````!@````0````$````"`$```B!!`@( M@00((````"`````$````!````"]L:6(O;&0M;&EN=7@N&%?9FEN86QI>F4`7U]D97)E9VES=&5R7V9R86UE7VEN M9F\`9V5T:&]S=&)Y;F%M90!?7V5R````$````!!I:0T```(`J@`````````, MEP0(!@D``/"6!`@'`0``])8$"`<"``#XE@0(!P,``/R6!`@'!````)<$"`<% M```$EP0(!P8```B7!`@'!P``58GE@^P(Z+T```"0Z%,!``#H/@(``,G#_S7H ME@0(_R7LE@0(`````/\E\)8$"&@`````Z>#_____)?26!`AH"````.G0____ M_R7XE@0(:!````#IP/____\E_)8$"&@8````Z;#_____)0"7!`AH(````.F@ M_____R4$EP0(:"@```#ID/____\E")<$"&@P````Z8#___\````````````` M```Q[5Z)X8/D\%!44FC0A00(:#R#!`A15FC@A`0(Z)/____TB?95B>534.@` M````6X'#UA(``(N#*````(7`=`+_T(M=_,G#B?:0D)"0D)"0D%6)Y8/L"(L5 MS)8$"(72=4F+%Q=PXUV`%6) MY8/L"(GL7<.-M@````!5N&2#!`B)Y8/L"(7`=!6#[`AHV)<$"&C0E@0(Z*/^ M__^#Q!")[%W#D(VT)@````!5B>6#[`B)[%W#C;8`````58GE@^P(@WT(`G0< M@^P(BT4,_S!H((8$".BF_O__@\00N`$```#K>L=%_`````"#[`R+10R#P`3_ M,.BE_O__@\00B<")1?R#??P`=">#[`2+1?S_,(M%#(/`!/\P:$"&!`CH7?[_ M_X/$$+@`````ZS&-=@"#[`2#[`SH%?[__X/$#(G`B<#_,(M%#(/`!/\P:("& M!`CH*O[__X/$$+@"````R<.0D)"0D)"0D)"0D)!5B>53@^P$H=26!`B[U)8$ M"(/X_W06C78`C;PG`````(/K!/_0BP.#^/]U]%A;7<-5B>6#[`B)[%W#C;8` M````58GE4U+H`````%N!PPH1``"-=@#H1_[__XM=_,G#```````````````` M`````````P````$``@````````````````````````````````!56YS M='(`+F=N=2YV97)S:6]N`"YG;G4N=F5R'0`+F9I;FD`+G)O9&%T80`N9&%T80`N96A? M9G)A;64`+F-T;W)S`"YD=&]R6YA;6EC`"YS8G-S`"YB```````````````$`````````(P````!```` M`@````"&!`@`!@``P```````````````(`````````"4`````0````,```#` ME@0(P`8``!````````````````0`````````F@````$````#````T)8$"-`& M```$```````````````$`````````*0````!`````P```-26!`C4!@``"``` M````````````!`````````"K`````0````,```#!@@`````$0#Q_R8#``#LCP0(5@```!(````R```` M_(\$"$H````2````U0$```R0!`C"````$@```$\#````4``!(```#Q`@``C)$$"#H````2````?0,``)R1 M!`BO````$@```.<```"LD00(R@0``!(```#W````O)$$"$D````2````S0(` M`,R1!`@O````$@````8!``#`P``/)($"#P# M```2````Y`(``$R2!`BJ`0``$@```(,```#@Q04(`````!(`#@")````7)($ M"%4````2````C0(``&R2!`@G````$@```-0"``!\D@0(N0$``!(```"4`@`` MC)($")T````B````9@,``)R2!`@K````$@```)X#``!$7P8(`````!$`\?^1 M````5%T&"``````1`/'_D0,``*R2!`C[````$@```+$#``"$7P8(`````!$` M\?\M````O)($"%$````2````8`,``,R2!`@.````$@```"0!``#0!S=&1O=70`9V5T<&ED`&UE;6-P M>0!?7V-X85]F:6YA;&EZ90!M86QL;V,`;W!T87)G`'-O8VME=`!S96QE8W0` M:7-S<&%C90!C:&UO9`!S=')T;VP`!@@&3```1%\&"`4A``!(7P8(!48``&!=!@@'`0``9%T& M"`<"``!H708(!P,``&Q=!@@'!```<%T&"`<%``!T708(!P8``'A=!@@'!P`` M?%T&"`<(``"`708(!PD``(1=!@@'"P``B%T&"`<,``",708(!PT``)!=!@@' M#@``E%T&"`!@@'+P``#%X&"`!@@',@``&%X& M"`!@@'-@``)%X&"`!@@'.0`` M,%X&"`!@@'/P``/%X&"`=```!`7@8(!T$``$1>!@@' M0@``2%X&"`=#``!,7@8(!T0``%!>!@@'10``5%X&"`=(``!87@8(!TD``%Q> M!@@'2@``8%X&"`=+``!D7@8(!TT``%6)Y8/L".AE!```D.C[!```Z%8V`0#) MP_\U6%T&"/\E7%T&"`````#_)6!=!@AH`````.G@_____R5D708(:`@```#I MT/____\E:%T&"&@0````Z<#_____)6Q=!@AH&````.FP_____R5P708(:"`` M``#IH/____\E=%T&"&@H````Z9#_____)7A=!@AH,````.F`_____R5\708( M:#@```#I````.GP M_O___R6@708(:(````#IX/[___\EI%T&"&B(````Z=#^____):A=!@AHD``` M`.G`_O___R6L708(:)@```#IL/[___\EL%T&"&B@````Z:#^____);1=!@AH MJ````.F0_O___R6X708(:+````#I@/[___\EO%T&"&BX````Z7#^____)#]____)>1=!@AH"`$``.G0_?___R7H708(:!`!``#IP/W___\E[%T&"&@8 M`0``Z;#]____)?!=!@AH(`$``.F@_?___R7T708(:"@!``#ID/W___\E^%T& M"&@P`0``Z8#]____)?Q=!@AH.`$``.EP_?___R4`7@8(:$`!``#I8/W___\E M!%X&"&A(`0``Z5#]____)0A>!@AH4`$``.E`_?___R4,7@8(:%@!``#I,/W_ M__\E$%X&"&A@`0``Z2#]____)11>!@AH:`$``.D0_?___R487@8(:'`!``#I M`/W___\E'%X&"&AX`0``Z?#\____)2!>!@AH@`$``.G@_/___R4D7@8(:(@! M``#IT/S___\E*%X&"&B0`0``Z<#\____)2Q>!@AHF`$``.FP_/___R4P7@8( M:*`!``#IH/S___\E-%X&"&BH`0``Z9#\____)3A>!@AHL`$``.F`_/___R4\ M7@8(:+@!``#I!@AHR`$``.E0_/__ M_R5(7@8(:-`!``#I0/S___\E3%X&"&C8`0``Z3#\____)5!>!@AHX`$``.D@ M_/___R547@8(:.@!``#I$/S___\E6%X&"&CP`0``Z0#\____)5Q>!@AH^`$` M`.GP^____R5@7@8(:``"``#IX/O___\E9%X&"&@(`@``Z=#[__\`````,>U> MB>&#Y/!05%)HX,4%"&@TCP0(459H@)0$".A[_O__](GV58GE4U#H`````%N! MPZ;)`0"+@Q0!``"%P'0"_]"+7?S)PXGVD)"0D)"0D)!5BQ6,0P8(B>6#[`B% MTG5)BQ6(0P8(BP*%P'0:C70F`(U"!*.(0P8(_Q*+%8A#!@B+"H7)=>JX/)$$ M"(7`=!"#[`QH0%T&".@@_?__@\00N`$```"CC$,&"(GL7<.-=@!5B>6#[`B) M[%W#C;8`````58GEN%R3!`B#[`B%P'05@^P(:$Q?!@AH0%T&".C[_O__@\00 MB>Q=PY"-M"8`````58GE@^P(B>Q=PXVV`````%6)Y8'L1!$``%?'A?#O__\` M````QX7L[___`````,>%X.___P````"-A?SO__^)A=CO__^#Q/AJ+XM%#(L0 M4NBX_?__@\00B<"C1$<&"(,]1$<&"`!U#8M%#(L0B15$1P8(ZP;_!41'!@B- MM@````"#Q/RA0$<&"%"+10Q0BT4(4.A6_/__@\00B<")A?3O__^#O?3O____ M=0;IM@```)"+A?3O__^#^&QT18/X;'\0@_AF=!OIC@```(VV`````(/X%^.___P````"#O>CO__\`=07IF@P``&;'1?X`$(/$^(V%Z.__ M_U"+A=CO__]0C47^4&H`:)3&!0AHFL8%".@*^___@\0@B<")A>SO__^#O>SO M__\`#X4["P``#[]%_HU0BL>%Q.[__Q^%ZU&+A<3N___WXHG1P>D%B8WD[___ M#[8%VEL&"(/X`7\(A("`("``"`="-%(4``````="-%(4`````C4)VB<(#E=CO M__^-0D50Z/7X__^#Q!")P(U0`5*+E`"`="-%(4``````="- M%(4`````C4)VB<(#E=CO__^-0@10Z(SX__^#Q!")P(U0`5*+E`"`="- M%(4``````="-%(4`````C4)VB<(#E=CO__^-0@2)A<3O___'A]/__@\00B<"%P'4)ZPR-M"8`````Z?````#'A-M@````"+A<3O__^`.`!U!>MHC78`@\3\ M:@J-A<3O__]0BX7$[___4.C$]?__@\00B87([___BX7$[___@#@`=22#Q/2+ MA<3O__\/MA!2Z/[S__^#Q!")P(7`=0GK"8VT)@````#K$\>%R.___P````#K M!XGVZ=S]__^#Q/1J!(V%R.___U!J`6IL:(C&!0CH[?+__X/$(.L`@SU(1P8( M``^$B@```(/$_&B4Q@4(H=!@[]?__@\0@@\3T MC87$[___4.@)]?__@\00@\3XC87([___4(N%Q.___U#HX/+__X/$$(/$^(N% MR.___U"A1%\&"%#H>//__X/$$(/$](N%R.___U#HYO/__X/$$(/$](N%Q.__ M_U#H]/3__X/$$,>%\.___P$```#I:`4``(VV``````^V!=I;!@B%P'0%ZP6- M=@#K%(/$^&IN:(C&!0CHZ_3__X/$$.L`@SU(1P8(``^$B@```(/$_&B4Q@4( MH=1AI]/__@\0@@\3TC87`[___4.@W]/__@\00 M@\3XC86\[___4(N%P.___U#H#O+__X/$$(/$^(N%O.___U"A1%\&"%#HIO+_ M_X/$$(/$](N%O.___U#H%//__X/$$(/$](N%P.___U#H(O3__X/$$,>%\.__ M_P$```#IE@0``(UT)@"-A;OO__^*%9K&!0B(E;OO__^-A;KO__^@FL8%"(B% MNN___P^V!=I;!@B%P'0"ZP+K%(/$^&IO:(C&!0CH^_/__X/$$.L`@SU(1P8( M``^$B@```(/$_&B4Q@4(H=AAY\___@\0@@\3T MC86T[___4.A'\___@\00@\3XC86P[___4(N%M.___U#H'O'__X/$$(/$^(N% ML.___U"A1%\&"%#HMO'__X/$$(/$](N%L.___U#H)/+__X/$$(/$](N%M.__ M_U#H,O/__X/$$(/$^&H`:@"-A;KO__]0C86[[___4&B4Q@4(:)K&!0CHB_+_ M_X/$((G`B87L[___@[WL[___``^-YP```(&][.___[O<__\/A-<````/M@7: M6P8(AAH\O__@\0@ M@\3TC86L[___4.@V\O__@\00@\3XC86H[___4(N%K.___U#H#?#__X/$$(/$ M^(N%J.___U"A1%\&"%#HI?#__X/$$(/$](N%J.___U#H$_'__X/$$(/$](N% MK.___U#H(?+__X/$$,>%\.___RD```#IN0$``(UV`(&][.___[O<__\/A=`` M```/M@7:6P8(AL%C78`ZQ2#Q/AJ<6B(Q@4(Z`OR__^#Q!#K`(,]2$<& M"``/A(X```"+A>SO__]0:)3&!0BAZ%P&"%!J0FH!:)O&!0AJ`&H!Z(7Q__^# MQ""#Q/2-A:3O__]0Z%/Q__^#Q!"#Q/B-A:#O__]0BX6D[___4.@J[___@\00 M@\3XBX6@[___4*%$7P8(4.C"[___@\00@\3TBX6@[___4.@P\/__@\00@\3T MBX6D[___4.@^\?__@\00QX7P[___`0```.G6````#[8%VEL&"(7`=`7K!8UV M`.L?@\3T:@2-A>SO__]0:@%JSO__]0:)3&!0BAX%P&"%!J0&H!:)O&!0AJ`&H!Z*KP__^#Q""#Q/2- MA9SO__]0Z'CP__^#Q!"#Q/B-A9CO__]0BX6<[___4.A/[O__@\00@\3XBX68 M[___4*%$7P8(4.CG[O__@\00@\3TBX68[___4.A5[___@\00@\3TBX6<[___ M4.AC\/__@\00QX7P[___`0```.G7````D(UT)@"#O?CO__\`=`_'A?#O__\I M````Z:P```#_A?CO___'A>CO__\#````QX7P[___`0```,>%D.___P````#' MA93O__\`X?4%#[8%VEL&"(7`=`+K`NL;@\3X:G5HB,8%".@8\/__@\00ZP>- MM"8`````@\3XC86([___4(V%D.___U#HQNW__X/$$(G`@_C_=`+K,NBE[O__ MB<")PH,Z!'4@BX6([___BY6,[___B860[___B964[___ZPB-M@````#K`NNL MZPS'A?#O__\I````ZP#K#/^%S.___^E1]?__D(.]\.___REU!^DB`0``B?;I M$0$``(&][.___Z#<__]U-`^V!=I;!@B%P'0$ZP2)]NL4@\3X:FEHB,8%".A; M[___@\00ZP#'A>CO__\#````Z=$````/M@7:6P8(A1B<[O__@\0@@\3TC868[___4.AJ[O__@\00 M@\3XC86<[___4(N%F.___U#H0>S__X/$$(/$^(N%G.___U"A1%\&"%#HV>S_ M_X/$$(/$](N%G.___U#H1^W__X/$$(/$](N%F.___U#H5>[__X/$$,>%\.__ M_RD```#K"NE=\___D(UT)@#K!>GM\/__@[WP[___`0^%-@<``,>%G.___P`` M``"-O1CO__\QP/RY&P```/.K9JL/M@7:6P8(AL%C78`ZQ2#Q/AJ>&B( MQ@4(Z!ON__^#Q!#K`,>%\.___P````"#Q/QJ`&H!:@'H'N___X/$$(G`B868 M[___@[V8[___`'U1#[8%VEL&"(7`?!6#^`%^#H/X!'0)ZPF-M"8`````ZR*# MQ/1J!.B`[/__B<")PE)J`6IV:(C&!0CHW>K__X/$(.L`QX7P[___*0```.DB M!0``9L>%&.___P$`@\3X:*7&!0B-A1CO__^-4`)2Z+GN__^#Q!"#Q/AHP<8% M"(V%&.___XU0`E+H?^W__X/$$(/$_&INC948[___B=!0BX68[___4.@2[O__ M@\00B<"%P`^-*0$``.CPZ___B<")PH,ZK__X/$$,>%B.___P````#'A8SO__^`EI@`#[8%VEL&"(7`?!6# M^`%^#H/X!'0)ZPF-M"8`````ZQ2#Q/AJ=&B(Q@4(Z&OL__^#Q!#K`(/$^(V% MD.___U"-A8CO__]0Z"#J__^#Q!")P(/X_W0"ZRSH_^K__XG`B<*#.@1U&HN% MD.___XN5E.___XF%B.___XF5C.___^L"ZP+KLNF/`P``C;0F`````(V]\.[_ M_S'`_+D*````\ZN-O%C.___P`` M``#'A9#O__\`````QX64[___`````,>%R.[__VER=7/'A#Q/2-A:#O__]0Z/;J__^#Q!"#Q/B-A:3O__]0BX6@[___ M4.C-Z/__@\00@\3XBX6D[___4*%$7P8(4.AEZ?__@\00@\3TBX6D[___4.C3 MZ?__@\00@\3TBX6@[___4.CAZO__@\00QX7P[___*0```.DS`@``C78`@\3X MC860[___4(N%F.___U#H*@0``(/$$(G`B87P[___@[WP[___``^$@@```(,] M2$<&"`!T9X/$](V%J.___U#H1NK__X/$$(/$^(V%K.___U"+A:CO__]0Z!WH M__^#Q!"#Q/B+A:SO__]0H41?!@A0Z+7H__^#Q!"#Q/2+A:SO__]0Z"/I__^# MQ!"#Q/2+A:CO__]0Z#'J__^#Q!#'A?#O__\I````Z8,!``"-=@"#Q/B-A8CO M__]0BX68[___4.CF"0``@\00B<")A?#O__^#O?#O__\`#X2"````@SU(1P8( M`'1G@\3TC86P[___4.B6Z?__@\00@\3XC86\[___4(N%L.___U#H;>?__X/$ M$(/$^(N%O.___U"A1%\&"%#H!>C__X/$$(/$](N%O.___U#H<^C__X/$$(/$ M](N%L.___U#H@>G__X/$$,>%\.___RD```#ITP```(UV`(/$^(V%\.[__U"- MA8CO__]0Z-X2`0"#Q!")P(F%\.___X.]\.___P`/A((```"#/4A'!@@`=&># MQ/2-A<#O__]0Z.;H__^#Q!"#Q/B-A<3O__]0BX7`[___4.B]YO__@\00@\3X MBX7$[___4*%$7P8(4.A5Y___@\00@\3TBX7$[___4.C#Y___@\00@\3TBX7` M[___4.C1Z/__@\00QX7P[___*0```.LFC;8`````@[T`[___9'0,QX7P[___ M*0```.L+ZPGI)/W__XUT)@"#Q/2+A9CO__]0Z,WF__^#Q!"#Q/2-A8CO__]0 MZ+OI__^#Q!"#Q/2-A9#O__]0Z*GI__^#Q!"#Q/2-A?#N__]0Z-\4`0"#Q!#K M"XVV`````.EK^O__@[WP[___`'4U#[8%VEL&"(7`=`?K!Y"-="8`ZQ^#Q/1J M!(V%G.___U!J`6IY:(C&!0CH<.7__X/$(.L`ZQV+A9SO____A9SO__\]QP`` M`'X"ZPCI"?K__XUV`(.]\.___P!T)P^V!=I;!@B%P'0"ZP+K&(/$^&IZ:(C& M!0CH]>?__X/$$.L$C70F`(,]2$<&"``/A+T```"#O?#O__\`=2J#Q/QHE,8% M"*'L7`8(4&I#:@%HF\8%"&H`:BGH9N?__X/$(.LHD(UT)@"#Q/QHE,8%"*'P M7`8(4&I$:@%HF\8%"&H`:BGH/.?__X/$((/$](V%H.___U#H"N?__X/$$(/$ M^(V%I.___U"+A:#O__]0Z.'D__^#Q!"#Q/B+A:3O__]0H41?!@A0Z'GE__^# MQ!"#Q/2+A:3O__]0Z.?E__^#Q!"#Q/2+A:#O__]0Z/7F__^#Q!`/M@7:6P8( MA6![&`!``!74\=%_`````"#Q/AH@\<%"(V%M/[__U#HUN?__X/$ M$`^V!=I;!@B%P'0,@_@(=`GK.I"-="8`ZS.#Q/2#Q/2-A;3^__]0Z-CE__^# MQ!")P(U0`5*-A;3^__]0:@%J/&B2QP4(Z'KC__^#Q"`QP+D@````C95\____ MB=?\\ZN)R(F%L/[__XGXB86L_O__ZPF-M"8`````Z].+10B)PL'J!8T$E0`` M``"-E7S___^+30B)RX/C'P^K'!`QP+D@````C97\_O__B=?\\ZN)R(F%K/[_ M_XGXB86P_O__ZPGKVHVT)@````"+10B)PL'J!8T$E0````"-E?S^__^+30B) MRX/C'P^K'!#'A?3^__\\````QX7X_O__`````(/$](V%]/[__U"-A?S^__]0 MC85\____4&H`BT4(0%#HT^/__X/$((G`B47\@WW\``^-C0```.@6!['`!``!74\=%_``` M``"#Q/AHL,@%"(V%M/[__U#H:N'__X/$$`^V!=I;!@B%P'0'@_@(=`OK/.LZ MC;0F`````(/$](/$](V%M/[__U#H:M___X/$$(G`C5`!4HV%M/[__U!J`6H\ M:)+'!0CH#-W__X/$(#'`N2````"-E7S___^)U_SSJXG(B86P_O__B?B)A:S^ M___K">O:C;0F`````(M%"(G"P>H%C025`````(V5?/___XM-"(G+@^,?#ZL< M$#'`N2````"-E?S^__^)U_SSJXG(B86L_O__B?B)A;#^___K`NO:BT4(B<+! MZ@6-!)4`````C97\_O__BTT(B%^/[__P`` M``"#Q/2-A?3^__]0C87\_O__4&H`C85\____4(M%"$!0Z&S=__^#Q"")P(E% M_(-]_``/C9,```#HM=W__XG`B<*+`E!HE\<%"*'\6P8(4&H':@%HH,<%"&H` M:@KH@=[__X/$(,=%_`H````/M@786P8(@_@(=TJ+!(4LR04(_^"-M@````#K M.8/$_&H$C47\4(/$](V%M/[__U#H`M[__X/$$(G`C5`!4HV%M/[__U!J`FH^ M:)+'!0CHI-O__X/$(.G5!0``Z88```"#??P`#X5\````@\3XH01D% MC1R-`````(V-_/[__P^C%`L/DL"$P'4JBTT(BADV___B<")PHL"4&C"R`4(H?Q;!@A0:@=J M`6B@QP4(:@!J"N@PW/__@\0@QT7\"@````^V!=A;!@B#^`AW28L$A9C)!0C_ MX)"-="8`ZSF#Q/QJ!(U%_%"#Q/2-A;3^__]0Z++;__^#Q!")P(U0`5*-A;3^ M__]0:@)J/FB2QP4(Z%39__^#Q"#IL````.FC````@[VH_O__``^%?@```(/$ M^*$,7`8(4&H+:@%HH,<%"&H`:@KHG]O__X/$(,=%_`H````/M@786P8(@_@( M=TB+!(6\R04(_^"-="8`ZSF#Q/QJ!(U%_%"#Q/2-A;3^__]0Z"+;__^#Q!") MP(U0`5*-A;3^__]0:@)J/FB2QP4(Z,38__^#Q"#K(^L9D(N%J/[__RF%I/[_ M_XN%J/[__P&%L/[__^EW_O__C78`@WW\`'0*ZVO__@\00B<")PHM%#(G2B5`$A=(/A8$```!H_````&C@R`4(H?!; M!@A0:@1J`6B@QP4(:@!J!NB5VO__@\0@QT7\!@````^V!=A;!@B#^`AW1(L$ MA>#)!0C_X.LY@\3\:@2-1?Q0@\3TC86T_O__4.@\!``"+10R+$(F5I/[__XM%#(M0!(F5 ML/[__XUV`(.]I/[__P!U!^F"`0``B?9J`(N%I/[__U"+A;#^__]0BT4(4.A# MV___@\00B<")A:C^__^#O:C^__\`#XVD````Z.;8__^)P(G"@SH$=0+KK^C6 MV/__B<")PHL"4&C"R`4(H?Q;!@A0:@=J`6B@QP4(:@!J"NBBV?__@\0@QT7\ M"@````^V!=A;!@B#^`AW2XL$A03*!0C_X(VT)@````#K.8/$_&H$C47\4(/$ M](V%M/[__U#H(MG__X/$$(G`C5`!4HV%M/[__U!J`FH^:)+'!0CHQ-;__X/$ M(.FP````Z:,```"#O:C^__\`#X5^````@\3XH0Q=C__X/$$,G#58GE@^Q8QT7T`````(/$^&C$R@4(C46T4.@6V?__@\00#[8% MVEL&"(7`=`R#^`AT">LTD(UT)@#K+8/$](/$](U%M%#H&]?__X/$$(G`C5`! M4HU%M%!J`6H\:-?*!0CHP-3__X/$((-]$``/A=<```"#Q/2+11!0:@-HQ,H% M"*%(7`8(4&H::@%HW,H%"&H`:A?H#=?__X/$,,=%]!<````/M@786P8(@_@( M=T"+!(4$RP4(_^")]NLS@\3\:@2-1?10@\3TC46T4.B5UO__@\00B<"-4`%2 MC46T4&H":CYHU\H%".@ZU/__@\0@#[8%VEL&"(7`=`>#^`AT"^L\ZSJ-M"8` M````@\3\:@2-1?10@\3TC46T4.A'UO__@\00B<"-4`%2C46T4&H":CUHU\H% M".CLT___@\0@N!<```#I\P0``(UV`(-]"``/A=8```"#Q/2+10A0:@%HQ,H% M"*%(7`8(4&H::@%HW,H%"&H`:A?H+-;__X/$,,=%]!<````/M@786P8(@_@( M=S^+!(4HRP4(_^"0ZS.#Q/QJ!(U%]%"#Q/2-1;10Z+75__^#Q!")P(U0`5*- M1;10:@)J/FC7R@4(Z%K3__^#Q"`/M@7:6P8(A'`@``BT7TB<*-!)4`````BY!,RP4(_^*0_T7XZ6H"``!J%&CFR@4(H4Q< M!@A0:AMJ`6C:@%HW,H%"&H`:A?H M)=3__X/$,,=%]!<````/M@786P8(@_@(=SZ+!(6\RP4(_^#K,X/$_&H$C47T M4(/$](U%M%#HK]/__X/$$(G`C5`!4HU%M%!J`FH^:-?*!0CH5-'__X/$(`^V M!=I;!@B%P'0*@_@(=`?K.(UV`.LS@\3\:@2-1?10@\3TC46T4.AET___@\00 MB<"-4`%2C46T4&H":CUHU\H%".@*T?__@\0@N!<```#I$0(``)"#Q/QHQ,H% M"*%<7`8(4&H?:@%HW,H%"&H`:AKH7-/__X/$(,=%]!H````/M@786P8(@_@( M=S^+!(7@RP4(_^"0ZS.#Q/QJ!(U%]%"#Q/2-1;10Z.72__^#Q!")P(U0`5*- M1;10:@)J/FC7R@4(Z(K0__^#Q"`/M@7:6P8(A#^`AT!.LUZS.#Q/QJ!(U%]%"#Q/2-1;10Z%/1__^#Q!")P(U0`5*-1;10 M:@)J/6C7R@4(Z/C.__^#Q"`QP.L%D(UT)@#)PXGV58GE@^Q8@\3X:"C,!0B- M1;Q0Z.'2__^#Q!#'1?P`````#[8%VEL&"(7`=`>#^`AT"^LVZS2-M"8````` M@\3T@\3TC46\4.C=T/__@\00B<"-4`%2C46\4&H!:CQHU\H%".B"SO__@\0@ M@WT(`'0BBT4(@S@`=!J#Q/2+10B+$%+H$]'__X/$$(M%",<``````(-]#`!T M(HM%#(,X`'0:@\3TBT4,BQ!2Z.O0__^#Q!"+10S'```````/M@7:6P8(A6![%@!``#'A?S^ M__\`````QX7X_O__`````(/$^&@]S`4(C86T_O__4.BWT?__@\00QX7T_O__ M``````^V!=I;!@B%P'0'@_@(=`3K->LS@\3T@\3TC86T_O__4.BTS___@\00 MB<"-4`%2C86T_O__4&H!:CQHU\H%".A6S?__@\0@@WT(``^%Y0```(/$](M% M"%!J`6@]S`4(H4AH"``"# M?0P`#X7F````@\3TBT4,4&H!:#W,!0BA2%P&"%!J&FH!:-S*!0AJ`&H7Z+3. M__^#Q##'A?3^__\7````#[8%V%L&"(/X"'=-BP2%>,P%"/_@C;8`````ZSR# MQ/QJ!(V%]/[__U"#Q/2-A;3^__]0Z"_.__^#Q!")P(U0`5*-A;3^__]0:@)J M/FC7R@4(Z-'+__^#Q"`/M@7:6P8(A#Q/2+ M10B+$%+H[#^`AT"^LVZS2-M"8`````@\3T M@\3TC46\4.AMR___@\00B<"-4`%2C46\4&H!:CQHU\H%".@2R?__@\0@@\3X MBT444(M%$%"+10Q0BT4(4&H`H8A;!@A0Z-_)__^#Q"")P(E%_(M%_(/X#W0V M@_@/?PZ%P'0AZ2H!``"0C70F`(/X$0^$EP```(/X%`^$C@```.D.`0``QT7\ M`````.E]`0``BT444&CFR@4(H4Q:@%HW,H%"&H`:A?H@\K__X/$,,=% M_!<````/M@786P8(@_@(=T2+!(7LS`4(_^#K.8VV`````(/$_&H$C47\4(/$ M](U%O%#H!\K__X/$$(G`C5`!4HU%O%!J`FH^:-?*!0CHK,?__X/$(.M[@\3\ M:++,!0BA8%P&"%!J(&H!:-S*!0AJ`&H:Z`?*__^#Q"#'1?P:````#[8%V%L& M"(/X"'<^BP2%$,T%"/_@ZS.#Q/QJ!(U%_%"#Q/2-1;Q0Z)')__^#Q!")P(U0 M`5*-1;Q0:@)J/FC7R@4(Z#;'__^#Q"#K!9"-="8`#[8%VEL&"(7`=`>#^`AT M!.LUZS.#Q/QJ!(U%_%"#Q/2-1;Q0Z$/)__^#Q!")P(U0`5*-1;Q0:@)J/6C7 MR@4(Z.C&__^#Q""+5?R)T.L"B?;)PXGV58GE@^Q8@\3X:#3-!0B-1;Q0Z-'* M__^#Q!#'1?P`````#[8%VEL&"(7`=`>#^`AT"^LVZS2-M"8`````@\3T@\3T MC46\4.C-R/__@\00B<"-4`%2C46\4&H!:CQHU\H%".ARQO__@\0@@\3XBT44 M4(M%$%"+10Q0BT4(4&H`H8Q;!@A0Z#_'__^#Q"")P(E%_(M%_(/X#W0V@_@/ M?PZ%P'0AZ2H!``"0C70F`(/X$0^$EP```(/X%`^$C@```.D.`0``QT7\```` M`.E]`0``BT4,4&CFR@4(H4Q:@%HW,H%"&H`:A?HX\?__X/$,,=%_!<` M```/M@786P8(@_@(=T2+!(5PS04(_^#K.8VV`````(/$_&H$C47\4(/$](U% MO%#H9\?__X/$$(G`C5`!4HU%O%!J`FH^:-?*!0CH#,7__X/$(.M[@\3\:#3- M!0BA8%P&"%!J(&H!:-S*!0AJ`&H:Z&?'__^#Q"#'1?P:````#[8%V%L&"(/X M"'<^BP2%E,T%"/_@ZS.#Q/QJ!(U%_%"#Q/2-1;Q0Z/'&__^#Q!")P(U0`5*- M1;Q0:@)J/FC7R@4(Z);$__^#Q"#K!9"-="8`#[8%VEL&"(7`=`>#^`AT!.LU MZS.#Q/QJ!(U%_%"#Q/2-1;Q0Z*/&__^#Q!")P(U0`5*-1;Q0:@)J/6C7R@4( MZ$C$__^#Q""+5?R)T.L"B?;)PXGV58GE@^Q8QT7\`````(/$^&BXS04(C46\ M4.@JR/__@\00#[8%VEL&"(7`=`>#^`AT"^LVZS2-M"8`````@\3T@\3TC46\ M4.@MQO__@\00B<"-4`%2C46\4&H!:CQHU\H%".C2P___@\0@@WT(``^%V0`` M`(/$](M%"%!J`6BXS04(H4A#^`AT"^L\ZSJ-M"8`````@\3\:@2-1?Q0@\3TC46\4.AWQ/__@\00B<"- M4`%2C46\4&H":CUHU\H%".@)]NLS@\3\ M:@2-1?Q0@\3TC46\4.@%Q/__@\00B<"-4`%2C46\4&H":CUHU\H%".BJP?__ M@\0@,<#K!XVT)@````#)PXGV58GE@^Q8@\3X:!3.!0B-1;Q0Z)'%__^#Q!#' M1?P`````#[8%VEL&"(7`=`>#^`AT"^LVZS2-M"8`````@\3T@\3TC46\4.B- MP___@\00B<"-4`%2C46\4&H!:CQHU\H%".@RP?__@\0@@WT(``^%V0```(/$ M](M%"%!J`6@4S@4(H4A# M^`AT"^L\ZSJ-M"8`````@\3\:@2-1?Q0@\3TC46\4.C7P?__@\00B<"-4`%2 MC46\4&H":CUHU\H%".A\O___@\0@N!<```#K=HVV`````(M%"`^W$(/$]%+H M;<'__X/$$(G`B<*+10QFB1`/M@7:6P8(A)]NLS@\3\:@2- M1?Q0@\3TC46\4.AEP?__@\00B<"-4`%2C46\4&H":CUHU\H%".@*O___@\0@ M,<#K!XVT)@````#)PXGV58GE@^Q8@\3X:'#.!0B-1;Q0Z/'"__^#Q!#'1?P` M````#[8%VEL&"(7`=`>#^`AT"^LVZS2-M"8`````@\3T@\3TC46\4.CMP/__ M@\00B<"-4`%2C46\4&H!:CQHU\H%".B2OO__@\0@@WT(``^%V0```(/$](M% M"%!J`6APS@4(H4A#^`AT M"^L\ZSJ-M"8`````@\3\:@2-1?Q0@\3TC46\4.@WO___@\00B<"-4`%2C46\ M4&H":CUHU\H%".C#^`AT"^LVZS2-M"8`````@\3T@\3TC46\4.A-OO__@\00 MB<"-4`%2C46\4&H!:CQHU\H%".CRN___@\0@@WT(``^%V0```(/$](M%"%!J M`6C,S@4(H4A#.!0C_X(UT)@#K,X/$_&H$C47\4(/$](U%O%#HQ;W__X/$ M$(G`C5`!4HU%O%!J`FH^:-?*!0CH:KO__X/$(`^V!=I;!@B%P'0'@_@(=`OK M/.LZC;0F`````(/$_&H$C47\4(/$](U%O%#H=[W__X/$$(G`C5`!4HU%O%!J M`FH]:-?*!0CH'+O__X/$(+@7````Z5,!``"-=@"#?0P`#X76````@\3TBT4, M4&H":,S.!0BA2%P&"%!J&FH!:-S*!0AJ`&H7Z%R]__^#Q##'1?P7````#[8% MV%L&"(/X"'<_BP2%!,\%"/_@D.LS@\3\:@2-1?Q0@\3TC46\4.CEO/__@\00 MB<"-4`%2C46\4&H":CYHU\H%".B*NO__@\0@#[8%VEL&"(7`=`>#^`AT"^L\ MZSJ-M"8`````@\3\:@2-1?Q0@\3TC46\4.B7O/__@\00B<"-4`%2C46\4&H" M:CUHU\H%".@\NO__@\0@N!<```#K=HVV`````(M%"(/$](L`4.A.NO__@\00 MB<")PHM%#(D0#[8%VEL&"(7`=`N#^`AT".LYC70F`.LS@\3\:@2-1?Q0@\3T MC46\4.@EO/__@\00B<"-4`%2C46\4&H":CUHU\H%".C*N?__@\0@,<#K!XVT M)@````#)PXGV58GE@^QT4X/$^&@HSP4(C46D4.BPO?__@\00QT7D``````^V M!=I;!@B%P'0'@_@(=`KK->LSC;8`````@\3T@\3TC46D4.BMN___@\00B<"- M4`%2C46D4&H!:CQHU\H%".A2N?__@\0@@WT(``^%V0```(/$](M%"%!J`6@H MSP4(H4A07````#[8%V%L& M"(/X"'<_BP2%:,\%"/_@D.LS@\3\:@2-1>10@\3TC46D4.A%NO__@\00B<"- M4`%2C46D4&H":CYHU\H%".CJM___@\0@#[8%VEL&"(7`=`>#^`AT"^L\ZSJ- MM"8`````@\3\:@2-1>10@\3TC46D4.CWN?__@\00B<"-4`%2C46D4&H":CUH MU\H%".BY__^#Q!")P(U0`5*-1:10:@)J/6C7 MR@4(Z+RV__^#Q""X%P```.GS````C78`H3S/!0B+%4#/!0B)1?B)5?R+10B+ M$(M(!"-5^"--_(E5\(E-](M%\(M5](G1,=N)3?")7?2+1?")1>R+10B+50B+ M"HM:!"--^"-=_(E-G(E=H(L0BT@$*U6<&TV@B57PB4WTBT7PB47H@\3TBT7L M4.AWM___@\00B<")PHM%#(D0@\3TBT7H4.A?M___@\00B<")PHM%$(D0#[8% MVEL&"(7`=`R#^`AT">LZD(UT)@#K,X/$_&H$C47D4(/$](U%I%#H);C__X/$ M$(G`C5`!4HU%I%!J`FH]:-?*!0CHRK7__X/$(#'`ZP>-M"8`````BUV(R<.- M=@!5B>6#[&13@\3X:+#/!0B-1;!0Z*RY__^#Q!#'1?``````#[8%VEL&"(7` M=`N#^`AT".LSC70F`.LM@\3T@\3TC46P4.BKM___@\00B<"-4`%2C46P4&H! M:CQHU\H%".A0M?__@\0@@WT(``^%UP```(/$](M%"%!J`6BPSP4(H4AV__^#Q!")P(U0`5*-1;!0:@)J/6C7R@4(Z'RT__^# MQ""X%P```.ES`@``C78`@WT,``^%U@```(/$](M%#%!J`FBPSP4(H4AC/ M!0C_X)#K,X/$_&H$C47P4(/$](U%L%#H1;;__X/$$(G`C5`!4HU%L%!J`FH^ M:-?*!0CHZK/__X/$(`^V!=I;!@B%P'0'@_@(=`OK/.LZC;0F`````(/$_&H$ MC47P4(/$](U%L%#H][7__X/$$(G`C5`!4HU%L%!J`FH]:-?*!0CHG+/__X/$ M(+@7````Z9,!``"-=@"#?1``#X76````@\3TBT404&H#:+#/!0BA2%P&"%!J M&FH!:-S*!0AJ`&H7Z-RU__^#Q##'1?`7````#[8%V%L&"(/X"'<_BP2%#-`% M"/_@D.LS@\3\:@2-1?!0@\3TC46P4.AEM?__@\00B<"-4`%2C46P4&H":CYH MU\H%".@*L___@\0@#[8%VEL&"(7`=`>#^`AT"^L\ZSJ-M"8`````@\3\:@2- M1?!0@\3TC46P4.@7M?__@\00B<"-4`%2C46P4&H":CUHU\H%".B\LO__@\0@ MN!<```#ILP```(UV`(M%"(/$](L`4.C>L___@\00B<")PHE5](M%]#'2B<&) MTXG+,-M"8`````BUV8R<.-=@!5B>6#[%B#Q/AH,-`%"(U%M%#H[;7__X/$$,=% M]``````/M@7:6P8(AS__^#Q!")P(U0`5*-1;10 M:@)J/6C7R@4(Z+RP__^#Q""X%P```.EC`0``C78`@WT,``^%U@```(/$](M% M#%!J`F@PT`4(H4A6#[%B#Q/AHC-`%"(U%M%#H M0;/__X/$$,=%]``````/M@7:6P8(A#^`AT"^L\ZSJ-M"8`````@\3\:@2-1?10@\3TC46T4.AGL/__ M@\00B<"-4`%2C46T4&H":CUHU\H%".@,KO__@\0@N!<```#I8P$``(UV`(-] M#``/A=8```"#Q/2+10Q0:@)HC-`%"*%(7`8(4&H::@%HW,H%"&H`:A?H3+#_ M_X/$,,=%]!<````/M@786P8(@_@(=S^+!(7$T`4(_^"0ZS.#Q/QJ!(U%]%"# MQ/2-1;10Z-6O__^#Q!")P(U0`5*-1;10:@)J/FC7R@4(Z'JM__^#Q"`/M@7: M6P8(AO__^# MQ!")P(U0`5*-1;10:@)J/6C7R@4(Z"RM__^#Q""X%P```.F#````C78`BT4( M@\3TBP!0Z#ZM__^#Q!")P(G"B57\C47\B47X@\3\:@2+1?A0BT4,4.C\K___ M@\00#[8%VEL&"(7`=`>#^`AT!.LUZS.#Q/QJ!(U%]%"#Q/2-1;10Z`"O__^# MQ!")P(U0`5*-1;10:@)J/6C7R@4(Z*6L__^#Q"`QP.L"B?;)PXGV58GE@^Q8 M@\3X:.C0!0B-1;!0Z)&P__^#Q!#'1?``````#[8%VEL&"(7`=`>#^`AT"^LV MZS2-M"8`````@\3T@\3TC46P4.B-KO__@\00B<"-4`%2C46P4&H!:CQHU\H% M".@RK/__@\0@@WT(``^%V0```(/$](M%"%!J`6CHT`4(H4A#^`AT"^L\ZSJ-M"8`````@\3\:@2-1?!0 M@\3TC46P4.C7K/__@\00B<"-4`%2C46P4&H":CUHU\H%".A\JO__@\0@N!<` M``#IDP$``(UV`(-]$``/A=8```"#Q/2+11!0:@-HZ-`%"*%(7`8(4&H::@%H MW,H%"&H`:A?HO*S__X/$,,=%\!<````/M@786P8(@_@(=S^+!(5$T04(_^"0 MZS.#Q/QJ!(U%\%"#Q/2-1;!0Z$6L__^#Q!")P(U0`5*-1;!0:@)J/FC7R@4( MZ.JI__^#Q"`/M@7:6P8(AK__^#Q!")P(U0`5*-1;!0:@)J/6C7R@4(Z)RI__^#Q""X%P`` M`.FS````C78`BT4(B47T@\3\:@2+1?10C47\4.B$K/__@\00@T7T!(/$_&H$ MBT7T4(U%^%#H:ZS__X/$$(/$](M%_%#HC*K__X/$$(G`B<*+10R)$(/$](M% M^%#H=*K__X/$$(G`B<*+11")$`^V!=I;!@B%P'0'@_@(=`3K->LS@\3\:@2- M1?!0@\3TC46P4.@_J___@\00B<"-4`%2C46P4&H":CUHU\H%".CDJ/__@\0@ M,<#K`9#)PXGV58GE@^Q8@\3X:&C1!0B-1;10Z-&L__^#Q!#'1?0`````#[8% MVEL&"(7`=`>#^`AT"^LVZS2-M"8`````@\3T@\3TC46T4.C-JO__@\00B<"- M4`%2C46T4&H!:CQHU\H%".ARJ/__@\0@@WT(``^%V0```(/$](M%"%!J`6AH MT04(H4A#^`AT"^L\ZSJ- MM"8`````@\3\:@2-1?10@\3TC46T4.@7J?__@\00B<"-4`%2C46T4&H":CUH MU\H%".B\IO__@\0@N!<```#IDP$``(UV`(-]$``/A=8```"#Q/2+11!0:@-H M:-$%"*%(7`8(4&H::@%HW,H%"&H`:A?H_*C__X/$,,=%]!<````/M@786P8( M@_@(=S^+!(7$T04(_^"0ZS.#Q/QJ!(U%]%"#Q/2-1;10Z(6H__^#Q!")P(U0 M`5*-1;10:@)J/FC7R@4(Z"JF__^#Q"`/M@7:6P8(AH__^#Q!")P(U0`5*-1;10:@)J/6C7 MR@4(Z-RE__^#Q""X%P```.FS````C78`BT40B47XBT4(@\3TBP!0Z.BE__^# MQ!")P(G"B57\@\3\:@2-1?Q0BT7X4.BLJ/__@\00@T7X!(M%#(/$](L`4.BW MI?__@\00B<")PHE5_(/$_&H$C47\4(M%^%#H>ZC__X/$$`^V!=I;!@B%P'0' M@_@(=`3K->LS@\3\:@2-1?10@\3TC46T4.A_I___@\00B<"-4`%2C46T4&H" M:CUHU\H%".@DI?__@\0@,<#K`9#)PXGV58GE@^Q8QT7T`````,=%\`````#' M1?P`````@\3X:.C1!0B-1;!0Z/RH__^#Q!`/M@7:6P8(A#^`AT"^L\ZSJ-M"8`````@\3\:@2-1?Q0@\3TC46P4.A7I?__@\00 MB<"-4`%2C46P4&H":CUHU\H%".C\HO__@\0@N!<```#I8P$``(UV`(/$^&B, M6P8(:(A;!@CH`M7__X/$$(G`B47\@WW\`'11#[8%VEL&"(7`=`>#^`AT!.LU MZS.#Q/QJ!(U%_%"#Q/2-1;!0Z..D__^#Q!")P(U0`5*-1;!0:@)J/6C7R@4( MZ(BB__^#Q""+5?R)T.GO````@\3TBT4(4.BOI/__@\00B<"-4`&)5?B-1?10 MC47P4(U%^%"+10A0Z-?8__^#Q!")P(E%_(-]_`!T50^V!=I;!@B%P'0*@_@( M=`?K.(UV`.LS@\3\:@2-1?Q0@\3TC46P4.A5I/__@\00B<"-4`%2C46P4&H" M:CUHU\H%".CZH?__@\0@BU7\B=#K9(UT)@"+10R+5?2)$(M%#(M5\(E0!`^V M!=I;!@B%P'0'@_@(=`3K->LS@\3\:@2-1?Q0@\3TC46P4.CRH___@\00B<"- M4`%2C46P4&H":CUHU\H%".B7H?__@\0@,<#K!(UT)@#)PXGV58GE@^Q8QT7T M`````,=%\`````"#Q/AH1-(%"(U%L%#H#^`AT"^L\ZSJ-M"8`````@\3\:@2-1?Q0@\3T MC46P4.C'H?__@\00B<"-4`%2C46P4&H":CUHU\H%".ALG___@\0@N!<```#I M8P$``(UV`(/$^&B,6P8(:(A;!@CH#^`AT!.LUZS.#Q/QJ!(U%_%"#Q/2-1;!0Z%.A__^#Q!")P(U0`5*- M1;!0:@)J/6C7R@4(Z/B>__^#Q""+5?R)T.GO````@\3TBT4(4.@?H?__@\00 MB<"-4`&)5?B-1?10C47P4(U%^%"+10A0Z.?7__^#Q!")P(E%_(-]_`!T50^V M!=I;!@B%P'0*@_@(=`?K.(UV`.LS@\3\:@2-1?Q0@\3TC46P4.C%H/__@\00 MB<"-4`%2C46P4&H":CUHU\H%".AJGO__@\0@BU7\B=#K9(UT)@"+10R+5?") M$`^V!=I;!@B%P'0-@_@(=`KK.XVV`````.LS@\3\:@2-1?Q0@\3TC46P4.AE MH/__@\00B<"-4`%2C46P4&H":CUHU\H%".@*GO__@\0@,<#K!XVT)@````#) MPXGV58GE@^Q8@\3X:*32!0B-1;A0Z/&A__^#Q!#'1?@`````#[8%VEL&"(7` M=`>#^`AT"^LVZS2-M"8`````@\3T@\3TC46X4.CMG___@\00B<"-4`%2C46X M4&H!:CQHU\H%".B2G?__@\0@@WT(``^%V0```(/$](M%"%!J`6BDT@4(H4A< M!@A0:AIJ`6C__^#Q##'1?@7````#[8%V%L&"(/X"'<_ MBP2%X-(%"/_@D.LS@\3\:@2-1?A0@\3TC46X4.B%GO__@\00B<"-4`%2C46X M4&H":CYHU\H%".@JG/__@\0@#[8%VEL&"(7`=`>#^`AT"^L\ZSJ-M"8````` M@\3\:@2-1?A0@\3TC46X4.@WGO__@\00B<"-4`%2C46X4&H":CUHU\H%".C< MF___@\0@N!<```#I8P(``(UV`(-]$``/A=8```"#Q/2+11!0:@-HI-(%"*%( M7`8(4&H::@%HW,H%"&H`:A?H')[__X/$,,=%^!<````/M@786P8(@_@(=S^+ M!(4$TP4(_^"0ZS.#Q/QJ!(U%^%"#Q/2-1;A0Z*6=__^#Q!")P(U0`5*-1;A0 M:@)J/FC7R@4(Z$J;__^#Q"`/M@7:6P8(A=__^#Q!")P(U0`5*-1;A0:@)J/6C7R@4(Z/R: M__^#Q""X%P```.F#`0``C78`@\3TBT4,4.BPG/__@\00B<")PHE5_(-]_``/ MA=````"+10Q0:*32!0BA3%P&"%!J&VH!:-S*!0AJ`&H&Z"N=__^#Q"#'1?@& M````#[8%V%L&"(/X"'<^BP2%*-,%"/_@ZS.#Q/QJ!(U%^%"#Q/2-1;A0Z+6< M__^#Q!")P(U0`5*-1;A0:@)J/FC7R@4(Z%J:__^#Q"`/M@7:6P8(A<__^#Q!")P(U0`5*- M1;A0:@)J/6C7R@4(Z`R:__^#Q""X!@```.F3````C78`@\3\BT4,4&H`BT7\ M4.AZG?__@\00@\3\BT4,4(M%"%"+1?Q0Z..<__^#Q!"+11"+50R)$(M%$(M5 M_(E0!`^V!=I;!@B%P'0(@_@(=`7K-I#K,X/$_&H$C47X4(/$](U%N%#HU9O_ M_X/$$(G`C5`!4HU%N%!J`FH]:-?*!0CH>IG__X/$(#'`ZP>-M"8`````R<.) M]E6)Y8/L6(/$^&A,TP4(C46X4.AAG?__@\00QT7X``````^V!=I;!@B%P'0' M@_@(=`OK-NLTC;0F`````(/$](/$](U%N%#H79O__X/$$(G`C5`!4HU%N%!J M`6H\:-?*!0CH`IG__X/$((-]"``/A=D```"#Q/2+10A0:@%H3-,%"*%(7`8( M4&H::@%HW,H%"&H`:A?H3YO__X/$,,=%^!<````/M@786P8(@_@(=T*+!(5H MTP4(_^"-="8`ZS.#Q/QJ!(U%^%"#Q/2-1;A0Z-6:__^#Q!")P(U0`5*-1;A0 M:@)J/FC7R@4(Z'J8__^#Q"`/M@7:6P8(A:__^#Q!")P(U0`5*-1;A0:@)J/6C7R@4(Z"R8 M__^#Q""X%P```.DS`P``C78`@WT,``^%U@```(/$](M%#%!J`6A,TP4(H4A< M!@A0:AIJ`6C#^`AT"^L\ZSJ-M"8`````@\3\ M:@2-1?A0@\3TC46X4.C'F/__@\00B<"-4`%2C46X4&H":CUHU\H%".ALEO__ M@\0@N!<```#I#^`AT M"^L\ZSJ-M"8`````@\3\:@2-1?A0@\3TC46X4.C7E___@\00B<"-4`%2C46X M4&H":CUHU\H%".A\E?__@\0@N`8```#I@P```(UV`(/$_(M%#%!J`(M%_%#H MZIC__X/$$(/$_(M%#%"+10A0BT7\4.A3F/__@\00BT40BU7\B1`/M@7:6P8( MAP` M````@\3X:/C3!0B-1:A0Z-.8__^#Q!`/M@7:6P8(A@/MT7^9HE%_(/$^(U%^E"-1?Q0Z"70__^#Q!")P(E%[(-][`!T M4P^V!=I;!@B%P'0(@_@(=`7K-I#K,X/$_&H$C47L4(/$](U%J%#H99;__X/$ M$(G`C5`!4HU%J%!J`FH]:-?*!0CH"I3__X/$((M5[(G0Z9$!``"0@\3\:@*- M1?I0BT7H4.CZEO__@\00@T7H`L=%]`0```"#Q/B-1?!0C47T4.C4U/__@\00 MB<")1>R#?>P`=%(/M@7:6P8(AI/__X/$((M5[(G0Z0$! M``"0@\3\:@2-1?!0BT7H4.AJEO__@\00@T7H!(M%#(E%](/$^(U%\%"-1?10 MZ$74__^#Q!")P(E%[(-][`!T4P^V!=I;!@B%P'0(@_@(=`7K-I#K,X/$_&H$ MC47L4(/$](U%J%#H197__X/$$(G`C5`!4HU%J%!J`FH]:-?*!0CHZI+__X/$ M((M5[(G0ZW2-="8`@\3\:@2-1?!0BT7H4.C:E?__@\00@T7H!(M%$(M5Z(D0 M#[8%VEL&"(7`=`>#^`AT!.LUZS.#Q/QJ!(U%[%"#Q/2-1:A0Z-*4__^#Q!") MP(U0`5*-1:A0:@)J/6C7R@4(Z'>2__^#Q"`QP.L$C70F`,G#B?95B>6#[%C' M1?P`````@\3X:`O4!0B-1;!0Z%J6__^#Q!`/M@7:6P8(A) M]NLS@\3\:@2-1?Q0@\3TC46P4.C5D___@\00B<"-4`%2C46P4&H":CUHU\H% M".AZD?__@\0@BU7\B=#IT0$``)"#??0$#X36````@\3\:`O4!0BA4%P&"%!J M'&H!:-S*!0AJ`&H$Z,*3__^#Q"#'1?P$````#[8%V%L&"(/X"'=%BP2%(-0% M"/_@C;0F`````.LS@\3\:@2-1?Q0@\3TC46P4.A%D___@\00B<"-4`%2C46P M4&H":CYHU\H%".CJD/__@\0@#[8%VEL&"(7`=`>#^`AT"^L\ZSJ-M"8````` M@\3\:@2-1?Q0@\3TC46P4.CWDO__@\00B<"-4`%2C46P4&H":CUHU\H%".B< MD/__@\0@N`0```#I\P```(UV`(/$_&H$BT7P4(U%^%#HBI/__X/$$(-%\`2# MQ/B-1?10C47X4.@+U/__@\00B<")1?R#??P`=%D/M@7:6P8(A6#[&B+ M10AFB47^QT7L`````(/$^&A$U`4(C46@4.B#D___@\00#[8%VEL&"(7`=`F# M^`AT!NLQB?;K+8/$](/$](U%H%#HBY'__X/$$(G`C5`!4HU%H%!J`6H\:-?* M!0CH,(___X/$((M%%(L0B57@#[=%_F:)1?R#Q/B-1?I0C47\4.C5RO__@\00 MB<")1>R#?>P`=%,/M@7:6P8(AR)T.G! M`0``D(/$_&H"C47Z4(M%X%#HJI'__X/$$(-%X`+'1?0(````@\3XC47P4(U% M]%#HA,___X/$$(G`B47L@WWL`'12#[8%VEL&"(7`=`>#^`AT!.LUZS.#Q/QJ M!(U%[%"#Q/2-1:!0Z(60__^#Q!")P(U0`5*-1:!0:@)J/6C7R@4(Z"J.__^# MQ""+5>R)T.DQ`0``D(/$_&H$C47P4(M%X%#H&I'__X/$$(-%X`2+10R+51") M1>2)5>B#Q/R-1?!0C47T4(U%Y%#H*]3__X/$$(G`B47L@WWL`'19#[8%VEL& M"(7`=`Z#^`AT"^L\C;0F`````.LS@\3\:@2-1>Q0@\3TC46@4.CEC___@\00 MB<"-4`%2C46@4&H":CUHU\H%".B*C?__@\0@BU7LB=#ID0```)"#Q/QJ!(U% M]%"+1>!0Z'J0__^#Q!"#1>`$@\3\:@2-1?!0BT7@4.AAD/__@\00@T7@!(M% M%(M5X(D0#[8%VEL&"(7`=`N#^`AT".LYC70F`.LS@\3\:@2-1>Q0@\3TC46@ M4.A5C___@\00B<"-4`%2C46@4&H":CUHU\H%".CZC/__@\0@,<#K!XVT)@`` M``#)PXGV58GE@^QHQT7\`````(/$^&A7U`4(C46D4.C:D/__@\00#[8%VEL& M"(7`=`>#^`AT"^LVZS2-M"8`````@\3T@\3TC46D4.C=CO__@\00B<"-4`%2 MC46D4&H!:CQHU\H%".B"C/__@\0@BT4(BQ")5>2#Q/QJ!(M%Y%"-1?A0Z'6/ M__^#Q!"#1>0$@\3XC47T4(U%^%#H]L___X/$$(G`B47\@WW\`'14#[8%VEL& M"(7`=`F#^`AT!NLWB?;K,X/$_&H$C47\4(/$](U%I%#H58[__X/$$(G`C5`! M4HU%I%!J`FH]:-?*!0CH^HO__X/$((M5_(G0Z?$!``"0@WWT"`^$U@```(/$ M_&A7U`4(H5!0$@\3\:@2+1>10C47P4.CQC?__@\00@T7D!(/$_(U%Z%"- M1?!0C47T4.@2U?__@\00B<")1?R#??P`=$X/M@7:6P8(AB+3>R)$(E(!(M%"(M5Y(D0#[8%VEL&"(7` M=`V#^`AT"NL[C;8`````ZS.#Q/QJ!(U%_%"#Q/2-1:10Z&6,__^#Q!")P(U0 M`5*-1:10:@)J/6C7R@4(Z`J*__^#Q"`QP.L'C;0F`````,G#B?95B>6#['B+ M10AFB47^QT7L`````(/$^&B0U`4(C4684.CCC?__@\00#[8%VEL&"(7`=`F# M^`AT!NLQB?;K+8/$](/$](U%F%#HZXO__X/$$(G`C5`!4HU%F%!J`6H\:-?* M!0CHD(G__X/$((M%'(L0B57@#[=%_F:)1?R#Q/B-1?I0C47\4.@UQ?__@\00 MB<")1>R#?>P`=%,/M@7:6P8(AR)T.G1 M`P``D(/$_&H"C47Z4(M%X%#H"HS__X/$$(-%X`*#?0P`#X7M````QT7T```` M`(/$^(U%\%"-1?10Z-K)__^#Q!")P(E%[(-][`!T6`^V!=I;!@B%P'0-@_@( M=`KK.XVV`````.LS@\3\:@2-1>Q0@\3TC4684.C5BO__@\00B<"-4`%2C468 M4&H":CUHU\H%".AZB/__@\0@BU7LB=#I,0,``)"#Q/QJ!(U%\%"+1>!0Z&J+ M__^#Q!"#1>`$BT4#^`AT!.LUZS.#Q/QJ!(U%[%"#Q/2-19A0Z/6)__^#Q!")P(U0`5*-19A0 M:@)J/6C7R@4(Z)J'__^#Q""+5>R)T.E1`@``D(M%V(E%](-]$``/A"X!``"+ M112+$(M%](T,$(E-Y(M%&(M5X(L`B=$IP8E-Z(/$^(M%Y%"+11B+$%+H+8K_ M_X/$$(G`B<*)5>"#?>``#X7-````BT7D4&B0U`4(H4QQ0@\3TC4684.@BB?__@\00B<"-4`%2C4684&H":CYHU\H%".C'AO__ M@\0@#[8%VEL&"(7`=`V#^`AT"NL[C;8`````ZS.#Q/QJ!(U%[%"#Q/2-19A0 MZ-6(__^#Q!")P(U0`5*-19A0:@)J/6C7R@4(Z'J&__^#Q""X!@```.DQ`0`` MD(M%&(M5X(D0BT44BU7DB1"+11B+$(M%Z(T,$(E-X(/$^(U%\%"-1?10Z$;' M__^#Q!")P(E%[(-][`!T5`^V!=I;!@B%P'0)@_@(=`;K-XGVZS.#Q/QJ!(U% M[%"#Q/2-19A0Z$6(__^#Q!")P(U0`5*-19A0:@)J/6C7R@4(Z.J%__^#Q""+ M5>R)T.FA````D(/$_&H$C47P4(M%X%#HVHC__X/$$(-%X`2#Q/R+1=A0BT7< M4(M%X%#HOXC__X/$$(M%V`%%X(M%'(M5X(D0@\3XBT784(M%W%#H,K#__X/$ M$`^V!=I;!@B%P'0'@_@(=`3K->LS@\3\:@2-1>Q0@\3TC4684.BBA___@\00 MB<"-4`%2C4684&H":CUHU\H%".A'A?__@\0@,<#K!(UT)@#)PXGV58GE@^QD M4X/$^&C(U`4(C46H4.@PB?__@\00QT7\``````^V!=I;!@B%P'0'@_@(=`KK M->LSC;8`````@\3T@\3TC46H4.@MA___@\00B<"-4`%2C46H4&H!:CQHU\H% M".C2A/__@\0@BT4(BQ")5>R#Q/QJ!(M%[%"-1?10Z,6'__^#Q!"#1>P$@\3X MC47X4(U%]%#H1LC__X/$$(G`B47\@WW\`'14#[8%VEL&"(7`=`F#^`AT!NLW MB?;K,X/$_&H$C47\4(/$](U%J%#HI8;__X/$$(G`C5`!4HU%J%!J`FH]:-?* M!0CH2H3__X/$((M5_(G0Z8$"``"0@WWX`'5JBT4,QP``````BT40QP`````` MBT4(BU7LB1`/M@7:6P8(AQ0 MBT7H4.C#A?__@\00BT7P`47L@\3XBT404(M%Z%#H$N'__X/$$(G`B47\@\3X MBT7P4(M%Z%#H)JW__X/$$(-]_`!T3@^V!=I;!@B%P'0'@_@(=`3K->LS@\3\ M:@2-1?Q0@\3TC46H4.B0A/__@\00B<"-4`%2C46H4&H":CUHU\H%".@U@O__ M@\0@BU7\B=#K;XM=#(/$](M%$(L04NA:A/__@\00B<"-4`&)$XM%"(M5[(D0 M#[8%VEL&"(7`=`>#^`AT!.LUZS.#Q/QJ!(U%_%"#Q/2-1:A0Z!^$__^#Q!") MP(U0`5*-1:A0:@)J/6C7R@4(Z,2!__^#Q"`QP.L!D(M=F,G#C78`58GE@^QX MBT4(9HE%_L=%[`````"#Q/AH!-4%"(U%F%#HGX7__X/$$`^V!=I;!@B%P'0' M@_@(=`3K+^LM@\3T@\3TC4684.BI@___@\00B<"-4`%2C4684&H!:CQHU\H% M".A.@?__@\0@BT4@BQ")5>`/MT7^9HE%_(/$^(U%^E"-1?Q0Z/.\__^#Q!") MP(E%[(-][`!T40^V!=I;!@B%P'0'@_@(=`3K->LS@\3\:@2-1>Q0@\3TC468 M4.@T@___@\00B<"-4`%2C4684&H":CUHU\H%".C9@/__@\0@BU7LB=#IT`,` M`(/$_&H"C47Z4(M%X%#HRH/__X/$$(-%X`*#?0P`#X7M````QT7T`````(/$ M^(U%\%"-1?10Z)K!__^#Q!")P(E%[(-][`!T6`^V!=I;!@B%P'0-@_@(=`KK M.XVV`````.LS@\3\:@2-1>Q0@\3TC4684.B5@O__@\00B<"-4`%2C4684&H" M:CUHU\H%".@Z@/__@\0@BU7LB=#I,0,``)"#Q/QJ!(U%\%"+1>!0Z"J#__^# MQ!"#1>`$BT4@BU7@B1`/M@7:6P8(ALS@\3\:@2-1>Q0@\3TC4684.BQ@?__@\00B<"-4`%2C468 M4&H":CUHU\H%".A6?___@\0@BU7LB=#I30(``(M%V(E%](-]%``/A"L!``"+ M11B+$(M%](T,$(E-Y(M%'(M5X(L`B=$IP8E-Z(/$^(M%Y%"+11R+$%+HZH'_ M_X/$$(G`B<*)5>"#?>``#X7*````BT7D4&@Q0@\3TC4684.C?@/__@\00B<"-4`%2C4684&H":CYHU\H%".B$?O__ M@\0@#[8%VEL&"(7`=`J#^`AT!^LXC78`ZS.#Q/QJ!(U%[%"#Q/2-19A0Z)6` M__^#Q!")P(U0`5*-19A0:@)J/6C7R@4(Z#I^__^#Q""X!@```.DQ`0``D(M% M'(M5X(D0BT48BU7DB1"+11R+$(M%Z(T,$(E-X(/$^(U%\%"-1?10Z`:___^# MQ!")P(E%[(-][`!T5`^V!=I;!@B%P'0)@_@(=`;K-XGVZS.#Q/QJ!(U%[%"# MQ/2-19A0Z`6`__^#Q!")P(U0`5*-19A0:@)J/6C7R@4(Z*I]__^#Q""+5>R) MT.FA````D(/$_&H$C47P4(M%X%#HFH#__X/$$(-%X`2#Q/R+1=A0BT7<4(M% MX%#H?X#__X/$$(M%V`%%X(M%((M5X(D0@\3XBT784(M%W%#H\J?__X/$$`^V M!=I;!@B%P'0'@_@(=`3K->LS@\3\:@2-1>Q0@\3TC4684.AB?___@\00B<"- M4`%2C4684&H":CUHU\H%".@'??__@\0@,<#K!(UT)@#)PXGV58GE@^QHQT7\ M`````(/$^&A8U04(C46L4.CJ@/__@\00#[8%VEL&"(7`=`>#^`AT"^LVZS2- MM"8`````@\3T@\3TC46L4.CM?O__@\00B<"-4`%2C46L4&H!:CQHU\H%".B2 M?/__@\0@BT4(BQ")5?"#Q/QJ!(M%\%"-1?10Z(5___^#Q!"#1?`$@\3XC47X M4(U%]%#H!L#__X/$$(G`B47\@WW\`'14#[8%VEL&"(7`=`F#^`AT!NLWB?;K M,X/$_&H$C47\4(/$](U%K%#H97[__X/$$(G`C5`!4HU%K%!J`FH]:-?*!0CH M"GS__X/$((M5_(G0Z8$"``"0@WWX`'5JBT4,QP``````BT40QP``````BT4( MBU7PB1`/M@7:6P8(AR#?>P`#X70````BT7X4&ARU04(H4QO__@\0@#[8%VEL&"(7`=`>#^`AT"^L\ZSJ-M"8`````@\3\:@2-1?Q0 M@\3TC46L4.@'??__@\00B<"-4`%2C46L4&H":CUHU\H%".BL>O__@\0@N`8` M``#I(P$``(UV`(/$_(M%^%!J`(M%[%#H&G[__X/$$(/$_(M%^%"+1?!0BT7L M4.B#??__@\00BT7X`47P@\3\BT404(M%^%"+1>Q0Z.[@__^#Q!")P(E%_(/$ M^(M%^%"+1>Q0Z.*D__^#Q!"#??P`=%D/M@7:6P8(A6#[&13QT7\```` M`(/$^&BPU04(C46H4.AI??__@\00#[8%VEL&"(7`=`>#^`AT"NLUZS.-M@`` M``"#Q/2#Q/2-1:A0Z&U[__^#Q!")P(U0`5*-1:A0:@%J/&C7R@4(Z!)Y__^# MQ""#?0@`#X79````@\3TBT4(4&H!:+#5!0BA2%P&"%!J&FH!:-S*!0AJ`&H7 MZ%][__^#Q##'1?P7````#[8%V%L&"(/X"'="BP2%R-4%"/_@C70F`.LS@\3\ M:@2-1?Q0@\3TC46H4.CE>O__@\00B<"-4`%2C46H4&H":CYHU\H%".B*>/__ M@\0@#[8%VEL&"(7`=`>#^`AT"^L\ZSJ-M"8`````@\3\:@2-1?Q0@\3TC46H M4.B7>O__@\00B<"-4`%2C46H4&H":CUHU\H%".@\>/__@\0@N!<```#I0PH` M`(UV`(-]#``/A=8```"#Q/2+10Q0:@)HL-4%"*%(7`8(4&H::@%HW,H%"&H` M:A?H?'K__X/$,,=%_!<````/M@786P8(@_@(=S^+!(7LU04(_^"0ZS.#Q/QJ M!(U%_%"#Q/2-1:A0Z`5Z__^#Q!")P(U0`5*-1:A0:@)J/FC7R@4(Z*IW__^# MQ"`/M@7:6P8(AR#Q/R-1>Q0BT4(BQ!2 M:+'.``#H(N'__X/$$(G`B47\@WW\`'1D@\3XBT7T4(M%\%#HD*#__X/$$`^V M!=I;!@B%P'0'@_@(=`3K->LS@\3\:@2-1?Q0@\3TC46H4.@`>/__@\00B<"- M4`%2C46H4&H":CUHU\H%".BE=?__@\0@BU7\B=#IK`<``(/$^(U%[%"-1?!0 MC47T4&H`BT4(BU`$4FBRS@``Z'[K__^#Q"")P(E%_(-]_`!T;(/$^(M%]%"+ M1?!0Z/R?__^#Q!`/M@7:6P8(AQ0BT4(BU`,4FBTS@``Z&C? M__^#Q!")P(E%_(-]_`!T9H/$^(M%]%"+1?!0Z-:>__^#Q!`/M@7:6P8(AQ0BT4(BU`84FBWS@``Z+C=__^#Q!")P(E%_(-]_`!T9H/$ M^(M%]%"+1?!0Z":=__^#Q!`/M@7:6P8(AC'1?@`````C78`BT4( MBU7X.U`8<@7IH`,``(M%Z(,X!@^'A@,``(L`B<*-!)4`````BY`TU@4(_^*0 M@\3\C47L4(M%Z(M0!%)HN,X``.CLZD(UT)@#K,X/$_&H$C47\ M4(/$](U%J%#HM7/__X/$$(G`C5`!4HU%J%!J`FH]:-?*!0CH6G'__X/$((M5 M_(G0Z6$#``"0Z=T"``"#Q/R-1>Q0BT7HBU`$4FBYS@``Z$?<__^#Q!")P(E% M_(-]_`!T98/$^(M%]%"+1?!0Z+6;__^#Q!`/M@7:6P8(AQ0BT7HBU`$BT@(45)HNLX``.@& MX?__@\00B<")1?R#??P`=&2#Q/B+1?10BT7P4.@DF___@\00#[8%VEL&"(7` M=`>#^`AT!.LUZS.#Q/QJ!(U%_%"#Q/2-1:A0Z)1R__^#Q!")P(U0`5*-1:A0 M:@)J/6C7R@4(Z#EP__^#Q""+5?R)T.E``@``Z;T!``"-1>Q0:@!J`&B[S@`` MZ'W@__^#Q!")P(E%_(-]_`!T:X/$^(M%]%"+1?!0Z)N:__^#Q!`/M@7:6P8( MAQ0C47P4(U%]%!J`8M%Z(M0!%)HO,X``.A]Y?__@\0@B<")1?R#??P`=&N# MQ/B+1?10BT7P4.C[F?__@\00#[8%VEL&"(7`=`V#^`AT"NL[C;8`````ZS.# MQ/QJ!(U%_%"#Q/2-1:A0Z&5Q__^#Q!")P(U0`5*-1:A0:@)J/6C7R@4(Z`IO M__^#Q""+5?R)T.D1`0``D.F-````@\3\C47L4(M%Z(M0!%)HO# M^`AT!.LUZS.#Q/QJ!(U%_%"#Q/2-1:A0Z-5P__^#Q!")P(U0`5*-1:A0:@)J M/6C7R@4(Z'IN__^#Q""+5?R)T.F!````D.L`@T7H#/]%^.E2_/__B?:+10R+ M5?")4`2+10R+5>R+3?")TRG+B1@/M@7:6P8(A-M"8`````BUV8R<.-=@!5B>6#[%B+10AFB47^@\3X:%#6 M!0B-1;!0Z-9Q__^#Q!#'1?@`````#[8%VEL&"(7`=`>#^`AT!.LOZRV#Q/2# MQ/2-1;!0Z-EO__^#Q!")P(U0`5*-1;!0:@%J/&C7R@4(Z'YM__^#Q"#'1?`` M````QT7T`````(-]#``/A(<```"#Q/QJ"&H`C47P4.CC#^`AT!.LUZS.#Q/QJ!(U%^%"#Q/2-1;!0Z+-N__^#Q!")P(U0`5*- M1;!0:@)J/6C7R@4(Z%AL__^#Q""+5?B)T.L"B?;)PXGV58GE@>R8````QT78 M`````,=%]`````"#Q/AH9M8%"(V%?/___U#H+7#__X/$$`^V!=I;!@B%P'0' M@_@(=`3K->LS@\3T@\3TC85\____4.@T;O__@\00B<"-4`%2C85\____4&H! M:CQHU\H%".C6:___@\0@@WT(``^%X@```(/$](M%"%!J`6A^U@4(H4AM`D(UT M)@#K.8/$_&H$C47T4(/$](V%?/___U#H4FW__X/$$(G`C5`!4HV%?/___U!J M`FH]:-?*!0CH]&K__X/$(+@7````Z4XE``"#?0P`#X77````@\3TBT4,4&H" M:'[6!0BA2%P&"%!J&FH!:-S*!0AJ`&H7Z#=M__^#Q##'1?07````#[8%V%L& M"(/X"'=$BP2%Z-8%"/_@ZSF#Q/QJ!(U%]%"#Q/2-A7S___]0Z+YL__^#Q!") MP(U0`5*-A7S___]0:@)J/FC7R@4(Z&!J__^#Q"`/M@7:6P8(A2#?>0`#X79````BT7P4&AFU@4(H4Q10Z`1K__^#Q!`/M@7:6P8( MAZ7__X/$$(G`B47T@WWT``^$V@```(M%Y(-X!`!T$H/$ M](M%Y(M0!%+H.6K__X/$$(M%Y(-X"`!T$H/$](M%Y(M0"%+H'FK__X/$$(M% MY(-X%`!T$H/$](M%Y(M0%%+H`VK__X/$$(M%Y(-X'`!T$H/$](M%Y(M0'%+H MZ&G__X/$$(/$^(M%\%"+1>10Z"F1__^#Q!`/M@7:6P8(A#^`AT!.L[ZSF#Q/QJ!(U%]%"#Q/2-A7S___]0Z*)G__^# MQ!")P(U0`5*-A7S___]0:@)J/6C7R@4(Z$1E__^#Q""X!````.F>'P``#[=5 M_(V"3S'__X/X#`^':!P``(L$A7C7!0C_X(-]O``/A/P```"+1>2#>`0`=!*# MQ/2+1>2+4`12Z$EH__^#Q!"+1>2#>`@`=!*#Q/2+1>2+4`A2Z"YH__^#Q!"+ M1>2#>!0`=!*#Q/2+1>2+4!12Z!-H__^#Q!"+1>2#>!P`=!*#Q/2+1>2+4!Q2 MZ/AG__^#Q!"#Q/B+1?!0BT7D4.@YC___@\00#[8%VEL&"(7`=`N#^`AT".L_ MC70F`.LY@\3\:@2-1?10@\3TC85\____4.BB9O__@\00B<"-4`%2C85\____ M4&H":CUHU\H%".A$9/__@\0@@\3\:&;6!0BA:%P&"%!J(FH!:-S*!0AJ`&H$ MZ*%F__^#Q"")PHG0Z7P>``#'1;P!````@\3XBT7D4(U%W%#HEM'__X/$$(G` MB47T@WWT``^$U@```(M%Y(-X!`!T$H/$](M%Y(M0!%+H)&?__X/$$(M%Y(-X M"`!T$H/$](M%Y(M0"%+H"6?__X/$$(M%Y(-X%`!T$H/$](M%Y(M0%%+H[F;_ M_X/$$(M%Y(-X'`!T$H/$](M%Y(M0'%+HTV;__X/$$(/$^(M%\%"+1>10Z!2. M__^#Q!`/M@7:6P8(A10Z"J-__^#Q!`/M@7:6P8(A2#>`0`=!*#Q/2+1>2+4`12Z`UE__^#Q!"+1>2#>`@`=!*# MQ/2+1>2+4`A2Z/)D__^#Q!"+1>2#>!0`=!*#Q/2+1>2+4!12Z-=D__^#Q!"+ M1>2#>!P`=!*#Q/2+1>2+4!Q2Z+QD__^#Q!"#Q/B+1?!0BT7D4.C]B___@\00 M#[8%VEL&"(7`=`>#^`AT"NM!ZS^-M@````"#Q/QJ!(U%]%"#Q/2-A7S___]0 MZ&1C__^#Q!")P(U0`5*-A7S___]0:@)J/6C7R@4(Z`9A__^#Q""+5?2)T.E@ M&P``Z3@9``"#?<0`#X3^````BT7D@W@$`'02@\3TBT7DBU`$4N@B9/__@\00 MBT7D@W@(`'02@\3TBT7DBU`(4N@'9/__@\00BT7D@W@4`'02@\3TBT7DBU`4 M4NCL8___@\00BT7D@W@<`'02@\3TBT7DBU`<4NC18___@\00@\3XBT7P4(M% MY%#H$HO__X/$$`^V!=I;!@B%P'0'@_@(=`3K.^LY@\3\:@2-1?10@\3TC85\ M____4.A_8O__@\00B<"-4`%2C85\____4&H":CUHU\H%".@A8/__@\0@@\3\ M:&;6!0BA:%P&"%!J(FH!:-S*!0AJ`&H$Z'YB__^#Q"")PHG0Z5D:``"-M@`` M``#'1<0!````@\3\BT7D@\`(4(U%^%"-1=Q0Z);:__^#Q!")P(E%](-]]``/ MA-8```"+1>2#>`0`=!*#Q/2+1>2+4`12Z/1B__^#Q!"+1>2#>`@`=!*#Q/2+ M1>2+4`A2Z-EB__^#Q!"+1>2#>!0`=!*#Q/2+1>2+4!12Z+YB__^#Q!"+1>2# M>!P`=!*#Q/2+1>2+4!Q2Z*-B__^#Q!"#Q/B+1?!0BT7D4.CDB?__@\00#[8% MVEL&"(7`=`>#^`AT!.L[ZSF#Q/QJ!(U%]%"#Q/2-A7S___]0Z%%A__^#Q!") MP(U0`5*-A7S___]0:@)J/6C7R@4(Z/->__^#Q""+5?2)T.E-&0``Z247``"0 MC70F`(-]R``/A/T```"+1>2#>`0`=!*#Q/2+1>2+4`12Z`IB__^#Q!"+1>2# M>`@`=!*#Q/2+1>2+4`A2Z.]A__^#Q!"+1>2#>!0`=!*#Q/2+1>2+4!12Z-1A M__^#Q!"+1>2#>!P`=!*#Q/2+1>2+4!Q2Z+EA__^#Q!"#Q/B+1?!0BT7D4.CZ MB/__@\00#[8%VEL&"(7`=`R#^`AT">M`D(UT)@#K.8/$_&H$C47T4(/$](V% M?/___U#H8F#__X/$$(G`C5`!4HV%?/___U!J`FH]:-?*!0CH!%[__X/$((/$ M_&AFU@4(H6A2# M>`0`=!*#Q/2+1>2+4`12Z.%@__^#Q!"+1>2#>`@`=!*#Q/2+1>2+4`A2Z,9@ M__^#Q!"+1>2#>!0`=!*#Q/2+1>2+4!12Z*M@__^#Q!"+1>2#>!P`=!*#Q/2+ M1>2+4!Q2Z)!@__^#Q!"#Q/B+1?!0BT7D4.C1A___@\00#[8%VEL&"(7`=`># M^`AT!.L[ZSF#Q/QJ!(U%]%"#Q/2-A7S___]0Z#Y?__^#Q!")P(U0`5*-A7S_ M__]0:@)J/6C7R@4(Z.!<__^#Q""+5?2)T.DZ%P``C;0F`````.D+%0``@WW, M``^$^````(M%Y(-X!`!T$H/$](M%Y(M0!%+H]5___X/$$(M%Y(-X"`!T$H/$ M](M%Y(M0"%+HVE___X/$$(M%Y(-X%`!T$H/$](M%Y(M0%%+HOU___X/$$(M% MY(-X'`!T$H/$](M%Y(M0'%+HI%___X/$$(/$^(M%\%"+1>10Z.6&__^#Q!`/ MM@7:6P8(A2#>`0`=!*#Q/2+1>2+ M4`12Z-%>__^#Q!"+1>2#>`@`=!*#Q/2+1>2+4`A2Z+9>__^#Q!"+1>2#>!0` M=!*#Q/2+1>2+4!12Z)M>__^#Q!"+1>2#>!P`=!*#Q/2+1>2+4!Q2Z(!>__^# MQ!"#Q/B+1?!0BT7D4.C!A?__@\00#[8%VEL&"(7`=`>#^`AT!.L[ZSF#Q/QJ M!(U%]%"#Q/2-A7S___]0Z"Y=__^#Q!")P(U0`5*-A7S___]0:@)J/6C7R@4( MZ-!:__^#Q""+5?2)T.DJ%0``C;0F`````.G[$@``@WW0``^$^````(M%Y(-X M!`!T$H/$](M%Y(M0!%+HY5W__X/$$(M%Y(-X"`!T$H/$](M%Y(M0"%+HREW_ M_X/$$(M%Y(-X%`!T$H/$](M%Y(M0%%+HKUW__X/$$(M%Y(-X'`!T$H/$](M% MY(M0'%+HE%W__X/$$(/$^(M%\%"+1>10Z-6$__^#Q!`/M@7:6P8(AL_C;8`````@\3\:@2- M1?10@\3TC85\____4.@46___@\00B<"-4`%2C85\____4&H":CUHU\H%".BV M6/__@\0@BU7TB=#I$!,``.GH$```@WW4``^$_@```(M%Y(-X!`!T$H/$](M% MY(M0!%+HTEO__X/$$(M%Y(-X"`!T$H/$](M%Y(M0"%+HMUO__X/$$(M%Y(-X M%`!T$H/$](M%Y(M0%%+HG%O__X/$$(M%Y(-X'`!T$H/$](M%Y(M0'%+H@5O_ M_X/$$(/$^(M%\%"+1>10Z,*"__^#Q!`/M@7:6P8(A2#>`0`=!*#Q/2+1>2+4`12Z*A:__^#Q!"+1>2# M>`@`=!*#Q/2+1>2+4`A2Z(U:__^#Q!"+1>2#>!0`=!*#Q/2+1>2+4!12Z'): M__^#Q!"+1>2#>!P`=!*#Q/2+1>2+4!Q2Z%=:__^#Q!"#Q/B+1?!0BT7D4.B8 M@?__@\00#[8%VEL&"(7`=`J#^`AT!^L^C78`ZSF#Q/QJ!(U%]%"#Q/2-A7S_ M__]0Z`)9__^#Q!")P(U0`5*-A7S___]0:@)J/6C7R@4(Z*16__^#Q""+5?2) MT.G^$```BT7D@W@8``^$3@$``(M%Y(M0&(G0`<`!T(T4A0````")5>R#Q/2+ M1>Q0Z#A8__^#Q!")P(G"BT7DB5`10Z%*`__^#Q!`/M@7:6P8(AQ0:@"+1>2+4!Q2Z,]8__^#Q!#I>PT``/]% MV(M%Y(M5V#M0&`^&4`$``(M%Y(-X!`!T$H/$](M%Y(M0!%+H75C__X/$$(M% MY(-X"`!T$H/$](M%Y(M0"%+H0EC__X/$$(M%Y(-X%`!T$H/$](M%Y(M0%%+H M)UC__X/$$(M%Y(-X'`!T$H/$](M%Y(M0'%+H#%C__X/$$(/$^(M%\%"+1>10 MZ$U___^#Q!"#Q/QH9M8%"*%D7`8(4&HA:@%HW,H%"&H`:@3H!E?__X/$(,=% M]`0````/M@786P8(@_@(=T2+!(6LUP4(_^#K.8/$_&H$C47T4(/$](V%?/__ M_U#HC5;__X/$$(G`C5`!4HV%?/___U!J`FH^:-?*!0CH+U3__X/$(`^V!=I; M!@B%P'0'@_@(=`3K.^LY@\3\:@2-1?10@\3TC85\____4.A`5O__@\00B<"- M4`%2C85\____4&H":CUHU\H%".CB4___@\0@N`0```#I/`X``(M%Y(M-V(G* M`=(!RHT,E0````"-4?2+2!P!T8E-X(M%X,<``````(/$^(M%X(/`!%"-1=Q0 MZ#/!__^#Q!")P(E%](-]]``/A-T```"+1>2#>`0`=!*#Q/2+1>2+4`12Z,%6 M__^#Q!"+1>2#>`@`=!*#Q/2+1>2+4`A2Z*96__^#Q!"+1>2#>!0`=!*#Q/2+ M1>2+4!12Z(M6__^#Q!"+1>2#>!P`=!*#Q/2+1>2+4!Q2Z'!6__^#Q!"#Q/B+ M1?!0BT7D4.BQ??__@\00#[8%VEL&"(7`=`>#^`AT!.L[ZSF#Q/QJ!(U%]%"# MQ/2-A7S___]0Z!Y5__^#Q!")P(U0`5*-A7S___]0:@)J/6C7R@4(Z,!2__^# MQ""+5?2)T.D:#0``C;0F`````.GK"@``_T78BT7DBU78.U`8#X90`0``BT7D M@W@$`'02@\3TBT7DBU`$4NC-5?__@\00BT7D@W@(`'02@\3TBT7DBU`(4NBR M5?__@\00BT7D@W@4`'02@\3TBT7DBU`44NB75?__@\00BT7D@W@<`'02@\3T MBT7DBU`<4NA\5?__@\00@\3XBT7P4(M%Y%#HO7S__X/$$(/$_&AFU@4(H61< M!@A0:B%J`6C#^`AT!.L[ZSF#Q/QJ M!(U%]%"#Q/2-A7S___]0Z+!3__^#Q!")P(U0`5*-A7S___]0:@)J/6C7R@4( MZ%)1__^#Q""X!````.FL"P``BT7DBTW8B10Z"%[__^#Q!`/M@7: M6P8(A2+5=@[4!@/AE`!``"+1>2#>`0`=!*#Q/2+1>2+4`12Z#U3 M__^#Q!"+1>2#>`@`=!*#Q/2+1>2+4`A2Z")3__^#Q!"+1>2#>!0`=!*#Q/2+ M1>2+4!12Z`=3__^#Q!"+1>2#>!P`=!*#Q/2+1>2+4!Q2Z.Q2__^#Q!"#Q/B+ M1?!0BT7D4.@M>O__@\00@\3\:&;6!0BA9%P&"%!J(6H!:-S*!0AJ`&H$Z.91 M__^#Q"#'1?0$````#[8%V%L&"(/X"'=$BP2%]-<%"/_@ZSF#Q/QJ!(U%]%"# MQ/2-A7S___]0Z&U1__^#Q!")P(U0`5*-A7S___]0:@)J/FC7R@4(Z`]/__^# MQ"`/M@7:6P8(A2+3=B)R@'2`"+1>#'``(```#IS08``/]% MV(M%Y(M5V#M0&`^&4`$``(M%Y(-X!`!T$H/$](M%Y(M0!%+HKU'__X/$$(M% MY(-X"`!T$H/$](M%Y(M0"%+HE%'__X/$$(M%Y(-X%`!T$H/$](M%Y(M0%%+H M>5'__X/$$(M%Y(-X'`!T$H/$](M%Y(M0'%+H7E'__X/$$(/$^(M%\%"+1>10 MZ)]X__^#Q!"#Q/QH9M8%"*%D7`8(4&HA:@%HW,H%"&H`:@3H6%#__X/$(,=% M]`0````/M@786P8(@_@(=T2+!(48V`4(_^#K.8/$_&H$C47T4(/$](V%?/__ M_U#HWT___X/$$(G`C5`!4HV%?/___U!J`FH^:-?*!0CH@4W__X/$(`^V!=I; M!@B%P'0'@_@(=`3K.^LY@\3\:@2-1?10@\3TC85\____4.B23___@\00B<"- M4`%2C85\____4&H":CUHU\H%".@T3?__@\0@N`0```#IC@<``(M%Y(M-V(G* M`=(!RHT,E0````"-4?2+2!P!T8E-X(M%X,<``P```.D_!0``_T78BT7DBU78 M.U`8#X92`0``BT7D@W@$`'02@\3TBT7DBU`$4N@A4/__@\00BT7D@W@(`'02 M@\3TBT7DBU`(4N@&4/__@\00BT7D@W@4`'02@\3TBT7DBU`44NCK3___@\00 MBT7D@W@<`'02@\3TBT7DBU`<4NC03___@\00@\3XBT7P4(M%Y%#H$7?__X/$ M$(/$_&AFU@4(H612+3=B)R@'2`"+1>#'``4```"#Q/R+1>"#P`10C47X4(U%W%#H M(<;__X/$$(G`B47T@WWT``^$VP```(M%Y(-X!`!T$H/$](M%Y(M0!%+H?T[_ M_X/$$(M%Y(-X"`!T$H/$](M%Y(M0"%+H9$[__X/$$(M%Y(-X%`!T$H/$](M% MY(M0%%+H24[__X/$$(M%Y(-X'`!T$H/$](M%Y(M0'%+H+D[__X/$$(/$^(M% M\%"+1>10Z&]U__^#Q!`/M@7:6P8(A#^`AT!.L[ZSF#Q/QJ!(U% M]%"#Q/2-A7S___]0Z'!+__^#Q!")P(U0`5*-A7S___]0:@)J/6C7R@4(Z!)) M__^#Q""X!````.EL`P``BT7DBTW8B2#>`0`=!*#Q/2+ M1>2+4`12Z-)+__^#Q!"+1>2#>`@`=!*#Q/2+1>2+4`A2Z+=+__^#Q!"+1>2# M>!0`=!*#Q/2+1>2+4!12Z)Q+__^#Q!"+1>2#>!P`=!*#Q/2+1>2+4!Q2Z(%+ M__^#Q!"#Q/B+1?!0BT7D4.C"#^`AT!.L[ZSF# MQ/QJ!(U%]%"#Q/2-A7S___]0Z"]*__^#Q!")P(U0`5*-A7S___]0:@)J/6C7 MR@4(Z-%'__^#Q""+5?2)T.DK`@``BT7X`472+4!A2BT7DBU`<4HM%Y(M0%%*+1>2+4!!2BT7DBU`,4HM%Y(M0"%*+1>2+ M4`12BT7DBQ!2C47H4.BM1___@\0PB<")1?2#??3_#X5A`0``BT7D@W@$`'02 M@\3TBT7DBU`$4NB32O__@\00BT7D@W@(`'02@\3TBT7DBU`(4NAX2O__@\00 MBT7D@W@4`'02@\3TBT7DBU`44NA=2O__@\00BT7D@W@<`'02@\3TBT7DBU`< M4NA"2O__@\00@\3XBT7P4(M%Y%#H@W'__X/$$(/$]&AFU@4(BT7T4&BTU@4( MH5AM`D(UT)@#K.8/$_&H$C47T4(/$](V%?/___U#H8DC__X/$$(G`C5`!4HV% M?/___U!J`FH]:-?*!0CH!$;__X/$(+@7````ZV&+10B+5=R)$(M%$(M5Z(D0 M#[8%VEL&"(7`=`>#^`AT!.L[ZSF#Q/QJ!(U%]%"#Q/2-A7S___]0Z/Y'__^# MQ!")P(U0`5*-A7S___]0:@)J/6C7R@4(Z*!%__^#Q"`QP.L`R<.-=@!5B>6# M[&13@\3X:*C8!0B-1;!0Z(Q)__^#Q!#'1?P`````#[8%VEL&"(7`=`N#^`AT M".LSC70F`.LM@\3T@\3TC46P4.B+1___@\00B<"-4`%2C46P4&H!:CQHU\H% M".@P1?__@\0@@WT(``^%UP```(/$](M%"%!J`6BHV`4(H4A#8!0C_X)#K M,X/$_&H$C47\4(/$](U%L%#H)4;__X/$$(G`C5`!4HU%L%!J`FH^:-?*!0CH MRD/__X/$(`^V!=I;!@B%P'0'@_@(=`OK/.LZC;0F`````(/$_&H$C47\4(/$ M](U%L%#HUT7__X/$$(G`C5`!4HU%L%!J`FH]:-?*!0CH?$/__X/$(+@7```` MZ;,"``"-=@"+10B+4`2#PAB)5?B#Q/2+1?A0Z"1%__^#Q!")P(G"B57T@WWT M``^%U````(M%^%!HJ-@%"*%,7`8(4&H;:@%HW,H%"&H`:@;HGT7__X/$(,=% M_`8````/M@786P8(@_@(=T*+!(4$V04(_^"-="8`ZS.#Q/QJ!(U%_%"#Q/2- M1;!0Z"5%__^#Q!")P(U0`5*-1;!0:@)J/FC7R@4(Z,I"__^#Q"`/M@7:6P8( MALS@\3\:@2-1?Q0@\3TC46P4.B5 M0___@\00B<"-4`%2C46P4&H":CUHU\H%".@Z0?__@\0@BU7\B=#K=(UT)@"+ M10R+5?2)4`2+10R+5?"+3?2)TRG+B1@/M@7:6P8(A-M"8`````BUV8R<.-=@!5B>6#[%B+10AFB47^QT7X M`````(/$^&@HV04(C46P4.B?1/__@\00#[8%VEL&"(7`=`>#^`AT!.LOZRV# MQ/2#Q/2-1;!0Z*E"__^#Q!")P(U0`5*-1;!0:@%J/&C7R@4(Z$Y`__^#Q""# MQ/QJ"&H`C47P4.C+0___@\00@\3XC47P4(M%#%#HE/K__X/$$(G`B47X@WWX M`'11#[8%VEL&"(7`=`>#^`AT!.LUZS.#Q/QJ!(U%^%"#Q/2-1;!0Z#%"__^# MQ!")P(U0`5*-1;!0:@)J/6C7R@4(Z-8___^#Q""+5?B)T.F.````@\3\BT4< M4(M%&%"+1110BT404(M%\%"+1?10#[=%_E#H\+W__X/$((G`B47X@\3XBT7P M4(M%]%#H,&K__X/$$`^V!=I;!@B%P'0'@_@(=`3K->LS@\3\:@2-1?A0@\3T MC46P4.B@0?__@\00B<"-4`%2C46P4&H":CUHU\H%".A%/___@\0@BU7XB=#K M`,G#D%6)Y8/L=%/'1?@`````@\3X:#S9!0B-1:!0Z"E#__^#Q!`/M@7:6P8( MA#^`AT"^L\ZSJ-M"8````` M@\3\:@2-1?A0@\3TC46@4.B7/O__@\00B<"-4`%2C46@4&H":CUHU\H%".@\ M//__@\0@N!<```#IV@<``(UV`(M%"(L0B57H@\3\:@2+1>A0C47T4.@B/___ M@\00@T7H!(/$^(M%#%"-1?10Z*-___^#Q!")P(E%^(-]^`!T40^V!=I;!@B% MP'0'@_@(=`3K->LS@\3\:@2-1?A0@\3TC46@4.@$/O__@\00B<"-4`%2C46@ M4&H":CUHU\H%".BI.___@\0@BU7XB=#I1P<``,=%\`P```"#Q/2+1?!0Z%D] M__^#Q!")P(E%[(-][``/A!0Z!<^__^#Q!"+10B+50R+ M`(L2`=`Y1>AR!^FG!0``B?:#Q/QJ`HM%Z%"-1?Y0Z&H]__^#Q!"#1>@"@\3X MC47\4(U%_E#HJWC__X/$$(G`B47X@WWX`'1]@\3XBT7LBU`$4HM%[(M0"%+H MPV3__X/$$(/$^(M%\%"+1>Q0Z+!D__^#Q!`/M@7:6P8(AQ0Z/-C__^#Q!`/M@7:6P8(AR+4`A2Z&!C__^# MQ!"#Q/B+1?!0BT7L4.A-8___@\00@\3\:#S9!0BA:%P&"%!J(FH!:-S*!0AJ M`&H$Z`8[__^#Q"#'1?@$````#[8%V%L&"(/X"'<^BP2%Y-D%"/_@ZS.#Q/QJ M!(U%^%"#Q/2-1:!0Z)`Z__^#Q!")P(U0`5*-1:!0:@)J/FC7R@4(Z#4X__^# MQ"`/M@7:6P8(AQ0C47H4.A=I?__@\00B<")1?B#??@`='V#Q/B+1>R+4`12 MBT7LBU`(4NA%8O__@\00@\3XBT7P4(M%[%#H,F+__X/$$`^V!=I;!@B%P'0' M@_@(=`3K->LS@\3\:@2-1?A0@\3TC46@4.BB.?__@\00B<"-4`%2C46@4&H" M:CUHU\H%".A'-___@\0@BU7XB=#IY0(``.EI`@``@WWD``^$_P```(/$^(M% M[(M0!%*+1>R+4`A2Z+EA__^#Q!"#Q/B+1?!0BT7L4.BF8?__@\00@\3\:#S9 M!0BA:%P&"%!J(FH!:-S*!0AJ`&H$Z%\Y__^#Q"#'1?@$````#[8%V%L&"(/X M"'="BP2%"-H%"/_@C70F`.LS@\3\:@2-1?A0@\3TC46@4.CE./__@\00B<"- M4`%2C46@4&H":CYHU\H%".B*-O__@\0@#[8%VEL&"(7`=`>#^`AT"^L\ZSJ- MM"8`````@\3\:@2-1?A0@\3TC46@4.B7./__@\00B<"-4`%2C46@4&H":CUH MU\H%".@\-O__@\0@N`0```#IV@$``(UV`,=%Y`$```"#Q/R+1>R#P`A0BT7L M@\`$4(U%Z%#H$[G__X/$$(G`B47X@WWX``^$?0```(/$^(M%[(M0!%*+1>R+ M4`A2Z(=@__^#Q!"#Q/B+1?!0BT7L4.AT8/__@\00#[8%VEL&"(7`=`>#^`AT M!.LUZS.#Q/QJ!(U%^%"#Q/2-1:!0Z.0W__^#Q!")P(U0`5*-1:!0:@)J/6C7 MR@4(Z(DU__^#Q""+5?B)T.DG`0``Z:L```"#Q/B-1?10C47H4.C_HO__@\00 MB<")1?B#??@`#X1]````@\3XBT7LBU`$4HM%[(M0"%+HXU___X/$$(/$^(M% M\%"+1>Q0Z-!?__^#Q!`/M@7:6P8(ACK!(UT)@#I0_K__XM%#(M5[(M-\(M2!(T<"HD8BT40BU7L MB1"+10B+5>B)$`^V!=I;!@B%P'0'@_@(=`KK.^LYC;8`````@\3\:@2-1?A0 M@\3TC46@4.BW-O__@\00B<"-4`%2C46@4&H":CUHU\H%".A<-/__@\0@,<#K M`(M=B,G#C70F`%6)Y8/L6(M%"&:)1?Z#Q/AHI=H%"(U%L%#H/CC__X/$$`^V M!=I;!@B%P'0'@_@(=`3K+^LM@\3T@\3TC46P4.A(-O__@\00B<"-4`%2C46P M4&H!:CQHN]H%".CM,___@\0@QT7T`````(M%#(L0B57P#[=%_F:)1?R#Q/B- M1?I0C47\4.B+;___@\00B<")1?2#??0`=%D/M@7:6P8(ALS@\3\:@2-1?10@\3T MC46P4.A2-?__@\00B<"-4`%2C46P4&H":CUHN]H%".CW,O__@\0@BU7TB=#K M`9#)PXGV58GE@^Q8QT7\`````(/$^&C`V@4(C46\4.C:-O__@\00#[8%VEL& M"(7`=`>#^`AT"^LVZS2-M"8`````@\3T@\3TC46\4.C=-/__@\00B<"-4`%2 MC46\4&H!:CQHN]H%".B",O__@\0@@WT(``^$E@```(/$^(M%"(M0#%*+10B+ M4!!2Z`-=__^#Q!"#Q/B+10B+4!12BT4(BU`84NCJ7/__@\00@\3XBT4(BU`< M4HM%"(M0(%+HT5S__X/$$(/$^(M%"(M0)%*+10B+4"A2Z+A<__^#Q!"#Q/B+ M10B+4#!2BT4(BU`T4NB?7/__@\00@\3XBT4(BU`X4HM%"(M0/%+HAES__X/$ M$`^V!=I;!@B%P'0(@_@(=`7K-I#K,X/$_&H$C47\4(/$](U%O%#H]3/__X/$ M$(G`C5`!4HU%O%!J`FH]:+O:!0CHFC'__X/$(#'`ZP>-M"8`````R<.)]E6) MY8/L6,=%_`````"#Q/AHU-H%"(U%O%#H>C7__X/$$`^V!=I;!@B%P'0'@_@( M=`OK-NLTC;0F`````(/$](/$](U%O%#H?3/__X/$$(G`C5`!4HU%O%!J`6H\ M:+O:!0CH(C'__X/$((-]"`!T,H/$^(M%"(M0#%*+10B+4!!2Z*=;__^#Q!"# MQ/B+10B+4!12BT4(BU`84NB.6___@\00#[8%VEL&"(7`=`>#^`AT"^L\ZSJ- MM"8`````@\3\:@2-1?Q0@\3TC46\4.CW,O__@\00B<"-4`%2C46\4&H":CUH MN]H%".B<,/__@\0@,<#K`,G#C78`58GE@^Q8QT7\`````(/$^&CFV@4(C46\ M4.B"-/__@\00#[8%VEL&"(7`=`B#^`AT!>LPD.LM@\3T@\3TC46\4.B+,O__ M@\00B<"-4`%2C46\4&H!:CQHN]H%".@P,/__@\0@@WT(`'1+@\3XBT4(BU`, M4HM%"(M0$%+HM5K__X/$$(/$^(M%"(M0%%*+10B+4!A2Z)Q:__^#Q!"#Q/B+ M10B+4!Q2BT4(BU`@4NB#6O__@\00#[8%VEL&"(7`=`>#^`AT!.LUZS.#Q/QJ M!(U%_%"#Q/2-1;Q0Z/,Q__^#Q!")P(U0`5*-1;Q0:@)J/6B[V@4(Z)@O__^# MQ"`QP.L%D(UT)@#)PXGV58GE@^Q8QT7\`````(/$^&CZV@4(C46\4.AZ,___ M@\00#[8%VEL&"(7`=`>#^`AT"^LVZS2-M"8`````@\3T@\3TC46\4.A],?__ M@\00B<"-4`%2C46\4&H!:CQHN]H%".@B+___@\0@@WT(`'1$@\3TBT4(BU`0 M4NBJ,?__@\00@\3XBT4(BU`84HM%"(M0'%+HE5G__X/$$(/$^(M%"(M0(%*+ M10B+4"12Z'Q9__^#Q!`/M@7:6P8(A6#[&13QT7\`````(/$^&@,VP4(C46L4.AI M,O__@\00#[8%VEL&"(7`=`>#^`AT"NLUZS.-M@````"#Q/2#Q/2-1:Q0Z&TP M__^#Q!")P(U0`5*-1:Q0:@%J/&B[V@4(Z!(N__^#Q""#?0@`#X6)````@\3T MBT4(4&H!:`S;!0BA2%P&"%!J&FH!:"#;!0AJ`&H$Z%\P__^#Q##'1?P$```` M#[8%VEL&"(7`=`Z#^`AT"^L\C;0F`````.LS@\3\:@2-1?Q0@\3TC46L4.CE M+___@\00B<"-4`%2C46L4&H":CUHN]H%".B*+?__@\0@BU7\B=#IP04``)"# M?0P`#X6&````@\3TBT4,4&H":`S;!0BA2%P&"%!J&FH!:"#;!0AJ`&H$Z,PO M__^#Q##'1?P$````#[8%VEL&"(7`=`N#^`AT".LYC70F`.LS@\3\:@2-1?Q0 M@\3TC46L4.A5+___@\00B<"-4`%2C46L4&H":CUHN]H%".CZ+/__@\0@BU7\ MB=#I,04``)"+10R)1>S'1?A*````@\3TBT7X4.BC+O__@\00B<")PHE5\(-] M\`!U?(M%^%!H#-L%"*%,7`8(4&H;:@%H(-L%"&H`:@;H(B___X/$(,=%_`8` M```/M@7:6P8(A#^`AT!.LUZS.# MQ/QJ!(U%_%"#Q/2-1:Q0Z%`L__^#Q!")P(U0`5*-1:Q0:@)J/6B[V@4(Z/4I M__^#Q""+5?R)T.DL`@``@\3XC47T4(U%\%"-1?A0:@&+10B+4!A2:*6P``#H MSI___X/$((G`B47\@WW\`'1L@\3XBT7X4(M%\%#H3%3__X/$$`^V!=I;!@B% MP'0.@_@(=`OK/(VT)@````#K,X/$_&H$C47\4(/$](U%K%#HM2O__X/$$(G` MC5`!4HU%K%!J`FH]:+O:!0CH6BG__X/$((M5_(G0Z9$!``"0@\3\C47T4(U% M\%"-1?A0:@&+10B+4!Q2BT4(BU`@4FBFL```Z&^G__^#Q"")P(E%_(-]_`!T M:8/$^(M%^%"+1?!0Z*E3__^#Q!`/M@7:6P8(A#^`AT!.LUZS.#Q/QJ M!(U%_%"#Q/2-1:Q0Z)$J__^#Q!")P(U0`5*-1:Q0:@)J/6B[V@4(Z#8H__^# MQ""+5?R)T.MPBT7LBU7TBTWPB=,IRXD8BT7LBU7PB5`$#[8%VEL&"(7`=`V# M^`AT"NL[C;8`````ZS.#Q/QJ!(U%_%"#Q/2-1:Q0Z"4J__^#Q!")P(U0`5*- M1:Q0:@)J/6B[V@4(Z,HG__^#Q""+5?R)T.L$C70F`(M=F,G#C78`58GE@^QX M@\3X:"K;!0B-19!0Z*TK__^#Q!`/M@7:6P8(A`0`#X6%````ZP*)]H/$](M% M"%!J`6@JVP4(H4ALS@\3\:@2-1?A0@\3TC4604.@3*?__@\00B<"- M4`%2C4604&H":CUHN]H%".BX)O__@\0@BU7XB=#I;PD``(-]#``/A84```"# MQ/2+10Q0:@)H*ML%"*%(7`8(4&H::@%H(-L%"&H`:@3H^RC__X/$,,=%^`0` M```/M@7:6P8(A$(``"0BT4, MB47H@\3\:AAJ`(U%T%#HEBG__X/$$(M%"(M0!(E5[(M%"(M5"(M`!(L2`=`Y M1>QR#.E'"```C;0F`````(/$_&H"BT7L4(U%_E#HVBC__X/$$(-%[`*#Q/B- M1?Q0C47^4.@;9/__@\00B<")1?B#??@`=%D/M@7:6P8(ASIX@8``(-] MT``/A(````"#Q/QH*ML%"*%H7`8(4&HB:@%H(-L%"&H`:@3HW";__X/$(,=% M^`0````/M@7:6P8(AA0C47L4.A]D?__@\00B<")1?B#??@`=%L/M@7:6P8( MALZD(UT)@#K,X/$_&H$C47X4(/$](U% MD%#H527__X/$$(G`C5`!4HU%D%!J`FH]:+O:!0CH^B+__X/$((M5^(G0Z;$% M``"0QT74`0```(/$^(M%Z(/`!%"-1>Q0Z&J0__^#Q!")P(E%^(-]^`!T6`^V M!=I;!@B%P'0-@_@(=`KK.XVV`````.LS@\3\:@2-1?A0@\3TC4604.C5)/__ M@\00B<"-4`%2C4604&H":CUHN]H%".AZ(O__@\0@BU7XB=#I,04``)#IPP0` M`(-]V``/A($```"#Q/QH*ML%"*%H7`8(4&HB:@%H(-L%"&H`:@3HO23__X/$ M(,=%^`0````/M@7:6P8(AB#P!!0BT7H@\`,4(U%[%#H#^`AT!.LUZS.#Q/QJ!(U%^%"#Q/2-19!0 MZ+0B__^#Q!")P(U0`5*-19!0:@)J/6B[V@4(Z%D@__^#Q""+5?B)T.D0`P`` MZ:,"``"#?>``#X2!````@\3\:"K;!0BA:%P&"%!J(FH!:"#;!0AJ`&H$Z)TB M__^#Q"#'1?@$````#[8%VEL&"(7`=`R#^`AT">LZD(UT)@#K,X/$_&H$C47X M4(/$](U%D%#H)2+__X/$$(G`C5`!4HU%D%!J`FH]:+O:!0CHRA___X/$((M5 M^(G0Z8$"``"0QT7@`0```(/$_(M%Z(/`&%"+1>B#P!10C47L4.ACFO__@\00 MB<")1?B#??@`=%$/M@7:6P8(A0!````@\3\BT7H@\`@4(M%Z(/`'%"-1>Q0Z).A__^# MQ!")P(E%^(-]^`!T40^V!=I;!@B%P'0'@_@(=`3K->LS@\3\:@2-1?A0@\3T MC4604.B4(/__@\00B<"-4`%2C4604&H":CUHN]H%".@Y'O__@\0@BU7XB=#I M\````.F#````QT7T`````(/$^(U%]%"-1>Q0Z*B+__^#Q!")P(E%^(-]^`!T M5@^V!=I;!@B%P'0+@_@(=`CK.8UT)@#K,X/$_&H$C47X4(/$](U%D%#H%2#_ M_X/$$(G`C5`!4HU%D%!J`FH]:+O:!0CHNAW__X/$((M5^(G0ZW2-="8`BT7T M`47LZP#II??__XUV`,=%^``````/M@7:6P8(A6#[&13@\3X:'S;!0B-1:Q0Z#`A M__^#Q!`/M@7:6P8(A__^#Q!")P(U0 M`5*-1:Q0:@)J/6B[V@4(Z%H<__^#Q""+5?R)T.GQ!@``D(-]#``/A88```"# MQ/2+10Q0:@)H?-L%"*%(7`8(4&H::@%H(-L%"&H`:@3HG![__X/$,,=%_`0` M```/M@7:6P8(A M__^#Q!")P(U0`5*-1:Q0:@)J/6B[V@4(Z,H;__^#Q""+5?R)T.EA!@``D(M% M#(E%[,=%^&(```"#Q/2+1?A0Z',=__^#Q!")P(G"B57P@WWP`'5\BT7X4&A\ MVP4(H4QLS@\3\:@2-1?Q0@\3TC46L4.A_'?__@\00B<"-4`%2C46L M4&H":CUHN]H%".@D&___@\0@BU7\B=#INP4``(/$_(M%^%!J`(M%\%#HE1[_ M_X/$$(M%\(E%](/$_(U%]%"+10B+$%)HL;```.C]A?__@\00B<")1?R#??P` M=&N#Q/B+1?A0BT7P4.AK1?__@\00#[8%VEL&"(7`=`V#^`AT"NL[C;8````` MZS.#Q/QJ!(U%_%"#Q/2-1:Q0Z-4<__^#Q!")P(U0`5*-1:Q0:@)J/6B[V@4( MZ'H:__^#Q""+5?R)T.D1!0``D(/$_(U%]%"+10B+4`12:+*P``#H;(7__X/$ M$(G`B47\@WW\`'1J@\3XBT7X4(M%\%#HVD3__X/$$`^V!=I;!@B%P'0,@_@( M=`GK.I"-="8`ZS.#Q/QJ!(U%_%"#Q/2-1:Q0Z$4<__^#Q!")P(U0`5*-1:Q0 M:@)J/6B[V@4(Z.H9__^#Q""+5?R)T.F!!```D(/$_(U%]%"+10B+4`A2:+.P M``#HW(3__X/$$(G`B47\@WW\`'1J@\3XBT7X4(M%\%#H2D3__X/$$`^V!=I; M!@B%P'0,@_@(=`GK.I"-="8`ZS.#Q/QJ!(U%_%"#Q/2-1:Q0Z+4;__^#Q!") MP(U0`5*-1:Q0:@)J/6B[V@4(Z%H9__^#Q""+5?R)T.GQ`P``D(/$_(U%]%"+ M10B+4`Q2:+2P``#H3(3__X/$$(G`B47\@WW\`'1J@\3XBT7X4(M%\%#HND/_ M_X/$$`^V!=I;!@B%P'0,@_@(=`GK.I"-="8`ZS.#Q/QJ!(U%_%"#Q/2-1:Q0 MZ"4;__^#Q!")P(U0`5*-1:Q0:@)J/6B[V@4(Z,H8__^#Q""+5?R)T.EA`P`` MD(/$^(U%]%"-1?!0C47X4&H!BT4(BU`04FBUL```Z+:J__^#Q"")P(E%_(-] M_`!T9(/$^(M%^%"+1?!0Z"!#__^#Q!`/M@7:6P8(AP``#HKY7__X/$((G`B47\@WW\`'1I M@\3XBT7X4(M%\%#HZ4'__X/$$`^V!=I;!@B%P'0+@_@(=`CK.8UT)@#K,X/$ M_&H$C47\4(/$](U%K%#H51G__X/$$(G`C5`!4HU%K%!J`FH]:+O:!0CH^A;_ M_X/$((M5_(G0Z9$!``"0@\3\C47T4(U%\%"-1?A0:@&+10B+4"A2BT4(BU`L M4FBXL```Z`^5__^#Q"")P(E%_(-]_`!T:8/$^(M%^%"+1?!0Z$E!__^#Q!`/ MM@7:6P8(A#^`AT!.LUZS.#Q/QJ!(U%_%"#Q/2-1:Q0Z#$8__^#Q!") MP(U0`5*-1:Q0:@)J/6B[V@4(Z-85__^#Q""+5?R)T.MPBT7LBU7TBTWPB=,I MRXD8BT7LBU7PB5`$QT7\``````^V!=I;!@B%P'0'@_@(=`3K->LS@\3\:@2- M1?Q0@\3TC46L4.C$%___@\00B<"-4`%2C46L4&H":CUHN]H%".AI%?__@\0@ MBU7\B=#K`XUV`(M=F,G#C78`58GE@>R(````@\3X:([;!0B-1810Z$H9__^# MQ!`/M@7:6P8(AR+10B+50B+0`2+$@'0.47L<@SI MAPH``(VT)@````"#Q/QJ`HM%[%"-1?Y0Z&H6__^#Q!"#1>P"@\3XC47\4(U% M_E#HJU'__X/$$(G`B47X@WWX`'19#[8%VEL&"(7`=`Z#^`AT"^L\C;0F```` M`.LS@\3\:@2-1?A0@\3TC46$4.A%%?__@\00B<"-4`%2C46$4&H":CUHN]H% M".CJ$O__@\0@BU7XB=#I40H``)!F@7W\L+`/AX0```"#Q/QHCML%"*%07`8( M4&H<:@%H(-L%"&H`:@3H,!7__X/$(,=%^`0```"#??@`=%0/M@7:6P8(A)]NLS@\3\:@2-1?A0@\3TC46$4.BU%/__@\00B<"-4`%2C46$ M4&H":CUHN]H%".A:$O__@\0@BU7XB=#IP0D``)`/MU7\C8)/3___@_@.#X?" M"```BP2%I-L%"/_@C70F`(M%"(M5"(M`!(L2C0P"B4WLZ2()``"#?<0`#X2` M````@\3\:([;!0BA:%P&"%!J(FH!:"#;!0AJ`&H$Z&P4__^#Q"#'1?@$```` M#[8%VEL&"(7`=`N#^`AT".LYC70F`.LS@\3\:@2-1?A0@\3TC46$4.CU$___ M@\00B<"-4`%2C46$4&H":CUHN]H%".B:$?__@\0@BU7XB=#I`0D``)#'1<0! M````@\3XBT7D4(U%[%#H#7___X/$$(G`B47X@WWX`'1;#[8%VEL&"(7`=`># M^`AT"^L\ZSJ-M"8`````@\3\:@2-1?A0@\3TC46$4.AW$___@\00B<"-4`%2 MC46$4&H":CUHN]H%".@<$?__@\0@BU7XB=#I@P@``(UV`.D3"```@WW(``^$ M@0```(/$_&B.VP4(H6A2#P`10C47L4.CZ??__@\00B<")1?B#??@`=%@/M@7:6P8( MALZD(UT)@#K,X/$_&H$C47X4(/$](U%A%#H MU1'__X/$$(G`C5`!4HU%A%!J`FH]:+O:!0CH>@___X/$((M5^(G0Z>$&``"0 MQT7,`0```(/$^(M%Y(/`"%"-1>Q0Z.I\__^#Q!")P(E%^(-]^`!T6`^V!=I; M!@B%P'0-@_@(=`KK.XVV`````.LS@\3\:@2-1?A0@\3TC46$4.A5$?__@\00 MB<"-4`%2C46$4&H":CUHN]H%".CZ#O__@\0@BU7XB=#I808``)#I\P4``(-] MT``/A($```"#Q/QHCML%"*%H7`8(4&HB:@%H(-L%"&H`:@3H/1'__X/$(,=% M^`0````/M@7:6P8(A2#P!!0C47T4(U%[%#HYJ#__X/$$(G`B47X@WWX M`'14#[8%VEL&"(7`=`F#^`AT!NLWB?;K,X/$_&H$C47X4(/$](U%A%#H-0__ M_X/$$(G`C5`!4HU%A%!J`FH]:+O:!0CHV@S__X/$((M5^(G0Z4$$``"0Z=,# M``#'1>@`````@WW8``^$>P```(/$_&B.VP4(H6ALS@\3\:@2-1?A0 M@\3TC46$4.BC#O__@\00B<"-4`%2C46$4&H":CUHN]H%".A(#/__@\0@BU7X MB=#IKP,``,=%V`$```"#Q/R-1>A0C47T4(U%[%#HZ,S__X/$$(G`B47X@WWX M`'16#[8%VEL&"(7`=`N#^`AT".LYC70F`.LS@\3\:@2-1?A0@\3TC46$4.@E M#O__@\00B<"-4`%2C46$4&H":CUHN]H%".C*"___@\0@BU7XB=#I,0,``)"+ M1>2+5>B+"HE(%(M%Y(M5Z(M*"(E('(M%Y(M5Z(M*!(E(&.F@`@``@WW<``^$ M?@```(/$_&B.VP4(H6A2#P"10BT7D@\`@4(U%[%#H\XW__X/$$(G`B47X@WWX`'11#[8% MVEL&"(7`=`>#^`AT!.LUZS.#Q/QJ!(U%^%"#Q/2-1810Z/0,__^#Q!")P(U0 M`5*-1810:@)J/6B[V@4(Z)D*__^#Q""+5?B)T.D``@``Z9,!``"#?>``#X2! M````@\3\:([;!0BA:%P&"%!J(FH!:"#;!0AJ`&H$Z-T,__^#Q"#'1?@$```` M#[8%VEL&"(7`=`R#^`AT">LZD(UT)@#K,X/$_&H$C47X4(/$](U%A%#H90S_ M_X/$$(G`C5`!4HU%A%!J`FH]:+O:!0CH"@K__X/$((M5^(G0Z7$!``"0QT7@ M`0```(/$_(M%Y(/`+%"+1>2#P"A0C47L4.CCC/__@\00B<")1?B#??@`=%$/ MM@7:6P8(A#^`AT!.LOZRV#Q/2#Q/2-1:Q0Z(H*__^#Q!")P(U0`5*-1:Q0:@%J/&B[ MV@4(Z"\(__^#Q""#?0@`#X6&````@\3TBT4(4&H!:.#;!0BA2%P&"%!J&FH! M:"#;!0AJ`&H$Z'P*__^#Q##'1?P$````#[8%VEL&"(7`=`N#^`AT".LYC70F M`.LS@\3\:@2-1?Q0@\3TC46L4.@%"O__@\00B<"-4`%2C46L4&H":CUHN]H% M".BJ!___@\0@BU7\B=#I(04``)"#?0P`#X6&````@\3TBT4,4&H":.#;!0BA M2%P&"%!J&FH!:"#;!0AJ`&H$Z.P)__^#Q##'1?P$````#[8%VEL&"(7`=`N# M^`AT".LYC70F`.LS@\3\:@2-1?Q0@\3TC46L4.AU"?__@\00B<"-4`%2C46L M4&H":CUHN]H%".@:!___@\0@BU7\B=#ID00``)"+10R)1>S'1?@\````@\3T MBT7X4.C#"/__@\00B<")PHE5\(-]\`!U?(M%^%!HX-L%"*%,7`8(4&H;:@%H M(-L%"&H`:@;H0@G__X/$(,=%_`8````/M@7:6P8(AL#``"#Q/R+1?A0:@"+1?!0Z.4)__^#Q!"+1?")1?2#Q/R- M1?10BT4(BQ!2:,&P``#H37'__X/$$(G`B47\@WW\`'1K@\3XBT7X4(M%\%#H MNS#__X/$$`^V!=I;!@B%P'0-@_@(=`KK.XVV`````.LS@\3\:@2-1?Q0@\3T MC46L4.@E"/__@\00B<"-4`%2C46L4&H":CUHN]H%".C*!?__@\0@BU7\B=#I M00,``)"#Q/R-1?10BT4(BU`$4FC"L```Z+QP__^#Q!")P(E%_(-]_`!T:H/$ M^(M%^%"+1?!0Z"HP__^#Q!`/M@7:6P8(AO__@\0@B<")1?R#??P`=&2#Q/B+1?A0BT7P4.@`+___@\00 M#[8%VEL&"(7`=`>#^`AT!.LUZS.#Q/QJ!(U%_%"#Q/2-1:Q0Z'`&__^#Q!") MP(U0`5*-1:Q0:@)J/6B[V@4(Z!4$__^#Q""+5?R)T.F,`0``@\3\C47T4(U% M\%"-1?A0:@&+10B+4!12BT4(BU`84FC%L```Z"N"__^#Q"")P(E%_(-]_`!T M98/$^(M%^%"+1?!0Z&4N__^#Q!`/M@7:6P8(A@/__X/$ M((M5_(G0Z?$```"0@\3XC47T4&C/L```Z`_/__^#Q!")P(E%_(-]_`!T88/$ M^(M%^%"+1?!0Z.$M__^#Q!`/M@7:6P8(AR+5?2+3?")TRG+B1B+1>R+5?")4`3'1?P`````#[8%VEL&"(7` M=`>#^`AT!.LUZS.#Q/QJ!(U%_%"#Q/2-1:Q0Z.0$__^#Q!")P(U0`5*-1:Q0 M:@)J/6B[V@4(Z(D"__^#Q""+5?R)T.L#C78`BUV8R<.-=@!5B>6#['B#Q/AH M\ML%"(U%E%#H;0;__X/$$`^V!=I;!@B%P'0'@_@(=`3K+^LM@\3T@\3TC464 M4.AW!/__@\00B<"-4`%2C4644&H!:CQHN]H%".@<`O__@\0@@WT(``^4P@^V MPHM5"(,Z``^>P0^VT0G0A#^`AT!.LUZS.#Q/QJ!(U%^%"#Q/2-1910Z-,#__^#Q!")P(U0`5*- M1910:@)J/6B[V@4(Z'@!__^#Q""+5?B)T.E?"```@WT,``^%A0```(/$](M% M#%!J`FCRVP4(H4AB# MQ/QJ%&H`C4744.A6!/__@\00BT4(BU`$B57LBT4(BU4(BT`$BQ(!T#E%['(, MZ3<'``"-M"8`````@\3\:@*+1>Q0C47^4.B:`___@\00@T7L`H/$^(U%_%"- M1?Y0Z-L^__^#Q!")P(E%^(-]^`!T60^V!=I;!@B%P'0.@_@(=`OK/(VT)@`` M``#K,X/$_&H$C47X4(/$](U%E%#H=0+__X/$$(G`C5`!4HU%E%!J`FH]:+O: M!0CH&@#__X/$((M5^(G0Z0$'``"09H%]_,"P#X>$````@\3\:/+;!0BA4%P& M"%!J'&H!:"#;!0AJ`&H$Z&`"__^#Q"#'1?@$````@WWX`'14#[8%VEL&"(7` M=`F#^`AT!NLWB?;K,X/$_&H$C47X4(/$](U%E%#HY0'__X/$$(G`C5`!4HU% ME%!J`FH]:+O:!0CHBO_^_X/$((M5^(G0Z7$&``"0#[=5_(V"/T___X/X#@^' M<@4``(L$A0CQ0Z#UL__^#Q!")P(E%^(-]^`!T6P^V!=I;!@B%P'0' M@_@(=`OK/.LZC;0F`````(/$_&H$C47X4(/$](U%E%#HIP#__X/$$(G`C5`! M4HU%E%!J`FH]:+O:!0CH3/[^_X/$((M5^(G0Z3,%``"-=@#IPP0``(-]V``/ MA($```"#Q/QH\ML%"*%H7`8(4&HB:@%H(-L%"&H`:@3HC0#__X/$(,=%^`0` M```/M@7:6P8(AB#P`A0C47L4.@::O__@\00B<")1?B#??@`=%@/M@7: M6P8(A``#X2!````@\3\:/+;!0BA:%P&"%!J(FH!:"#;!0AJ`&H$Z&W^_O^#Q"#' M1?@$````#[8%VEL&"(7`=`R#^`AT">LZD(UT)@#K,X/$_&H$C47X4(/$](U% ME%#H]?W^_X/$$(G`C5`!4HU%E%!J`FH]:+O:!0CHFOO^_X/$((M5^(G0Z8$" M``"0QT7@`0```(/$_(M%Z(/`$%"+1>B#P`Q0C47L4.@S=O__@\00B<")1?B# M??@`=%$/M@7:6P8(A0!````@\3\BT7H@\`84(M%Z(/`%%"-1>Q0Z&-]__^#Q!")P(E% M^(-]^`!T40^V!=I;!@B%P'0'@_@(=`3K->LS@\3\:@2-1?A0@\3TC4644.AD M_/[_@\00B<"-4`%2C4644&H":CUHN]H%".@)^O[_@\0@BU7XB=#I\````.F# M````QT7T`````(/$^(U%]%"-1>Q0Z'AG__^#Q!")P(E%^(-]^`!T5@^V!=I; M!@B%P'0+@_@(=`CK.8UT)@#K,X/$_&H$C47X4(/$](U%E%#HY?O^_X/$$(G` MC5`!4HU%E%!J`FH]:+O:!0CHBOG^_X/$((M5^(G0ZW2-="8`BT7T`47LZP#I MM?C__XUV`,=%^``````/M@7:6P8(A6#[&13@\3X:$3LS@\3\:@2-1?Q0@\3TC46L4.A/^?[_@\00B<"-4`%2C46L4&H":CUH MN]H%".CT]O[_@\0@BU7\B=#IZP8``(/$_(M%^%!J`(M%\%#H9?K^_X/$$(M% M\(E%](/$_(U%]%"+10B+$%)HX;```.C-8?__@\00B<")1?R#??P`=&N#Q/B+ M1?A0BT7P4.@[(?__@\00#[8%VEL&"(7`=`V#^`AT"NL[C;8`````ZS.#Q/QJ M!(U%_%"#Q/2-1:Q0Z*7X_O^#Q!")P(U0`5*-1:Q0:@)J/6B[V@4(Z$KV_O^# MQ""+5?R)T.E!!@``D(/$_(U%]%"+10B+4`12:.*P``#H/&'__X/$$(G`B47\ M@WW\`'1J@\3XBT7X4(M%\%#HJB#__X/$$`^V!=I;!@B%P'0,@_@(=`GK.I"- M="8`ZS.#Q/QJ!(U%_%"#Q/2-1:Q0Z!7X_O^#Q!")P(U0`5*-1:Q0:@)J/6B[ MV@4(Z+KU_O^#Q""+5?R)T.FQ!0``D(/$_(U%]%"+10B+4`A2:..P``#HK&#_ M_X/$$(G`B47\@WW\`'1J@\3XBT7X4(M%\%#H&B#__X/$$`^V!=I;!@B%P'0, M@_@(=`GK.I"-="8`ZS.#Q/QJ!(U%_%"#Q/2-1:Q0Z(7W_O^#Q!")P(U0`5*- M1:Q0:@)J/6B[V@4(Z"KU_O^#Q""+5?R)T.DA!0``D(/$^(U%]%"-1?!0C47X M4&H!BT4(BU`04FCDL```Z`)K__^#Q"")P(E%_(-]_`!T9(/$^(M%^%"+1?!0 MZ(`?__^#Q!`/M@7:6P8(A#^`AT!.LUZS.#Q/QJ!(U%_%"#Q/2-1:Q0Z,#U_O^#Q!")P(U0 M`5*-1:Q0:@)J/6B[V@4(Z&7S_O^#Q""+5?R)T.E<`P``@\3\C47T4(U%\%"- M1?A0:@&+10B+4"12BT4(BU`H4FCFL```Z'MQ__^#Q"")P(E%_(-]_`!T98/$ M^(M%^%"+1?!0Z+4=__^#Q!`/M@7:6P8(ALZD(UT)@#K M,X/$_&H$C47\4(/$](U%K%#HE?3^_X/$$(G`C5`!4HU%K%!J`FH]:+O:!0CH M.O+^_X/$((M5_(G0Z3$"``"0@\3\C47T4(U%\%"-1?A0:@&+10B+4#!2BT4( MBU`T4FCHL```Z$]P__^#Q"")P(E%_(-]_`!T:8/$^(M%^%"+1?!0Z(D<__^# MQ!`/M@7:6P8(ALS@\3\:@2-1?Q0@\3TC46L4.C1\O[_@\00B<"-4`%2C46L4&H":CUHN]H% M".AV\/[_@\0@BU7\B=#K<(M%[(M5](M-\(G3*#^`AT M"^LVZS2-M"8`````@\3T@\3TC46`4.CM\?[_@\00B<"-4`%2C46`4&H!:CQH MN]H%".B2[_[_@\0@@WT(``^4P@^VPHM5"(,Z``^>P0^VT0G0AB#Q/QJ*&H`C47`4.C&\?[_@\00 MBT4(BU`$B57LBT4(BU4(BT`$BQ(!T#E%['(,Z4<,``"-M"8`````@\3\:@*+ M1>Q0C47^4.@*\?[_@\00@T7L`H/$^(U%_%"-1?Y0Z$LL__^#Q!")P(E%^(-] M^`!T60^V!=I;!@B%P'0.@_@(=`OK/(VT)@````#K,X/$_&H$C47X4(/$](U% M@%#HY>_^_X/$$(G`C5`!4HU%@%!J`FH]:+O:!0CHBNW^_X/$((M5^(G0Z1$, M``"09H%]_."P#X>$````@\3\:%C_^_X/$$(G`C5`!4HU%@%!J`FH]:+O:!0CH^NS^_X/$ M((M5^(G0Z8$+``"0#[=5_(V"'T___X/X#@^'@@H``(L$A7#S^_X/$(,=% M^`0```"+5?B)T.G)"@``QT7``0```(/$^(M%Z%"-1>Q0Z+99__^#Q!")P(E% M^(-]^`!T5`^V!=I;!@B%P'0)@_@(=`;K-XGVZS.#Q/QJ!(U%^%"#Q/2-18!0 MZ"7N_O^#Q!")P(U0`5*-18!0:@)J/6B[V@4(Z,KK_O^#Q""+5?B)T.E1"@`` MD.GC"0``@WW$`'1[@\3\:%CW^_X/$ M$(G`C5`!4HU%@%!J`FH]:+O:!0CH2NO^_X/$(,=%^`0```"+5?B)T.G*"0`` MQT7$`0```(/$^(M%Z(/`!%"-1>Q0Z+18__^#Q!")P(E%^(-]^`!T4@^V!=I; M!@B%P'0'@_@(=`3K->LS@\3\:@2-1?A0@\3TC46`4.@E[?[_@\00B<"-4`%2 MC46`4&H":CUHN]H%".C*ZO[_@\0@BU7XB=#I40D``)#IXP@``(-]R`!T>X/$ M_&A8W`4(H6A# M^`AT!.LUZS.#Q/QJ!(U%^%"#Q/2-18!0Z*7L_O^#Q!")P(U0`5*-18!0:@)J M/6B[V@4(Z$KJ_O^#Q"#'1?@$````BU7XB=#IR@@``,=%R`$```"#Q/B+1>B# MP`A0C47L4.BT5___@\00B<")1?B#??@`=%(/M@7:6P8(AS^_X/$$(G`C5`!4HU%@%!J`FH]:+O:!0CH MRNG^_X/$((M5^(G0Z5$(``"0Z>,'``"#?S^_X/$(`^V!=I;!@B%P'0'@_@(=`3K->LS@\3\:@2- M1?A0@\3TC46`4.BEZ_[_@\00B<"-4`%2C46`4&H":CUHN]H%".A*Z?[_@\0@ MQT7X!````(M5^(G0ZQ0 MZ-UC__^#Q!")P(E%^(-]^`!T6P^V!=I;!@B%P'0'@_@(=`OK/.LZC;0F```` M`(/$_&H$C47X4(/$](U%@%#H%^O^_X/$$(G`C5`!4HU%@%!J`FH]:+O:!0CH MO.C^_X/$((M5^(G0Z4,'``"-=@#ITP8``(-]T`!T>X/$_&A8W`4(H6A#^`AT!.LUZS.#Q/QJ M!(U%^%"#Q/2-18!0Z)7J_O^#Q!")P(U0`5*-18!0:@)J/6B[V@4(Z#KH_O^# MQ"#'1?@$````BU7XB=#IN@8``,=%T`$```"#Q/R+1>B#P!A0BT7H@\`44(U% M[%#HS6+__X/$$(G`B47X@WWX`'1;#[8%VEL&"(7`=`>#^`AT"^L\ZSJ-M"8` M````@\3\:@2-1?A0@\3TC46`4.@'ZO[_@\00B<"-4`%2C46`4&H":CUHN]H% M".BLY_[_@\0@BU7XB=#I,P8``(UV`.G#!0``@WWD`'1[@\3\:%CG^_X/$$(G`C5`!4HU%@%!J`FH]:+O:!0CH*N?^ M_X/$(,=%^`0```"+5?B)T.FJ!0``QT7D`0```(/$_(M%Z(/`(%"+1>B#P!Q0 MC47L4.B]8?__@\00B<")1?B#??@`=%L/M@7:6P8(AC^_X/$(`^V!=I;!@B%P'0'@_@(=`3K->LS M@\3\:@2-1?A0@\3TC46`4.AUZ/[_@\00B<"-4`%2C46`4&H":CUHN]H%".@: MYO[_@\0@QT7X!````(M5^(G0Z9H$``#'1=0!````@\3\BT7H@\`H4(M%Z(/` M)%"-1>Q0Z.UH__^#Q!")P(E%^(-]^`!T6P^V!=I;!@B%P'0'@_@(=`OK/.LZ MC;0F`````(/$_&H$C47X4(/$](U%@%#HY^?^_X/$$(G`C5`!4HU%@%!J`FH] M:+O:!0CHC.7^_X/$((M5^(G0Z1,$``"-=@#IHP,``(-]V`!T>X/$_&A8W`4( MH6A#^`AT!.LU MZS.#Q/QJ!(U%^%"#Q/2-18!0Z&7G_O^#Q!")P(U0`5*-18!0:@)J/6B[V@4( MZ`KE_O^#Q"#'1?@$````BU7XB=#IB@,``,=%V`$```"#Q/B+1>B#P"Q0C47L M4.AT4O__@\00B<")1?B#??@`=%(/M@7:6P8(A;^_X/$$(G`C5`!4HU%@%!J`FH]:+O:!0CHBN3^_X/$ M((M5^(G0Z1$#``"0Z:,"``"#?=P`='N#Q/QH6-P%"*%H7`8(4&HB:@%H(-L% M"&H`:@3HT>;^_X/$(`^V!=I;!@B%P'0'@_@(=`3K->LS@\3\:@2-1?A0@\3T MC46`4.AEYO[_@\00B<"-4`%2C46`4&H":CUHN]H%".@*Y/[_@\0@QT7X!``` M`(M5^(G0Z8H"``#'1=P!````@\3\BT7H@\`T4(M%Z(/`,%"-1>Q0Z-UF__^# MQ!")P(E%^(-]^`!T6P^V!=I;!@B%P'0'@_@(=`OK/.LZC;0F`````(/$_&H$ MC47X4(/$](U%@%#HU^7^_X/$$(G`C5`!4HU%@%!J`FH]:+O:!0CH?./^_X/$ M((M5^(G0Z0,"``"-=@#IDP$``(-]X`!T>X/$_&A8W`4(H6A#^`AT!.LUZS.#Q/QJ!(U%^%"# MQ/2-18!0Z%7E_O^#Q!")P(U0`5*-18!0:@)J/6B[V@4(Z/KB_O^#Q"#'1?@$ M````BU7XB=#I>@$``,=%X`$```"#Q/R+1>B#P#Q0BT7H@\`X4(U%[%#HS67_ M_X/$$(G`B47X@WWX`'1;#[8%VEL&"(7`=`>#^`AT"^L\ZSJ-M"8`````@\3\ M:@2-1?A0@\3TC46`4.C'Y/[_@\00B<"-4`%2C46`4&H":CUHN]H%".ALXO[_ M@\0@BU7XB=#I\P```(UV`.F#````QT7T`````(/$^(U%]%"-1>Q0Z-A/__^# MQ!")P(E%^(-]^`!T5@^V!=I;!@B%P'0+@_@(=`CK.8UT)@#K,X/$_&H$C47X M4(/$](U%@%#H1>3^_X/$$(G`C5`!4HU%@%!J`FH]:+O:!0CHZN'^_X/$((M5 M^(G0ZW2-="8`BT7T`47LZP#II?/__XUV`,=%^``````/M@7:6P8(A6#[!C'1?0$````@WWT!'0=:#G=!0AJ1VA@W04(:,#=!0CH@^+^_X/$ M$.L"B?:#Q/2-1?Q0Z(#C_O^#Q!"+1?10:)A;!@AHV%L&"&@0W@4(Z(7D_O^# MQ!")P(E%^(/$](M%_%#HL>3^_X/$$(/$]&AL7P8(Z)'B_O^#Q!"+5?B)T.L` MR<.058GE@>RH)0``QT7\`````*`5W@4(B(6<[___C86=[___@\3\:/X/``!J M`%#H,^3^_X/$$*`5W@4(B(6%C-___P$```#'A9C?__\`````@\3X:"#>!0BA@%\&"%#H%>'^_X/$$(G` MA<`/A&,"``"#Q/2A@%\&"%#H>N+^_X/$$(G`C5`!@?K_#P``=GZ#Q/QH_P\` M`*&`7P8(4(V%G.___U#H(./^_X/$$(/$_&C_#P``H8!?!@A0C86!0CH<^#^_X/$$(G`HX!?!@B#/8!?!@@`=!3'A9C?__\! M````Z=P!``#K$XUV`,=%_`8```#IRP$``(UT)@"#Q/QH_@\``*&`7P8(4(V% MG-___U#H0N/^_X/$$(/$_&C^#P``H8!?!@A0C86<[___4.@EX_[_@\00@\3X MC46<4*&`7P8(4.AT%0``@\00B<"%P'P^BT6L)0#P```]`$```'4O@\3T:"#> M!0CHR]_^_X/$$(G`HX!?!@B#/8!?!@@`=`_'A9C?__\!````Z30!``"#Q/QH M_@\``*&`7P8(4(V%G.___U#HK^+^_X/$$(/$^&HOC86<[___4.@+XO[_@\00 MB<")A8C?__^#O8C?__\`=3V#Q/1H(-X%".A:W_[_@\00B<"C@%\&"(,]@%\& M"`!T$<>%F-___P$```#IPP```.L,QT7\!@```.FU````BX6(W___Q@``@\3X MC46<4(V%G.___U#HDA0``(/$$(G`A_O^#Q!")P*.` M7P8(@SV`7P8(`'0.QX68W___`0```.MDZPO'1?P&````ZUF)]NM.BT6L)0#P M```]`$```'4$ZT3K.X/$]&@@W@4(Z*K>_O^#Q!")P*.`7P8(@SV`7P8(`'0. MQX68W___`0```.L6ZPW'1?P&````ZPN-="8`ZP7IG?W__X-]_`9U,VBD```` M:&#=!0BA\%L&"%!J!&H!:$+>!0AJ`&H&Z#W@_O^#Q""+5?R)T.E$!@``C70F M`(/$]&H_Z++>_O^#Q!"#Q/AH(-X%"*&`7P8(4.A,WO[_@\00B<"%P'4J@\3X M:,`!``!H3-X%".CY#```@\00@\3X:,`!``!H8=X%".CD#```@\00@\3T:G_H M7][^_X/$$.CK^___@SUH7P8(`'4%Z50!``"#/61?!@@`=!:!/61?!@C_#P`` M?PK'!61?!@@`$```@\3TH8!?!@A0Z)S?_O^#Q!")P(E%_(-]_`!T18/$](U% M^%#H4M_^_X/$$(/$^(U%]%"+1?A0Z"_=_O^#Q!"#Q/2+1?10Z%#>_O^#Q!"# MQ/2+1?A0Z&'?_O^#Q!#IU````(,]9%\&"`!T7(/$]*%D7P8(4.@2W?[_@\00 MB<")1?R#??P`=$"#Q/2-1?A0Z.C>_O^#Q!"#Q/B-1?10BT7X4.C%W/[_@\00 M@\3TBT7T4.CFW?[_@\00@\3TBT7X4.CWWO[_@\00@SU\7P8(`'1?@\3TH7Q? M!@A0Z)W=_O^#Q!")P(E%_(-]_`!T0X/$](U%^%#H@][^_X/$$(/$^(U%]%"+ M1?A0Z&#<_O^#Q!"#Q/2+1?10Z('=_O^#Q!"#Q/2+1?A0Z)+>_O^#Q!#K")#K M!>F>_O__#[8%VUL&"(/X!P^'WP,``(L$A8C>!0C_X.G1`P``QX6(W___`0`` M`*`5W@4(B(6$WO__C86%WO__@\3\:``!``!J`%#H+-_^_X/$$,>%@-[__P`` M``"#Q/2-A8#>__]0Z$#=_O^#Q!"#Q/2-A83>__]0Z![<_O^#Q!")P(7`=!># MQ/AH?=X%"(V%A-[__U#H8=_^_X/$$(/$]&H$C86`WO__4(/$](V%A-[__U#H M<]W^_X/$$(G`C5`!4HV%A-[__U!J!(V%B-___U!J`VH$:!#>!0CH#-O^_X/$ M,.D.`P``QX6(W___`@```*`5W@4(B(5\W?__C85]W?__@\3\:``!``!J`%#H M:=[^_X/$$,>%>-W__P````"#Q/2-A7C=__]0Z'W<_O^#Q!"#Q/2-A7S=__]0 MZ%O;_O^#Q!")P(7`=!>#Q/AH?=X%"(V%?-W__U#HGM[^_X/$$(/$]&H$C85X MW?__4(/$](V%?-W__U#HL-S^_X/$$(G`C5`!4HV%?-W__U!J!(V%B-___U!J M`VH$:!#>!0CH2=K^_X/$,.E+`@``D(UT)@#'A8C?__\#````H!7>!0B(A73< M__^-A77<__^#Q/QH``$``&H`4.BAW?[_@\00QX5PW/__`````(/$](V%<-S_ M_U#HM=O^_X/$$(/$](V%=-S__U#HD]K^_X/$$(G`A!0B(A6S;__^-A6W;__^#Q/QH``$``&H`4.C>W/[_@\00QX5H MV___`````(/$](V%:-O__U#H\MK^_X/$$(/$](V%;-O__U#HT-G^_X/$$(G` MA!0B(A63:__^-A67:__^#Q/QH``$` M`&H`4.@;W/[_@\00QX5@VO__`````(/$](V%8-K__U#H+]K^_X/$$(/$](V% M9-K__U#H#=G^_X/$$(G`AG9`@``C70F`(M%"(,X`'0(@WT,`'4RZP"#Q/QH MJ]\%"*'X6P8(4&H&:@%H.=\%"&H`:@3H#-;^_X/$(,=%]`0```#IE@(``)"+ M10B#."-W+X/$_&BKWP4(H1!`@``@\3\:BAJ`(M%#%#HQ=;^_X/$$(M%"(M0!(E5_(/$_&H$BT7\ M4(U%^%#H)];^_X/$$(/$](M%^%#H.-/^_X/$$(G`B<*+10R)$(-%_`2#Q/QJ M!(M%_%"-1?A0Z/;5_O^#Q!"#Q/2+1?A0Z`?3_O^#Q!")P(G"BT4,B5`$@T7\ M!(/$_&H$BT7\4(U%^%#HQ-7^_X/$$(/$](M%^%#HU=+^_X/$$(G`B<*+10R) M4`B#1?P$@\3\:@2+1?Q0C47X4.B2U?[_@\00@\3TBT7X4.BCTO[_@\00B<") MPHM%#(E0#(-%_`2#Q/QJ!(M%_%"-1?A0Z_O^#Q!"#Q/2+1?A0Z''2_O^# MQ!")P(G"BT4,B5`0@T7\!(/$_&H$BT7\4(U%^%#H+M7^_X/$$(/$](M%^%#H M/]+^_X/$$(G`B<*+10R)4!2#1?P$@\3\:@2+1?Q0C47X4.C\U/[_@\00@\3T MBT7X4.@-TO[_@\00B<")PHM%#(E0&(-%_`2#Q/QJ!(M%_%"-1?A0Z,K4_O^# MQ!"#Q/2+1?A0Z-O1_O^#Q!")P(G"BT4,B5`<@T7\!(/$_&H$BT7\4(U%^%#H MF-3^_X/$$(/$](M%^%#HJ='^_X/$$(G`B<*+10R)4""#1?P$BT4,@W@@`'1P M@\3TBT4,BU`@4N@@T_[_@\00B<")PHM%#(G2B5`DA=)U,6C/````:&#?!0BA M\%L&"%!J!&H!:#G?!0AJ`&H&Z)O3_O^#Q"#'1?0&````ZRCK'I"#Q/R+10R+ M4"!2BT7\4(M%#(M0)%+H`M3^_X/$$.L&D.D<_?__BU7TB=#K!(UT)@#)PXGV M58GE@^P(@WT(`'12BT4(@W@@`'0VBT4(@W@D`'0M@\3\BT4(BU`@4FH`BT4( MBU`D4N@RU/[_@\00@\3TBT4(BU`D4NC@T_[_@\00@\3\:BAJ`(M%"%#H#=3^ M_X/$$,G#58GE@^P8QT7\`````(/$^(M%#%"+10A0Z'O0_O^#Q!")P(7`?3;H MW='^_XG`B<*+`E"+10A0H3!BJTO[_@\0@QT7\ M:0```.M9B?:#Q/B+10Q0BT4(4.BLT?[_@\00B<"%P'TWZ([1_O^)P(G"BP)0 MBT4(4*$H7`8(4&H2:@%H.=\%"&H`:FGH6]+^_X/$(,=%_&D```#K"HUV`.L% MZ5K___^+5?R)T.L"B?;)PXGV58GE@^QHQT7\`````,=%H/\!``"#Q/B-1:10 M:,+?!0CHIP4``(/$$(G`ABUT/[_B<")PHL"4&C"WP4(H2A< M!@A0:A)J`6@YWP4(:@!J:>B!T?[_@\0@QT7\:0```.L.ZPR-M"8`````Z4/_ M__^#??P!=`7IYP```(/$^(U%I%!HWM\%".C?!```@\00B<"%P'P6BT6T)0#P M```]`$```'4'ZS60C70F`(/$^*$T7`8(4&H5:@%H.=\%"&H`:FGH$='^_X/$ M(,=%_&D```#IC0```(VV`````(/$^(U%I%!H[=\%".A_!```@\00B<")1?R# M??P`?!&+1;0E`/```#T`0```=0+K-X-]_`!U$(/$]&CMWP4(Z%G/_O^#Q!"# MQ/B+1:!0:.W?!0CHK?W__X/$$(G`B47\@WW\`'0"ZR"#Q/B+1:!0:,+?!0CH MC/W__X/$$(G`B47\ZP7I#O___X-]_`!T`^MSD(/$^(U%I%!H`N`%".CO`P`` M@\00B<")1?R#??P`?!&+1;0E`/```#T`0```=0+K-X-]_`!U$(/$]&@"X`4( MZ,G._O^#Q!"#Q/B+1:!0:`+@!0CH'?W__X/$$(G`B47\@WW\`'0"ZPOK"8VT M)@````#KA8M5_(G0ZP>-M"8`````R<.)]E6)Y8/L:,=%_`````#'1:#H`0`` M@\3XC46D4&@>X`4(Z%<#``"#Q!")P(7`?0['1?P!````Z9(```")]HM%M"4` M\```/0!```!T&8/$]&@>X`4(Z##._O^#Q!#'1?P!````ZVB+1:`[1;1T5(/$ M^(M%H%!H'N`%".B+SO[_@\00B<")1?R#??P`=#7H:,[^_XG`B<*+`E!H'N`% M"*$H7`8(4&H2:@%H.=\%"&H`:FGH-,_^_X/$(,=%_&D```#K#.L*Z4W___^0 MC70F`(-]_`%T`NM]@\3XC46D4&@SX`4(Z)<"``"#Q!")P(7`?!&+1;0E`/`` M`#T`0```=0+K+8/$^*$T7`8(4&H5:@%H.=\%"&H`:FGHSL[^_X/$(,=%_&D` M``#K*XVV`````(/$^(M%H%!H'N`%".BS^___@\00B<")1?SK"I"-="8`Z7O_ M__^#??P`=4>#Q/1H'N`%".@TSO[_@\00B<"%P'TQ@\3\Z(/-_O^)P(G"BP)0 MH4!A4SO[_@\0@QT7\:0```(M5_(G0ZP>-M"8` M````R<.)]E6)Y8/L&`^V!=I;!@B#^`%T'(/X`7\&AMA@_@$=`R#^`AT M!^M5C78`ZU"A0N`%"(L51N`%"(E%^(E5_.CTR_[_B<")1?2#Q/QJ!(U%]%"# MQ/2-1?A0Z)K-_O^#Q!")P(U0`5*-1?A0:@)J`FA)X`4(Z#_+_O^#Q"#K`.L` MR<.)]E6)Y8/L&)#'1?@`````@\3TBT4(4.A:S?[_@\00B<"-4/^)5?2-=@"+ M1?@[1?1\".L]C;8`````BT4(BU7X`=`/MA")5?R+10B+5?@!T(M5"(M-]`'* MB@J("(M%"(M5]`'0BE7\B!#_1?C_3?3KN$"`=F-'`F+5?`IVHC1@,$PBT7TB`C_1?R+50B)5?2Y M9V9F9HM%]/?IB='!^0*+5?3!^A^)R"G0B<*)50B%TG\"ZPCKC8VV`````(-] M^`!]#HM%#(M5_`'0Q@`M_T7\BT4,BU7\`=#&``"#Q/2+10Q0Z,W^__^#Q!"+ M7=C)PXVV`````(V\)P````!5B>534N@`````6X'#VI<``%#_=0S_=0AJ`^B] MR_[_@\00BUW\R<.0D)"0D)"0D)!5H41=!@B)Y5.#[`2#^/^[1%T&"'06C78` MC;PG`````(/K!/_0BP.#^/]U]%A;7<-5B>6#[`B)[%W#C;8`````58GE4U+H M`````%N!PVJ7``"-=@#HU\W^_XM=_,G#```#`````0`"```````````````` M`````````````````$`H(RDU-R`@(#$N,2`@('-R8R]RM00(Y;0$ M"-"U!`C2M00(TK4$"`NV!`C2M00("[8$"`NV!`@+M@0(TK4$"&"V!`ABM@0( M8K8$")NV!`ABM@0(F[8$")NV!`B;M@0(8K8$"&:W!`AHMP0(:+<$"*&W!`AH MMP0(H;<$"*&W!`BAMP0(:+<$"&"X!`ABN`0(8K@$")NX!`ABN`0(F[@$")NX M!`B;N`0(8K@$"/"X!`CRN`0(\K@$""NY!`CRN`0(*[D$""NY!`@KN00(\K@$ M"```````````````````````````0"@C*3`Q(#$N."`@("`@_!`B4OP0(8V%S7U]C;&]S95]U=&8X7VAD M;',`8V%S7U]S971U<%]U=&8X7VAD;',```!@P@0(8L($"&+"!`B>P@0(8L($ M")["!`B>P@0(GL($"&+"!`A0PP0(4L,$"%+#!`B.PP0(4L,$"([#!`B.PP0( MCL,$"%+#!`AC87-?7V-O;G9?!`A5W@0((MX$"%7>!`A5W@0(5=X$""+>!`@`WP0(`M\$"`+? M!`@UWP0(`M\$"#7?!`@UWP0(-=\$"`+?!`AC87-?7W5N96YC;V1E7S,R9FQT M`-#@!`C2X`0(TN`$"`7A!`C2X`0(!>$$"`7A!`@%X00(TN`$"+#A!`BRX00( MLN$$".7A!`BRX00(Y>$$".7A!`CEX00(LN$$"&-A,$"(+C!`BUXP0(M>,$"+7C!`B"XP0(8.0$"&+D M!`ABY`0(E>0$"&+D!`B5Y`0(E>0$")7D!`ABY`0(0.4$"$+E!`A"Y00(=>4$ M"$+E!`AUY00(=>4$"'7E!`A"Y00(8V%S7U]U;F5N8V]D95\V-&9L=`!`YP0( M0N<$"$+G!`AUYP0(0N<$"'7G!`AUYP0(=><$"$+G!`@@Z`0((N@$""+H!`A5 MZ`0((N@$"%7H!`A5Z`0(5>@$""+H!`@`Z00(`ND$"`+I!`@UZ00(`ND$"#7I M!`@UZ00(->D$"`+I!`AC87-?7V5N8V]D95]S=')I;F<```/K!`@%ZP0(!>L$ M"#CK!`@%ZP0(..L$"#CK!`@XZP0(!>L$".#K!`CBZP0(XNL$"!7L!`CBZP0( M%>P$"!7L!`@5[`0(XNL$"&-AX$",CN!`B5[@0(R.X$",CN!`C([@0(E>X$"'#O!`AR[P0(\$"*7O!`BE[P0(71E004(I4$%"-Y! M!0C>004(WD$%"*5!!0@Q0P4(,T,%"#-#!0AL0P4(,T,%"&Q#!0AL0P4(;$,% M"#-#!0C%104(QT4%",=%!0@`1@4(QT4%"`!&!0@`1@4(`$8%",=%!0C(2`4( MT$@%"-!(!0@)204(T$@%"`E)!0@)204("4D%"-!(!0AC87-?7V5N8V]D95]S M96-K97D``(!*!0B"2@4(@DH%"+5*!0B"2@4(M4H%"+5*!0BU2@4(@DH%"&!+ M!0AB2P4(8DL%")5+!0AB2P4(E4L%")5+!0B52P4(8DL%"&!,!0AB3`4(8DP% M")5,!0AB3`4(E4P%")5,!0B53`4(8DP%"&-A0!H8F%?;6%R0```$9]!0A5?@4(97\%"'6` M!0B%@04(E8(%",B#!0C5A`4(Y84%".6%!0CEA04(Y84%".6%!0CEA04(,'T% M"&AB85]M87)S:&%L7V-R961S`&AB85]U;FUA&ES=',@86YD(&ES(&$@=F%L:60*"7!R;V=R86T@;W(@=&AA="!S>7-T M96T@&5C=71E"@ET:&4@+W5S7!E(&]F(&ME M>2!U7!T:6]N("@E,B1D*2X*"51H:7,@8V]N9&ET:6]N M(&UA>2!H87!P96X@=VAE;B!T:&4@8VQI96YT(&%N9"!S97)V97(@:&]S=',@ M:&%V92!D:69F97)N="!T>7!E7,N"@E0;&5A7!E(&]F(&AO7,N"@`````R-C4Q+3$S,B!% M;G9I2!F;W(@=&AE(&AO7-T96T@8V%L;"!T;R!R971R:65V92!T:&4@;&]C86P@:&]S M=&YA;64@9F%I;&5D+@`R-C4Q+3$R-R!5;FEX($ED96YT:71Y(&UI3H*"24Q M)',*5&AI2!F M:6QE('-Y7-T96T@8V%N('-U<'!O7-T96T@861M:6YI0IN86UE(&ES('-P96-I9FEE9"!A;F0@ M8V]N7-T96T@861M:6YI2!E>'1E;F1I;F<*:&4@7-T96T@8V]N=&%I;FEN9R!T:&ES(&1I2X*```````` M,C8U,2TQ,C0@8W1C87-D($1A96UO;B!&86EL=7)E.B!4:&4@9&%E;6]N('=A M2!H M879E(&)E96X@;6]D:69I960@=&\@9F]R8FED"F%C8V5S2!T M:&%T('1H92!D:7)E8W1O7-T96US('=I=&AI;@IT:&4@8VQU2!T:&%T('1H92!T2!F:6QE2!B87-E9"!K97ES(&%R92!I;B!U7,@8V%N(&)E(')E M8W)E871E9"!U6=E;B<@8V]M;6%N9"X@($EF('-E M8W5R960@7,@87)E(&EN('5S92P@8V]N7,N("!3>7-T96T@861M:6YI2!O0IF:6QE(&]N('1H M92!L;V-A;"!S>7-T96TL(&)U="!W87,@=6YA8FQE('1O(&QO8V%T92!T:&4@ M87-S;V-I871E9"!P=6)L:6,@:V5Y"F9I;&4@;VX@=&AE(&QO8V%L('-Y2!F:6QE2!B87-E9"!K97ES(&%R92!I;B!U7,@8V%N(&)E(')E8W)E871E9"!U6=E;B<@ M8V]M;6%N9"X@($EF('-E8W5R960@7,@87)E(&EN M('5S92P@8V]N7,N("!3>7-T96T@861M:6YI2!O2!G96YE`I297!A:7(@=&AE(&-T M8V%S9"!D865M;VX@8V]N9FEG=7)A=&EO;B!I;F9O2!G96YE"4S M)'@*0V]N=&%C="!T:&4@8VQU7-T96T*=&\@;W1H97(@2!R97-I9&4@:6X@82!R96%D M+6]N;'D@9FEL92!S>7-T96TL(&]N92!O9B!T:&4@8V]M<&]N96YT"F1I2!B92!M:7-S:6YG+"!T:&4@ M9&ER96-T;W)Y(&YA;64@;6%Y(&-O;G1A:6X*;6]R92!S>6UB;VQI8R!L:6YK M2!N;W0@7-T96T@861M:6YI2!T:&%T('1H92!A8F]V92!D:7)E8W1O2!F:6QE('1O M(&)E('5S960@9F]R(&AO3H*"24Q)',*5&AI2!F:6QE('-Y7-T96T@8V%N('-U M<'!O7-T96T@861M:6YI0IN86UE M(&ES('-P96-I9FEE9"!A;F0@8V]N7-T96US(&EN('1H M92!C;'5S=&5R+B`@5&AE(&1A96UO;B!A='1E;7!T960@=&\@8W)E871E('1H M92!I;FET:6%L"G!U8FQI8R!K97D@9FEL92!I;B!T:&4@9F]L;&]W:6YG(&1I M3H*"24Q)',*5&AE(&9I;&4@7-T96T@861M:6YI7-T96T*=&\@;W1H97(@2!F:6QE(&EN('1H92!F;VQL;W=I M;F<@9&ER96-T;W)Y.@H))3$D7-T96T@8V]N=&%I;FEN M9R!T:&ES(&1I2!D;V5S(&YO="!H879E('-U9F9I8VEE;G0@7-T96T@861M:6YI7-T96US M(&EN('1H92!C;'5S=&5R+B`@5&AE(&1A96UO;B!A='1E;7!T960@=&\@8W)E M871E('1H92!I;FET:6%L"G!U8FQI8R!K97D@9FEL92!I;B!T:&4@9F]L;&]W M:6YG(&1I3H*"24Q)',*02!C;VUP;VYE;G0@9&ER96-T;W)Y(&EN M('1H92!A8F]V92!P871H(&YA;64@;6%Y(&)E(&UI2!H879E(&)E96X@;6]D:69I960@=&\@9F]R8FED"F%C8V5S2!T:&%T('1H92!D:7)E8W1O7-T96US(&EN('1H92!C M;'5S=&5R+B`@5&AE(&1A96UO;B!A='1E;7!T960@=&\@8W)E871E('1H92!I M;FET:6%L"G!R:79A=&4@:V5Y(&9I;&4@:6X@=&AE(&9O;&QO=VEN9R!D:7)E M8W1O2!I;B!T:&4@86)O M=F4@<&%T:"!N86UE(&UA>2!B92!M:7-S:6YG+"!O&ES=',L(&%N9"!T:&%T M('1H90IP97)M:7-S:6]N2!P97)M:70@<')O M8V5S2!A;F0@8W)E871E(&9I;&5S('=I=&AI;B!T:&4@9&ER96-T M;W)Y+B`@268@=&AI2!R97-O=7)C97,N("!4 M:&ES(&UA>2!I;F1I8V%T92!T:&%T('1H90IO<&5R871I;F<@2!B92!M:7-S:6YG+"!T:&4@<&5R;6ES2!H879E"F)E96X@;6]D:69I960@=&\@9F]R8FED(&%N>2!P2!N86UE(&UA>2!H879E(&)E96X@;6]D:69I960@=&\@9F]R M8FED(&%C8V5S2!T:&%T"G1H92!P=6)L:6,@86YD('!R:79A M=&4@:V5Y(&9I;&5S(&5X:7-T+"!A;F0@=&AA="!T:&4@<&5R;6ES2!D971E8W1E9"!A(')E<&5A=&5D(&1A M=&$@9FEE;&0@=VET:&EN('1H90IM87)S:&%L960@9&%T82X@($ET(&ES('!O M2!O=F5R=W)I='1E;B!T:&4@;65M;W)Y('5S960@=&\@ M2!L96%K(&%N9"!M96UO6EN9R!T:&ES(&UE;6]R M>2X*```````````````R-C4Q+3$P."!L:6)C=%]C87,@1F%I;'5R93H@5&AE M(&UA2!L M:6)R87)Y(&1E=&5C=&5D(&UO2!T M:&%T('1H92!A<'!L:6-A=&EO;B!I2!U2!L:6)R87)Y(&ES('5N86)L92!T M;PIT&5C=71I;VX*96YV:7)O;FUE;G0N("!4:&ES(&9A:6QU&5C=71I;VX@96YV M:7)O;FUE;G0@2!O M=F5R=W)I=&EN9R!T:&4@8VAA2!I2!T;R!C;VYV97)T(&)E='=E96X@=&AE(&-O9&5S970@ M=7-E9`IB>2!T:&ES(&%P<&QI8V%T:6]N(&%N9"!T:&4@551&+3@@9&%T82!E M;F-O9&EN9R!F;W)M870N("!4:&ES(&9A:6QU2!T:&4@8VQU2!O=F5R=W)I='1E;B!T:&4@;65M;W)Y('5S960*=&\@2!L M96%K"F%N9"!M96UO2!O=F5R=W)I='1E;B!T:&4@=F%R M:6%B;&4@8V]N=&%I;FEN9R!T:&4@861D2!H879E(&EN861V97)T96YT;'D@;W9E2!U2!M;V1I9GEI;F<@=&AIF4@86QL(&%V86EL86)L92!M96UO2!T:&%T('1H92!A;&QO8V%T:6]N(&ET&-E961I;F<@:71S(&UE M;6]R>2!A;&QO8V%T:6]N"FQI;6ET2!P2!A;F0@8V]N"4S)'@*268@=&AI M2!T:&%T M('1H92!S;V9T=V%R92!I2X*```````````````````````````````````````R-C4Q+3`R-"!4:&4@ M2!T;R`O=F%R+V-T+TE7+W)U;B]C=&-A2X*````````````````,C8U,2TP,C$@5&AE('-E"4Q)#`X M>"!N;W0@2!F;W(@!0AB,P8(0#,&",`R!@B`,@8(0#(&"``R!@C`,08(@#$&""`Q!@C@ M,`8(@#`&"$`P!@C@+P8(H"\&"&`O!@@@+P8(P"X&"&`N!@C@+08(H"T&"$`M M!@@`+08(H"P&"$`L!@C@*P8(H"L&".`I!@A@)@8(("0&"*`A!@C@(`8(8!\& M"(`(%",#B!0@`X@4(P.$%""#A M!0C@X`4(H.`%"&#@!0@```````````````!"860@;65S"`W+C$@,BXY-BTX M,2D``$=#0SH@*$=.52D@,BXY-2XS(#(P,#$P,S$U("AR96QE87-E*0``1T-# M.B`H1TY5*2`R+CDU+C,@,C`P,3`S,34@*')E;&5A6#[`CHW0```)#H6#[`B+%8R7!`B%TG5)BQ6(EP0(BP*%P'0:C70F M`(U"!*.(EP0(_Q*+%8B7!`B+"H7)=>JXU(,$"(7`=!"#[`QHD)<$".CH_O__ M@\00N`$```"CC)<$"(GL7<.-=@!5B>6#[`B)[%W#C;8`````5;BT@P0(B>6# M[`B%P'05@^P(:*"8!`AHD)<$".B#_O__@\00B>Q=PY"-M"8`````58GE@^P( MB>Q=PXVV`````%6)Y8'L&`$``(/L!&@``0``:@"-A?C^__]0Z,7^__^#Q!#' MA?3^__\`````@^P(:``!``"-A?C^__]0Z(3^__^#Q!"`O?C^__\`=&R#[`R- MA?C^__]0Z'G^__^#Q!")P(F%]/[__X.]]/[__P!T(8/L"(N%]/[___\P:,"& M!`CH(/[__X/$$+@`````ZU")]H/L"(/L".C9_?__@\0(B<")P/\P:`"'!`CH M]OW__X/$$+@"````ZR:#[`B#[`CHL?W__X/$"(G`B<#_,&A`AP0(Z,[]__^# MQ!"X`0```,G#58GE4X/L!*&4EP0(NY27!`B#^/]T%HUV`(V\)P````"#ZP3_ MT(L#@_C_=?186UW#58GE@^P(B>Q=PXVV`````%6)Y5-2Z`````!;@<,J$0`` MC78`Z!?^__^+7?S)PP````````````````````````,````!``(````````` M````````````````````````4E-#5"!#=%-E8R!N86UE(&9O"`W M+C$@,BXY-BTY-RD``$=#0SH@*$=.52D@,BXY-B`R,#`P,#"`W+C$@,BXY-BTY M."D``$=#0SH@*$=.52D@,BXY-B`R,#`P,#"`W M+C$@,BXY-BTY-RD`"``````````!````,#$N,#$````(``````````$````P M,2XP,0````@``````````0```#`Q+C`Q````"``````````!````,#$N,#$` M```(``````````$````P,2XP,0````@``````````0```#`Q+C`Q`````"YS M>6UT86(`+G-T6YS>6T`+F1Y;G-T<@`N9VYU+G9E6X`+G)E;"YP;'0`+FEN:70`+G!L=``N=&5X=``N9FEN M:0`NP````$````&````I(,$"*0# M``"@```````````````$````!````(`````!````!@```%"$!`A0!```(`(` M````````````$`````````"&`````0````8```!PA@0(<`8``!X````````` M``````0`````````C`````$````"````H(8$"*`&``#@```````````````@ M`````````)0````!`````P```("7!`B`!P``$```````````````!``````` M``":`````0````,```"0EP0(D`<```0```````````````0`````````I``` M``$````#````E)<$")0'```(```````````````$`````````*L````!```` M`P```)R7!`B````````````````0`````` J```1`````P``````````````7`H``-H```````````````$````````` ` end begin 755 getRemoteHostName.mcplinux M?T5,1@$!`0````````````(``P`!````X(,$"#0```!P"@```````#0`(``& M`"@`&@`9``8````T````-(`$"#2`!`C`````P`````4````$`````P```/0` M``#T@`0(](`$"!,````3````!`````$````!``````````"`!`@`@`0(P`8` M`,`&```%`````!````$```#`!@``P)8$","6!`@8`0``,`$```8`````$``` M`@```!`'```0EP0($)<$",@```#(````!@````0````$````"`$```B!!`@( M@00((````"`````$````!````"]L:6(O;&0M;&EN=7@N&%?9FEN86QI>F4`7U]D97)E9VES=&5R7V9R86UE7VEN M9F\`9V5T:&]S=&)Y;F%M90!?7V5R````$````!!I:0T```(`J@`````````, MEP0(!@D``/"6!`@'`0``])8$"`<"``#XE@0(!P,``/R6!`@'!````)<$"`<% M```$EP0(!P8```B7!`@'!P``58GE@^P(Z+T```"0Z%,!``#H/@(``,G#_S7H ME@0(_R7LE@0(`````/\E\)8$"&@`````Z>#_____)?26!`AH"````.G0____ M_R7XE@0(:!````#IP/____\E_)8$"&@8````Z;#_____)0"7!`AH(````.F@ M_____R4$EP0(:"@```#ID/____\E")<$"&@P````Z8#___\````````````` M```Q[5Z)X8/D\%!44FC0A00(:#R#!`A15FC@A`0(Z)/____TB?95B>534.@` M````6X'#UA(``(N#*````(7`=`+_T(M=_,G#B?:0D)"0D)"0D%6)Y8/L"(L5 MS)8$"(72=4F+%Q=PXUV`%6) MY8/L"(GL7<.-M@````!5N&2#!`B)Y8/L"(7`=!6#[`AHV)<$"&C0E@0(Z*/^ M__^#Q!")[%W#D(VT)@````!5B>6#[`B)[%W#C;8`````58GE@^P(@WT(`G0< M@^P(BT4,_S!H((8$".BF_O__@\00N`$```#K>L=%_`````"#[`R+10R#P`3_ M,.BE_O__@\00B<")1?R#??P`=">#[`2+1?S_,(M%#(/`!/\P:$"&!`CH7?[_ M_X/$$+@`````ZS&-=@"#[`2#[`SH%?[__X/$#(G`B<#_,(M%#(/`!/\P:("& M!`CH*O[__X/$$+@"````R<.0D)"0D)"0D)"0D)!5B>53@^P$H=26!`B[U)8$ M"(/X_W06C78`C;PG`````(/K!/_0BP.#^/]U]%A;7<-5B>6#[`B)[%W#C;8` M````58GE4U+H`````%N!PPH1``"-=@#H1_[__XM=_,G#```````````````` M`````````P````$``@````````````````````````````````!56YS M='(`+F=N=2YV97)S:6]N`"YG;G4N=F5R'0`+F9I;FD`+G)O9&%T80`N9&%T80`N96A? M9G)A;64`+F-T;W)S`"YD=&]R6YA;6EC`"YS8G-S`"YB```````````````$`````````(P````!```` M`@````"&!`@`!@``P```````````````(`````````"4`````0````,```#` ME@0(P`8``!````````````````0`````````F@````$````#````T)8$"-`& M```$```````````````$`````````*0````!`````P```-26!`C4!@``"``` M````````````!`````````"K`````0````,```#`````3P!0@`````$0`/`&,# M```XE`0(WP8``!(```"Q`@``2)0$"(X````2````"0,``%B4!`@5`0``(@`` M`#H```!HE`0(<0```!(```"J`P``:`P&"`0````A`!8`N`(``'B4!`@[```` M$@```(4```#PD@0(`````!(`"@#C`P``$`@&"`0````1``\`C0(``(B4!`A% M`@``$@````(!``"8E`0(=````!(```#R`P``I`P&"`0````1`!8`9@(``&P, M!@@$````$0`6`/T#````"08()`$``!$`#P#-`0``J)0$"+`````2````;0,` M`+B4!`@V`0``$@```$0!``#(E`0(5`0``!(````5`@``V)0$"),````2```` M+0```.B4!`@U`0``$@```#$!``#XE`0(XP$``!(```!'`P``")4$"$P````2 M````BP```!B5!`B)4$"-8````2````-@,``(B5!`AI`@``$@```.H"``"8E00(J@$``!(```"H M`P``:`P&"`0````1`!8`)`(``*B5!`@T`P``$@```),```#(<@4(`````!(` M#0"9````N)4$"$(````2````A@(``,B5!`A&````$@```*D#``!H#`8(!``` M`"$`%@"^`@``V)4$"+D!```2````WP$``.B5!`A-`0``$@```#X#``#XE00( M5P```!(````K!```3&$%"%H````2``P`D@$```B6!`A[````$@```+(#``!H M#`8(`````!``\?^A````/`L&"``````1`/'_HP,``!B6!`C5````$@```,4# M``"L#`8(`````!``\?\>````*)8$"&L````2````@0$``#B6!`AV`@``$@`` M`$X#``!(E@0(5````!(````6````6)8$"&0````2````)P,``&B6!`B-```` M$@````,"``!XE@0(00$``!(```"4`@``<`P&"`0````1`!8`=0,```1S!0@$ M````$0`.`$4$```@"`8(!````!$`#P!>!```J`P&"`0````1`!8`$0```(B6 M!`AK````$@```*X!``"8E@0(*````!(```";`@``J)8$"#H````2````:`0` M``P(!@@$````$0`/`$L``````````````"````!C`0``N)8$"#,````2```` MMP``````````````(````%\"``#(E@0(,````!(`````;&EB<'1H0L```8`A`0``!`` M```0:6D-```"`'H$````````.`P&"`8%```\#`8(!@H``$`,!@@&$0``1`P& M"`8?``!(#`8(!B(``$P,!@@&)```4`P&"`8N``!4#`8(!D```%@,!@@&3@`` M7`P&"`9/``!@#`8(!E,``&0,!@@&5@``:`P&"`4W``!L#`8(!2,``'`,!@@% M3```2`L&"``L&"`<0``!\"P8(!Q(``(`+!@@'$P``A`L&"`<4``"("P8( M!Q4``(P+!@@'%@``D`L&"`<8``"4"P8(!QD``)@+!@@'&@``G`L&"`<;``"@ M"P8(!QT``*0+!@@'(```J`L&"`#_____ M)4P+!@AH"````.G0_____R50"P8(:!````#IP/____\E5`L&"&@8````Z;#_ M____)5@+!@AH(````.F@_____R5<"P8(:"@```#ID/____\E8`L&"&@P```` MZ8#_____)60+!@AH.````.EP_____R5H"P8(:$````#I8/____\E;`L&"&A( M````Z5#_____)7`+!@AH4````.E`_____R5T"P8(:%@```#I,/____\E>`L& M"&A@````Z2#_____)7P+!@AH:````.D0_____R6`"P8(:'````#I`/____\E MA`L&"&AX````Z?#^____)8@+!@AH@````.G@_O___R6,"P8(:(@```#IT/[_ M__\ED`L&"&B0````Z<#^____)90+!@AHF````.FP_O___R68"P8(:*````#I MH/[___\EG`L&"&BH````Z9#^____):`+!@AHL````.F`_O___R6D"P8(:+@` M``#I@+!@AH M0`$``.E@_?___R7L"P8(:$@!``#I4/W___\E\`L&"&A0`0``Z4#]____)?0+ M!@AH6`$``.DP_?___R7X"P8(:&`!``#I(/W___\E_`L&"&AH`0``Z1#]____ M)0`,!@AH<`$``.D`_?___R4$#`8(:'@!``#I\/S___\E"`P&"&B``0``Z>#\ M____)0P,!@AHB`$``.G0_/___R40#`8(:)`!``#IP/S___\E%`P&"&B8`0`` MZ;#\____)1@,!@AHH`$``.F@_/___R4<#`8(:*@!``#ID/S___\E(`P&"&BP M`0``Z8#\____)20,!@AHN`$``.EP_/___R4H#`8(:,`!``#I8/S___\E+`P& M"&C(`0``Z5#\____)3`,!@AHT`$``.E`_/___R4T#`8(:-@!``#I,/S__S'M M7HGA@^3P4%12:,AR!0AH\)($"%%6:,B7!`CH?_[___20D%6)Y5-0Z`````!; M@<,V=`$`BX,H`0``ANX6)0$"(7`=!"#[`QH)`H& M".CQ_/__@\00Q@5T#`8(`#Q!#)PU6)Y5=64X'LW!$``(/D\(/L"&HOBW4,_S;'A3#N__\` M````QX6T[O__`````.C>_?__@\00A<"+?0BCR/,%"`^$M1```$"CR/,%")!0 M_S7$\P4(5E?HYOS__X/$$(/X_XG##X2"````C4.:@_@0=]S_)(5$=`4(46@` M$```_S5P#`8(:.#S!0CH$_[__X/$$.NZ4F@`!```_S5P#`8(:``$!@CKXVH` M:@IJ`/\U<`P&".C*_/__@\00/0``$`"C!`@&"'Z'QP4$"`8(```!`.EX____ M_P7,\P4(Z6W_____!=#S!0CI8O___Z',\P4(A<`/A/D/``#HB,@``(/L#&C@ M\P4(Z*?]__]8_S4$"`8(Z!O[___'!"0`!`8(Z/_\__\/M@4B"`8(@\00A<`/ MA(<```!(#X2=#P``9J'S)V?*N]]%14K\`!`8(B=GR MKO?146@`!`8(:@1H!`@&"+_@\P4(B=GRKO?146C@\P4(:@1J:FCZ[N__]0:@!H_W,%"&@%=`4(9L>%[N[__P`0Z.[[__^#Q""%P(F%M.[__XG# M#X7/#0``#[^%[N[__X/H=KH?A>M1]^*)T,'H!8`](@@&"`&)A>CN__\/AWL- M```QTC'`.YWH[O__QX7<[O__`````'TV@#TB"`8(`0^'RPP``(T$DHT$@(V$ MA>CO__]F@WAV$0^$^@4``$([E>CN__^)E=SN__^)T'S*BXTP[O__@_DI=!2+ MA?#N__^%P`^%+?___XN-,.[__TET30^V!2((!@B%P'0@2'0K@^P,:@2-A3#N M__]0:@%J;&CZ,<#\N1L```"-O6CO___'A3SN__\`````\ZMFJX`](@@&"``/ MA3H%``!0:@!J`6H!QX4P[O__`````.BH^___@\00A<")PP^(VP0``(/L"/R^ M!G0%"(V]:N___[D'````9L>%:.___P$`C85J[___\Z5H(G0%"%#H6_K__X/$ M#&INC8UH[___45.)C63O___H`_O__X/$$(7`#XBL`P``N@H```"-M2CO__\Q MP/R)T8GW\ZN)T8V]^.[___.K@^P(C;UH[O__5XV%^.[__U#'A5#N__\````` MQX54[O__`````,>%:.[__P````#'A6SN__\`````QX7X[O__:7)U<\>%_.[_ M_P$```#HO,T``(/$$(7`B84P[O__#X2X`0``H=#S!0B%P`^%50$``,>%,.[_ M_RD```"#[`Q3Z*?W__^-A5#N__^)!"3H*?G__XD\).@A^?__B30DZ+'0``"# MQ!"+C3#N__^%R0^$W@```(N5/.[__XU"`8'ZQP```(F%/.[__P^.G_[__X7) M=`V`/2((!@@`#X6;````H=#S!0B%P`^$"_[__XN%,.[__X7`=710:/]S!0C_ M-1`*!@AJ1&H!:#AT!0AJ`&HIZ"?Z__^#Q!2-A3CN__]0Z+CX__]>7XV%-.[_ M_U#_M3CN___HY/?__UE;_[4T[O___S5L#`8(Z/'V__]:_[4T[O__Z+7V__]8 M_[4X[O__Z'GV__^#Q!#IC?W__U!H_W,%"/\U%`H&"&I%ZXJ#[`AJ?FCZAPS```@\00A<") MA3#N__]T7(L-T/,%"(7)#X1#_?__@^P,C85$[O__4.B>]O__6%J-A4#N__]0 M_[5$[O__Z,KU__]:6?^U0.[___\U;`P&".C7]/__6/^U0.[__^B;]/__6/^U M1.[__^F3_O__@[TX[___9`^%Z/S__^GM_/__D.A7]?__@SAS#X2^````#[85 M(@@&"(/Z`7X<@_H$=!>#[`QJ!%!J`6I[:/IS!0CH6??__X/$((/L#%/'A3#N M__\I````Z%/T__\/M@4B"`8(@\00@_@!QX5X[O__`````(VU>.[__\>%?.[_ M_X"6F`!^%X/X!'02@^P(:GAH^G,%".A&]?__@\00C9UP[O__D(/L"%-6Z-+S M__^#Q!!`#X5R_/__Z+/T__^#.`0/A63\__^+A7#N__^+E73N__^)A7CN__^) ME7SN___KQ(/L#%/HQ_/__^DY_/__B?8/M@4B"`8(@_@!?B&#^`1T'(/L#&H$ MZ&7T__]0:@%J>FCZCO__^-4'J)E=CN___'A=3N__\`````@'AZ``^$B0`` M`(H"A,!T*H/L#`^VP%#H`//__X/$$(7`=!&+A=CN__]`B878[O__B<+KUHN5 MV.[__X`Z`'14@^P(:B!2Z(+R__^)A=CN__^#Q!"`.`")PG0YB@*$P'0J@^P, M#[;`4.BP\O__@\00AA5]?__@\04 MC870[O__4.CF\___65N-A%U.[__P````#I;?[_ M_XGVBX4L[O__A<`/A9H```"`/2((!@@`QX4L[O__`0```,>%\.[__P,```#' MA3#N__\!````QX60[O__`````(VUD.[__\>%E.[__P#A]05U0HV=B.[__X/L M"%-6Z'7P__^#Q!!`#X5%]___Z%;Q__^#.`0/A3?W__^+A8CN__^+E8SN__^) MA9#N__^)E93N___KQ(/L"&IY:/IS!0CHE/'__X/$$.NJC78`QX4P[O__*0`` M`.GW]O__@#TB"`8(`'5ZBSW0\P4(A?\/A,3]__]6:/]S!0C_-?@)!@AJ/FH! M:#AT!0AJ`&H!Z"CS__^#Q!2-A[__UC_M:3N___H`>[__U__M:CN___I&?S__X/L"&IU:/IS!0CH M-N___X/$$.EJ____/;O<__\/A%;___^`/2((!@@`#X6"````BSW0\P4(A?\/ MA'S]__]6:/]S!0C_-0`*!@AJ0&H!:#AT!0AJ`&H!Z,KP__^#Q!2-A;#N__]0 MZ%OO__]96XV%K.[__U#_M;#N___HA^[__UA:_[6L[O___S5L#`8(Z)3M__]8 M_[6L[O__Z%CM__]?_[6P[O__Z!SM__^#Q!#I"/W__X/L#&H$C86T[O__4&H! M:G1H^G,%".@Z\/__@\0@Z5S___]6:/]S!0C_-?P)!@AJ/VH!:#AT!0AJ`&H! MZ#3P__^#Q!2-A<#N__]0Z,7N__]96XV%O.[__U#_M<#N___H\>W__UA:_[6\ M[O___S5L#`8(Z/[L__]8_[6\[O__Z,+L__]8_[7`[O__Z(;L__^#Q!#I1_W_ M_X/L"&IS:/IS!0CH[^W__X/$$.DB_?__C78`C12`C122C925Z.___P^_0G:) MA>#N__\/OT)XB87D[O__OO____^-@KL````QVXF%).[__XG'_(C8B?'RKH/L M#/?148/">O^U).[__XG7B?'RKO?145)J!(V%Y.[__U!J!(V%X.[__U!J!(V% MW.[__U!J!6IO:/IS!0CH)>___X/$0(N5W.[__^FH\O__4&H$C8WP[O__46H$ MC87H[O__4&H":FYH^G,%".CV[O__@\0@Z5SR__^)]CV@W/__=2R`/2((!@@` M=0_'A?#N__\#````Z9+R__^#[`AJ;6CZ%,.[__RD```#I:/+__U=H_W,%"/\U"`H& M"&I":@%H.'0%"&H`:@'HD>[__X/$%(V%A.[__U#H(NW__UM>C86`[O__4/^U MA.[__^A.[/__6EG_M8#N____-6P,!@CH6^O__UC_M8#N___H'^O__UC_M83N M___HX^K__X/$$.EX____@^P,:@2-A;3N__]0:@%J=VCZ__ M_Y")]E6)Y5=64X/L;(L=:`P&"(7;QT64`````,=%D``````/A.@```"+,X7V M#X2X````D+^X=`4(N08```#\\Z8/A94```"+=92%]@^$]@```(M5D(/L"(T$ ME00```!0_W64Z%CL__^#Q!"%P`^$OP```(E%E%%J06H`C7V85^C\[/__BS.* M5@:#Q!"`^CV)\(U.!G02A-)T#HGV08H1@/H]=`2$TG7T4BG!4?\S5^CL[/__ M7EAHOW0%"%?H#^S__XD\).AG[/__BTV0BU64@\00A<")!(IT0/]%D(/#!(L# MA<")Q@^%2?____]-D(-]D/]T'8/L#(M-D(M%E/\TB.A[ZO___TV0@\00@WV0 M_W7CC67T6UY?R<-HP70%"&C4`0``:.!T!0AH+W4%".@NZO__:,%T!0AHS`$` M`&C@=`4(:$%U!0CKY8/L#&H$Z&[J__^#Q!"%P(E%E`^%%O___VC!=`4(:,D! M``!HX'0%"&A#=04(Z[>0D%6)Y5=64X'LM`$``.@`````6X'#ZV`!`(VSBFK_ M__R-O:C^__^Y`P```,>%G/[__P````#SI6:EI/^S&`$``/^S%`$``(V]J/[_ M_XF]D/[__^A2ZO__BX,<`0``#[9``H/$$(7`=`F#^`@/A)@%``"-E6C___\Q MP+D@````B=?\\ZN+?0C![P6+=0B)O8C^__^#YA\/J[2]:/___XV-Z/[__XF- M5/[__XN]5/[__[D@````_/.KBX6(_O__#ZNTA>C^__^#[`R-A:#^__]0_[54 M_O__4HM%"&H`0%#'A:#^__\\````QX6D_O__`````.CCZ/__@\0@A<")A9S^ M__\/B'($``"%P`^$Y@,``,>%G/[__P````"+O8C^__\/H[2]Z/[__P^2P(3` M=1,/H[2]:/___P^2P(3`#X4L`0``@^P(BX,0`0``_W`@:@AJ`8V#F6K__U!J M`&H*Z!CK__^#Q!C_LQ@!``#_LQ0!``#'A9S^__\*````Z"KI__^+@QP!```/ MM@"#Q!"#^`AW,8G:*Y2#H*#^___BB?8\7P$`S%X!`,Q>`0`\7P$`S%X!`#Q? M`0`\7P$`/%\!`,Q>`0"#[`C_LQ@!``#_LQ0!``#HU.C__XN#'`$```^V0`*# MQ!"%P'0%@_@(=`Z+A9S^__^-9?1;7E_)PU!J!(V%G/[__U"+O9#^___\,<"Y M______*N]]%1_[60_O__:@)J08V#HVK__U#H+>K__X/$(.NZ4FH$C86<_O__ M4(N]D/[___PQP+G_____\J[WT5'_M9#^__]J`FI"C8.C:O__4.CUZ?__@\0@ MZ57___^0BWT,BP=FP<@(P<@09L'("&H`:@2)A9C^__^-A9C^__]0_W4(Z%/I M__^#Q!"#^`0/A!L!``"%P`^(@P```%!J!(N#$`$``/]P*&H*:@&-@YEJ__]0 M:@!J"NBOZ?__@\08_[,8`0``_[,4`0``QX6<_O__"@```.C!Y___BX,<`0`` M#[8`@\00@_@(#X?$_O__B=\KO(,,HO[__^>0/%\!`,Q>`0#,7@$`/%\!`,Q> M`0`\7P$`/%\!`#Q?`0#,7@$`Z/?F____,(V#J&K__U"+@Q`!``#_G__X/$&/^S&`$``/^S%`$``,>%G/[__PH```#H,^?_ M_XN#'`$```^V`(/$$(/X"`^'-O[__XG:*Y2#G*+^___BC78`/%\!`,Q>`0#, M7@$`/%\!`,Q>`0`\7P$`/%\!`#Q?`0#,7@$`:@"+?0S_-_]W!/]U".@:Z/__ MBQ>#Q!`YT`^$Y?W__X7`#XB!````4%*+@Q`!``#_<"AJ"FH!C8.9:O__4&H` M:@KH=NC__X/$&/^S&`$``/^S%`$``,>%G/[__PH```#HB.;__XN#'`$```^V M`(/$$(/X"`^'B_W__XG?*[R#1*/^___G/%\!`,Q>`0#,7@$`/%\!`,Q>`0`\ M7P$`/%\!`#Q?`0#,7@$`Z+_E____,(V#J&K__U"+@Q`!``#_?__X/$&/^S&`$``/^S%`$``,>%G/[__PH```#H^^7__XN# M'`$```^V`(/$$(/X"`^'_OS__XG:*Y2#U*/^___BC78`/%\!`,Q>`0#,7@$` M/%\!`,Q>`0`\7P$`/%\!`#Q?`0#,7@$`@^P(BX,0`0``_W`D:@EJ`8V#F6K_ M_U!J`&IFZ&3G__^#Q!C_LQ@!``#_LQ0!``#'A9S^__]F````Z';E__^+@QP! M```/M@"#Q!"#^`@/AWG\__^)WRN\@UBD_O__YXGV/%\!`,Q>`0#,7@$`/%\! M`,Q>`0`\7P$`/%\!`#Q?`0#,7@$`Z*OD____,(V#KVK__U"+@Q`!``#_;__X/$&/^S&`$``/^S%`$``,>%G/[__PH```#H MY^3__XN#'`$```^V`(/$$(/X"`^'ZOO__XG:*Y2#Z*3^___BC78`/%\!`,Q> M`0#,7@$`/%\!`,Q>`0`\7P$`/%\!`#Q?`0#,7@$`B[V0_O___#'`N?_____R MKH/L#/?14?^UD/[__VH!:D"-@Z-J__]0Z"3F__^#Q"#I-/K__U6)Y5=64X'L MM`$``.@`````6X'#KUH!`(VSN&K___R-O:C^__^Y!````,>%G/[__P````#S MI6:E_[,8`0``_[,4`0``C;VH_O__B;V0_O__Z!?D__^+@QP!```/MD`"@\00 MA%H/[__SP```#'A:3^ M__\`````Z*CB__^#Q""%P(F%G/[__P^(;@4``(7`#X0W!0``QX6<_O__```` M`(N]B/[__P^CM+WH_O__#Y+`A,!U$P^CM+UH____#Y+`A,`/A9T```"#[`B+ M@Q`!``#_<"!J"&H!C8.9:O__4&H`:@KHW>3__\>%G/[__PH```"#Q""#[`C_ MLQ@!``#_LQ0!``#H[.+__XN#'`$```^V0`*#Q!"%P'0%@_@(=`Z+A9S^__^- M9?1;7E_)PU%J!(V%G/[__U"+O9#^___\,<"Y______*N]]%1_[60_O__:@)J M08V#HVK__U#H1>3__X/$(.NZO@0```"-O9C^__^0:@!65_]U".@8Y/__@\00 MA<`/B*T#``"%P`^$Y0(``"G&`<>%]G79BX6<_O__A<`/A4____^+A9C^__]F MP<@(P<@09L'("(M]#(7`B0=U#\>%G/[__P````#I)O___X/L#%#HO>'__XM5 M#(/$$(7`B4($#X3(`0``BWT,BS>%]HG'=4&+O9S^__^%_P^$\_[__XM]#(LW MA?9T!XM'!(7`=16+10S'``````#'0`0`````Z<[^__^#[`Q0Z/7B__^#Q!#K MW6H`5E?_=0CH5./__X/$$(7`#XC-````A%]G7=ZYJ#[`B+@Q`! M``#_<"QJ"VH!C8.9:O__4&H`:@KH2^/__X/$&/^S&`$``/^S%`$``,>%G/[_ M_PH```#H7>'__XN#'`$```^V`(/$$(/X"`^'1____XG?*[R#<*C^___GD%58 M`0!L5P$`;%+__X/$(.G< M_O__D.A7X/__BP"#^`0/A"O___]0C8/*:O__4(N#$`$``/]P'&H':@&-@YEJ M__]0:@!J"NAWXO__@\08_[,8`0``_[,4`0``QX6<_O__"@```.B)X/__BX,< M`0``#[8`@\00@_@(#X=S_O__B=HKE(-$J?[__^*055@!`&Q7`0!L5P$`55@! M`&Q7`0!56`$`55@!`%58`0!L5P$`:/P```"-@^1J__]0BX,0`0``_W`0:@1J M`8V#F6K__U!J`&H&Z.OA__^#Q!C_LQ@!``#_LQ0!``#'A9S^__\&````Z/W? M__^+@QP!```/M@"#Q!"#^`@/A^C\__^)V2N,@]"I_O__X9!460$`#%8!``Q6 M`0!460$`#%8!`%19`0!460$`5%D!``Q6`0!0:@2-A9S^__]0B[V0_O__,<#\ MN?_____RKO?14?^UD/[__VH":D*-@Z-J__]0Z#7A___I??S__X/L"(N#$`$` M`/]P+&H+:@&-@YEJ__]0:@!J"N@PX?__@\08_[,8`0``_[,4`0``QX6<_O__ M"@```.A"W___BX,<`0``#[8`@\00@_@(#X?0_/__B=\KO(.,JO[__^>)]K%8 M`0!050$`4%4!`+%8`0!050$`L5@!`+%8`0"Q6`$`4%4!`%!J!(V%G/[__U"+ MO9#^___\,<"Y______*N]]%1_[60_O__:@)J0HV#HVK__U#H>>#__X/$(.ED M_/__D.@[WO__BP"#^`0/A$_\__]0C8/*:O__4(N#$`$``/]P'&H':@&-@YEJ M__]0:@!J"NA;X/__@\08_[,8`0``_[,4`0``QX6<_O__"@```.AMWO__BX,< M`0``#[8`@\00@_@(#X?[^___B=HKE(-@J_[__^*0L5@!`%!5`0!050$`L5@! M`%!5`0"Q6`$`L5@!`+%8`0!050$`@^P(BX,0`0``_W`D:@EJ`8V#F6K__U!J M`&IFZ-C?___'A9S^__]F````Z?;Z___H=-W___\PC8.O:O__4(N#$`$``/]P M'&H':@&-@YEJ__]0:@!J"NB>W___@\08_[,8`0``_[,4`0``QX6<_O__"@`` M`.BPW?__BX,<`0``#[8`@\00@_@(#X>;^O__B=HKE(,R<.)]E)0 M:@!6Z%K>__^#Q!#KW)!5B>575E.#[`SH`````%N!PSI3`0"+?1"%_P^$40$` M`(M%"(7`#X0K`0``,?;'1?``````4%?_=0S_=0CHD]S__X/$$(/X$G=;B=HK ME(,,K?[__^*H4@$`I%(!`*12`0"D4@$`I%(!`*12`0"D4@$`I%(!`*12`0"D M4@$`I%(!`*12`0"D4@$`I%(!`*12`0!94@$`I%(!`"Q2`0"`4@$`_T7PD$:# M_@1_$8M%\(7`=(,QP(UE]%M>7\G#BTWPA-W__[@7````Z5W___^#[`QJ M`&H!C8/5:___4(N#$`$``/]P:&H:Z\F#[`QJ`&H#Z^.)]E6)Y5=64X/L#.@` M````6X'#OE$!`(MU"(7VBWT,=`:+!H7`=2N%_W0&BP>%P'4-C67T6UXQP%_) MPXUV`(/L#%#H@]S__\<'`````(/$$.O?@^P,4.AOW/__QP8`````@\00Z\%5 MB>575E.![`P!``#H`````%N!PU=1`0"+?0B%_P^$I0```(MU#(7V#X2:```` M46@``0``:@"-O>C^__]7Z#+<__]86FH`:@;H%]K__\<$)`X```#HZ]C__UE> M4%?HDMS__XM%"(L0@\00A=)T1HM%#(L(A56 M4^@`````6X'#R<.0@_@1=`6#^!1UP8/L#(V# M$FS__U!2C8.W:___4(N#$`$``/]P>&H>:@&-@ZUK__]0:@!J%^A#VO__NA<` M``"#Q##KLY!6C8.W:___4(N#$`$``/]P;&H;:@&-@ZUK__]0:@!J!N@3VO__ MN@8```#K@U6)Y5-0Z`````!;@<.&3@$`BT4(A<"+50QT1X72=!%FBP!FP<@( M9HD",<"+7?S)PX/L#&H`:@*-@RAL__]0BX,0`0``_W!H:AIJ`8V#K6O__U!J M`&H7Z+'9__^X%P```.O)@^P,:@!J`>O,D%6)Y5-0Z`````!;@<,:3@$`BT4( MA<"+50QT1X72=!%FBP!FP<@(9HD",<"+7?S)PX/L#&H`:@*-@SIL__]0BX,0 M`0``_W!H:AIJ`8V#K6O__U!J`&H7Z$79__^X%P```.O)@^P,:@!J`>O,D%6) MY5-0Z`````!;@<.N30$`BT4(A<"+50QT3(72=!:+`&;!R`C!R!!FP<@(B0(Q MP(M=_,G#@^P,:@!J`HV#3FS__U"+@Q`!``#_<&AJ&FH!C8.M:___4&H`:A?H MU-C__[@7````Z\F#[`QJ`&H!Z\Q5B>534.@`````6X'#/DT!`(M%"(7`BU4, M=$R%TG06BP!FP<@(P<@09L'("(D",<"+7?S)PX/L#&H`:@*-@V!L__]0BX,0 M`0``_W!H:AIJ`8V#K6O__U!J`&H7Z&38__^X%P```.O)@^P,:@!J`>O,58GE M5U93@^P,Z`````!;@C'1>P`````BT7HBU7L"?`)^HD!B5$$ M,<"-9?1;7E_)PX/L#&H`:@.-@X9L__]0BX,0`0``_W!H:AIJ`8V#K6O__U!J M`&H7Z`[7__^X%P```.O&@^P,:@!J`NO,@^P,:@!J`>O#D%6)Y5-0Z`````!; M@<-N2P$`BT4(A<"+50QT3(72=!:+`&;!R`C!R!!FP<@(B0(QP(M=_,G#@^P, M:@!J`HV#FFS__U"+@Q`!``#_<&AJ&FH!C8.M:___4&H`:A?HE-;__[@7```` MZ\F#[`QJ`&H!Z\Q5B>534.@`````6X'#_DH!`(M%"(7`BU4,=$R%TG06BP!F MP<@(P<@09L'("(D",<"+7?S)PX/L#&H`:@*-@ZQL__]0BX,0`0``_W!H:AIJ M`8V#K6O__U!J`&H7Z"36__^X%P```.O)@^P,:@!J`>O,58GE5E/H`````%N! MPXY*`0"+50B%THM-#(MU$'1KA#[`QJ`&H"Z\R#[`QJ`&H!Z\.) M]E6)Y5-0Z`````!;@CHD?C__X/$ M$(7`=575E.# M[`SH`````%N!PY9(`0"+=0B%]L=%\`````#'1>P`````#X24````BT4,A7\G#,<#\B?>Y____ M__*NC47P4(U%[%"-1>A0]]%6B4WHZ*WX__^#Q!"%P'7.BT7LBU4,B0(QP.O" MB?:#[`QJ`&H"C8/Y;/__4(N#$`$``/]P:&H::@&-@ZUK__]0:@!J%^AET___ MN!<```#KCH/L#&H`:@'KS)!5B>575E.#[`SH`````%N!P\I'`0"+30B%R8M] M#`^$M@```(7_#X2E````BU40A=)T:H/L#%?HZ=#__X/$$(7`B<9T*5!7:@!6 MZ);2__^#Q`Q7_W4(5N@)TO__BT40B3B)<`0QP(UE]%M>7\G#5XV##FW__U"+ M@Q`!``#_<&QJ&VH!C8.M:___4&H`:@;HPM+__[@&````Z\R-=@"#[`QJ`&H# MC8,.;?__4(N#$`$``/]P:&H::@&-@ZUK__]0:@!J%^B-TO__N!<```#KEXGV M@^P,:@!J`NO*@^P,:@!J`>O!B?95B>575E.#[`SH`````%N!P^9&`0"+10B% MP(M]#`^$J0```(7_#X2A````BT40A7\G#5XV##FW__U"+ M@Q`!``#_<&QJ&VH!C8.M:___4&H`:@;HX='__[@&````Z\R)]H/L#&H`:@.- M@R5M__]0BX,0`0``_W!H:AIJ`8V#K6O__U!J`&H7Z*W1__^X%P```.N8B?:# M[`QJ`&H!Z\J0B?95B>575E.#[`SH`````%N!PPY&`0"+10R+50B+,(L"*<:+ M?1@!]XM5%#LZ=CB+31"%R70\@^P(5U#H*M#__X/$$(7`="N+50B)`@'PBU4, MB0*+512).E+_=1AJ`%#HQM#__X/$$#'`C67T6UY?R<.05_]U'(N#$`$``/]P M;&H;:@&-@ZUK__]0:@!J!N@'T?__N`8```#KSU6)Y5=64X/L).@`````6X'# M=D4!`(V#/FW__U!J"O]U%/]U$/]U'/]U&(MU".@V____@\0@A M7\G#C78`BT4<@^P(BSB-1?)0C47P4&:)=?#HE_;__X/$$(7`==5FBT7R9HD' M@^P(C47L4(UUZ%;'1>@$````B47DZ$?W__^#QP*#Q!"%P'6JBT7LB0>#[`C_ M=>2+10Q6B47HZ";W__^#QP2#Q!"%P'6)BT7LB0>+11R#QP2).#'`Z77___]5 MB>575E.#[!3H`````%N!P[)$`0"+10B+,(L&B47LC47P4(U][%>)1>CH2??_ M_X/&!(/$$(7`=2Z#??`$=#&#[`B+@Q`!``#_L"`!``!J2&H!C8.M:___4&H` M:@3HVL___[@$````C67T6UY?R<.0@^P(BP;_=>A7B47LZ/?V__^#Q@2#Q!"% MP'7575E.#[#3H`````%N!PQ9$`0"+10R) M1="-@SYM__]0:@[_=1C_=13_=2"+51#_=1R+=0B)5=3HROW__X/$((7`=`N- M9?1;7E_)PXUV`(/L"(M5((U%[HLZ4(U%[%!FB77LZ"OU__^#Q!"%P'759HM% M[F:)!X/L"(U%Z%"-=>16QT7D"````(E%S.C;]?__@\<"@\00A+1>B# MQP2)!XM5((/'!(DZ,<#I9?___U6)Y5=64X/L).@`````6X'#-D,!`(M%"(LP MBP:-?>Q7B47HC47H4.C0]?__@\8$@\00A575E.#[!SH`````%N!PXI"`0"+10AFB47:BT4,A<"Z M!@```'0@@^P(C47H4/]U#.CM^/__@\00A<`/A9$```"+5>B#P@:#[`B-@U%M M__]04O]U%/]U$/]U'/]U&.@8_/__@\0@A<")QG569HM%VH/L"(M5'&:)1>2- M1>:+.E"-1>10Z'[S__^#Q!"%P(G&=3!FBT7F9HD'BT4,@\<"AC_=>SH.^[__XGPC67T M6UY?R<.+1>")!U;_=>C_=>R#QP17Z#3,__^+1>B+51P!QXDZ6EE0_W7LZ`?N M__\QP.O*@^P(C47@4(U%W%#'1=P`````Z,#S__^#Q!"%P(G&=9J+1>")!XM5 M'(/'!(DZZ\U5B>575E.#["3H`````%N!PU)!`0"+10B+`(E%X(L`B47LC47P M4(U%[%"#1>`$Z.7S__^#Q!"%P'4FBU7PA=*)5>1U)(M]#(M%$,<'`````,<` M`````(M]X(M5"(DZ,<"-9?1;7E_)PX/L#/]UY.@YRO__@\00A<")1>AT9U?_ M=>1J`/]UZ.CAR___@\0,_W7D_W7@_W7HZ%#+__]97O]U$(M%Y/]UZ`%%X.@- M^/__B<986O]UY/]UZ.@6[?__@\00A?:)\'69BWT0BQ2-@V5M__]0BX,0`0``_W!L:AMJ`8V#K6O__U!J`&H& MZ-'+__^X!@```.E+____D(GV58GE5U93@^P+1>B#[`B)1=R-1>!0C47<4.CK M\?__@\00A<")QG0:@^P(_W7H_W7LZ`#L__^)\(UE]%M>7\G#B?:+1>")!U;_ M=>C_=>R#QP17Z/?)__^+1>B+52`!QXDZ6EE0_W7LZ,KK__\QP.O(@^P(C47@ M4(U%W%#'1=P`````Z(/Q__^#Q!"%P(G&=9B+1>")!XM5((/'!(DZZ\V-=@!0 MC47H4%'_=0SH.O?__X/$$(7`=8&+5>B#P@;IZ_[__U6)Y5=64X/L%.@````` M6X'#\CX!`(M%"(LXBP>)1>R-1?!0C47L4.B,\?__@\<$@\00ACHB\G__X/$#/]U\%?_=>CH_,C__X/$#/]U M$(M%\%#_=>@!Q^AH]___B<986O]U\/]UZ.C!ZO__@\00A?:)\'6:BT7PBU4, MB0*+10B)..N)_W7PC8.3;?__4(N#$`$``/]P;&H;:@&-@ZUK__]0:@!J!NB* MR?__N`8```#I6O___U6)Y5=64X/L$.@`````6X'#]CT!`(M5"#'VA=(/A)L` M``"+>@B%_[Y!````=`_\N?____\QP/*N]]&-<4&+0A2#QAJ%P(E%['01B2#P@PY1?!ROH/&`H/$$%N)\%Y?R<.+?>R%_W3>BT($B47H M_+G_____,<"+?>CRKO?1C70.!NO#C78`@\8*Z[N0B?95B>575E.#["SH```` M`%N!PP(]`0"+?0B%_P^$)0,``(M%#(7`#X3E`@``@^P,5\=%[`````#'1>@` M````Z,K^__^#Q!`QTH7`B47H=0J-9?1;7HG07\G#@^P,4.C[Q?__@\00A<") M1>P/A&T"``"#[`B)1?"-1?!0C57L4HU-Z%%J`/\W:+'.``")1=R)5=B)3=3H M]/;__X/$((7`B<8/A8L!``"#[`C_==S_==C_==1J`/]W!&BRS@``Z+CY__^# MQ""%P(G\`0``@^P(_W7<_W78_W74:@#_=PAHL\X``.B0^?__@\0@A<") MQ@^%.P$``(/L"/]UW/]UV/]UU&H`_W<,:+3.``#H?/;__X/$((7`B<8/A1,! M``"#[`C_==S_==C_==1J`/]W$&BUS@``Z%3V__^#Q""%P(GK````@^P( M_W7<_W78_W74:@#_=Q1HMLX``.@8^?__@\0@A<")Q@^%PP```(/L"/]UW/]U MV/]UU&H`_W<8:+?.``#H!/;__X/$((7`B<8/A9L```"+5QB%TG1ZQT7D```` M`(M''#E5Y(E%X'-HBTW@BP&#^`9W4HG9*XR#M,3^___AD#`[`0#+.@$`L#H! M`(PZ`0`&.P$`=3H!`%(Z`0"#[`C_==S_==C_==1J`(M%X/]P!&BXS@``Z([U M__^#Q""%P(G&=2F+5QC_1>2#1>`,.57DR+1?"+30PIT(E1!(D!,=+I M(?[__XUV`(/L"/]UZ/]U[.A&Y___B?+I"?[__X/L"/]UW/]UV/]UU&H`BU7@ M_W($:+G.``#KF5#_==S_==C_==1J`(M-X/]Q"/]Q!&BZS@``Z&WV___I>O__ M_U#_==S_==C_==1J`&H`:@!HN\X``.O?@^P(_W7<_W78_W74:@"+1>#_<`1H MO,X``.B_]___Z4#___^#[`C_==S_==C_==1J`(M5X/]R!&B]S@``Z1W_____ M=>B-@ZUM__]0BX,0`0``_W!L:AMJ`8V#K6O__U!J`&H&Z(G%__^Z!@```.E! M_?__C78`@^P,:@!J`HV#K6W__U"+@Q`!``#_<&AJ&FH!C8.M:___4&H`:A?H M4<7__[H7````Z0G]__^#[`QJ`&H!Z\F)]E6)Y5=64X/L'.@`````6X'#LCD! M`(M]#(M%"(U-Z(7_9HE%YL=%Z`````")3=S'1>P`````="V+=1"%]G5F@^P( MBTW7\G#C78`BT4G__X/$$(7`B<8/A;$$``!FBT7" M9CVPS@^&`P<```^WP"VQS@``@_@,#X?-!@``B=HKE(.8R/[__^*)]C0W`0#< M-`$`LS0!`)@T`0!W-`$`6C0!`#PT`0`H,P$`\#$!`'0Q`0!-,0$`(C$!`.8P M`0"+17\G#BU6TBT($A<`/A8X```"+3;2+00B% MP'5SBU6TBT(4A+__XGPZ0____^#[`Q0Z('`__^#Q!#K MWH/L#%#H<\#__X/$$.O&@^P,4.AEP/__@\00ZZZ#[`Q0Z%?`__^#Q!#KEHM- MM(M!!(7`=7R+5;2+0@B%P'5DBTVTBT$4A- M1;Q0Z%CS___IH/W__XM5T(72#X4R____4(M%M(/`",=%T`$```#KU8M%U(7` M#X47____BT6T@^P(@\`,QT74`0```%#I6_W__XM%V(7`#X7V_O__BT6TQT78 M`0```(/L"(/`$.O=BT7#[`AJ(/]UM.CAW___N`8```#IQ/S__X/L#%#H-K[__X/$ M$.O;@^P,4.@HOO__@\00Z\.#[`Q0Z!J^__^#Q!#KJX/L#%#H#+[__X/$$.N3 MC78`_T6PBTVPBT6T.T@8#X>&````BTVPC01)BTVTBU$+0`2%P`^%@0```(M5M(M""(7`=6F+3;2+ M012%P'51BU6TBT(__]97HN#$`$``/^PA````&HA M:@&-@ZUK__]0:@!J!.BTO?__N`0```#IC_O__X/L#%#H`;W__X/$$.NY@^P, M4.CSO/__@\00ZZ&#[`Q0Z.6\__^#Q!#KB8/L#%#HU[S__X/$$.EN____C78` M_T6PBT6PBU6T.T(8=QN+5;"+3;2-!%*+41R-!(+'0/0!````Z?BT6PBTVTC11`BT$-1;Q0Z-OK__^#Q!"%P(GK_?__BT7$`46\ MZ7WY__^#[`AJ(/]UM.CJW/__6%J+@Q`!``#_L"`!``!J2.D7_O__D(/L#/]U MM.@QN___Z9OZ__]J((V#V&W__U"+@Q`!``#_<&QJ&VH!C8.M:___4&H`:@;H MIKO__^FX_/__@^P,:@!J`XV#&6[__U"+@Q`!``#_<&AJ&NG&^?__@^P,:@!J M`NO@@^P,:@!J`>O7D%6)Y5=64X/L'.@`````6X'#YB\!`(M]"(7_#X0I`0`` MBW4,A?8/A.D```"+1P2#P!B#[`Q0B47HZ`.Y__^#Q!"%P(E%[`^$F0```%'_ M=>AJ`%#HJ;K__UB+1>Q:B47PC47P4(U5[%*)1>2-1>A0:@#_-VBAS@``B57@ MB47C_=>SHBMO__XGPZ^.)]O]UZ(V#-&[__U"+@Q`!``#_<&QJ&VH!C8.M:___ M4&H`:@;H9;K__[@&````Z[.)]H/L#&H`:@*-@S1N__]0BX,0`0``_W!H:AIJ M`8V#K6O__U!J`&H7Z#&Z__^X%P```.E\____@^P,:@!J`>O)B?95B>6+50@Q MP(72=`V+2@B%R70&BT($@\`0R<.058GE5U93@^P,Z`````!;@<-V+@$`BU4, M,?:%THM]"'0'BT((AC_=>P/M\=0Z,CM M__^#Q!C_=>C_=>R)QNATVO__@\00ZY^0B?95B>575E.#[#SH`````%N!P^HM M`0"+?0B%_XMU$`^$[P$``(M%#(7`#X3;`0``A?8/A)X!``#'!@````#'1@0` M````QT8(`````(L7B578BP*#[`C_=0R)1>R-1>R#P@10B578B47,Z$3@__^# MQ!"%P`^%M````,=%X`````#'1>0`````BTT,C57@BP&)5=`#!XM5V#G"B=%S M?HU%WHU5W(E%Q(E5R)"#[`AFBP'_=<2-40+_=#[`C_=7\G#D(M-T(M!!(7`=2+'000!````4(U&"%"-1@10 MC4784.BA[?__@\00ANI@^P(BX,0`0``_["(````:B)J`8V#K6O__U!J M`&H$Z/&W__^X!````.NAB?:+1>"%P'7-@^P(5HU%V%#'1>`!````Z)'G___K MKH/L"(N#$`$``/^P(`$``&I(:@&-@ZUK__]0:@!J!.BHM___@\0@Z[*-=@"# M[`QJ`&H#C8-';O__4(N#$`$``/]P:&H::@&-@ZUK__]0:@!J%^AUM___N!<` M``#I(O___X/L#&H`:@+KR8/L#&H`:@'KP)!5B>575E.#[`SH`````%N!P\XK M`0"+30B%R71.BT4(BW`$,?^+`#G'575H/L"(M5"(72QT7P`````'0_BP*%P,=%\`H```")1?1T*S'V.<:+ M4@1S(OPQP(MZ"+G_____\J[WT8M%\$:-3`@0@\(,.W7TB4WP575E.#[!SH`````%N!P](J`0"+10AFB47JBT4,A<"Z#``` M`'1`BTT,BPF%R8E-V'0TQT7D`````(M%##E-Y(MP!',B_)"+?@@QP+G_____ M\J[WT8U4"A#_1>2+3=B#Q@PY3>1RX(/L"(V#76[__U!2_W44_W40_W4<_W48 MZ$#D__^#Q""%P(G"=`N-9?1;7HG07\G#D(M5'(L"@^P(B47LC47RC57P4%)F MBTWJB57<9HE-\(E%X.B2V___@\00A<")PG7&BT7L9HM5\F:)$(M]#(-%[`(Q M]H7_9L=%\/&P=`6+30R+,8/L"(U][%?_=1C_=11J`%8/MT7P4.A9Y/__@\0@ MA<")PG6!A?9T$8M5##L"BW($QT7D`````')`@^P(_W7@_W7<9L=%\/^PZ!O; M__^#Q!"%P(G"#X5+____BU7L9HM%\F:)`HM%[(/``HM5'(E%[(D",=+I+/__ M_X/L"%?_=1C_=11J`/\V:/*P``!FQT7P\K#HW>/__X/$((7`=36#[`A7_W48 M_W44:@#_=@AH\[```.BIYO__@\0@A``````QT7(`````,=%Q`````")1;R)5<#'1;@`````@^P(BT70 M9HL0_W6\@\`"_W7`9HE5U(E%T.@VVO__@\00A`3K@5:-@W5N__]0BX,0`0``_W!L:AMJ`8V#K6O_ M_U!J`&H&Z-6R__^X!@```.F)_O__48V#=6[__U"+@Q`!``#_L(@```!J(FH! MC8.M:___4&H`:@3HH[+__^E7_O__B?8]\[```'03/?^P```/A>G^____1<3I M"?___U"-1PA0C4<$4(U%T%#HE.7__X/$$(7`#X4C_O__Z>?^__^+1564^@`````6X'#ZB4!`(MU"(7V=%*#[`C_=@S_=A#H0M+_ M_UA:_W84_W88Z#72__]96/]V'/]V(.@HTO__6%K_=B3_=BCH&]+__UE8_W8P M_W8TZ`[2__]86O]V./]V/.@!TO__@\00C67X6S'`7LG#D%6)Y593Z`````!; M@<-V)0$`BW4(A?9T'H/L"/]V#/]V$.C.T?__65C_=A3_=ACHP='__X/$$(UE M^%LQP%[)PY!5B>564^@`````6X'#-B4!`(MU"(7V="N#[`C_=@S_=A#HCM'_ M_UE8_W84_W88Z('1__]86O]V'/]V(.ATT?__@\00C67X6S'`7LG#58GE5E/H M`````%N!P^HD`0"+=0B%]G0H@^P,_W80Z.VL__]96/]V&/]V'.@XT?__6%K_ M=B#_=B3H*]'__X/$$(UE^%LQP%[)PY")]E6)Y8M5"#'`A=)T+XM*$(7)N"0` M``!T!HM"#(/`)(M*&(/`!H7)=`,#0A2+2B"#P`:%R70#`T(<@\`"R<.0B?95 MB>575E.![)P```#H`````%N!PUM__^+@QP!```/M@"#Q!"#^`1T"X/X!']52(/X`7="@^P,:@2-1:10 M:@2-19C'19@S`0``4(N]8/____PQP+G_____\J[WT5'_M6#___]J`VI_C8-' M;___4.BLKO__@\0PBT6DC67T6UY?R<.)]H/X"'7NZZJ0@^P,4.A[K/__@\00 MA<")18P/A"4$``!7_W6(:@!0Z"&N__]97HM%C(UUD%:)19"-18Q0C7V(5VH` MBTT(_S%HH;```(F%9/___^AFW?__@\0@A<")1:1T:(/L"/]UB/]UC.A&S___ M6%K_LQ@!``#_LQ0!``#H:ZS__XN#'`$```^V`(/$$(/X!'0/@_@$?R1(@_@! M#X=2____@^P,:@2-1:10:@2-183'181&`0``Z0O___^#^`@/A2_____KVXGV M@^P(5O^U9/___U=J`(M%"/]P!&BBL```Z-?<__^#Q""%P(E%I'1F@^P(_W6( M_W6,Z+?.__]?6/^S&`$``/^S%`$``.C%?/___TX! M``#IZ?W__X/X"`^%#?[__^O5@^P(5O^U9/___U=J`(M%"/]P$&BDL```Z*/> M__^#Q""%P(E%I'1L@^P(_W6(_W6,Z)?-__]86O^S&`$``/^S%`$``.B\JO__ MBX,<`0``#[8`@\00@_@$=`^#^`1_*DB#^`$/AZ/]__^#[`QJ!(U%I%!J!(V% M>/___\>%>/___U,!``#I5OW__X/X"`^%>OW__^O5@^P(5O^U9/___U=J`(M- M"/]Q&&BEL```Z!#>__^#Q""%P(E%I'1L@^P(_W6(_W6,Z`3-__]>7_^S&`$` M`/^S%`$``.@IJO__BX,<`0``#[8`@\00@_@$=`^#^`1_*DB#^`$/AQ#]__^# M[`QJ!(U%I%!J!(V%=/___\>%=/___U@!``#IP_S__X/X"`^%Y_S__^O545;_ MM63___]7:@"+10C_`0``Z2_\__^# M^`@/A5/\___KU8/L"%9HK[```.A0^?__@\00A<")1:1U'HM%D(M5C"G0BTT, MB0&)403'1:0`````,<#I'OS__X/L"/]UB/]UC.C.R___7E__LQ@!``#_LQ0! M``#H\ZC__XN#'`$```^V`(/$$(/X!'0/@_@$?RI(@_@!#X?:^___@^P,:@2- M1:10QX5L____80$``&H$C85L____Z8W[__^#^`@/A;'[___KU?]UB/^U:/__ M_XN#$`$``/]P;&H;:@&-@SUO__]0:@!J!NA2JO__@\08_[,8`0``_[,4`0`` MQT6D!@```.AGJ/__BX,<`0``#[8`@\00@_@$=`^#^`1_)$B#^`$/AT[[__^# M[`QJ!(U%I%!J!(U%E,=%E#T!``#I!_O__X/X"`^%*_O__^O;B?:#[`QJ`&H" M_[5H____BX,0`0``_W!H:AIJ`8V#/6___U!J`&H$Z,:I__^#Q"C_LQ@!``#_ MLQ0!``#'1:0$````Z-NG__^+@QP!```/M@"#Q!"#^`1T#X/X!'\D2(/X`0^' MPOK__X/L#&H$C46D4&H$C46P`G0@^`!=0N+202% MR0^%N@```(/L#/]U"&H!_[4L____BX,0`0``_W!H:AIJ`8V#/6___U!J`&H$ MZ$^H__^#Q"C_LQ@!``#_LQ0!``#'180$````Z&2F__^+@QP!```/M@"#Q!"# M^`1T"X/X!']62(/X`7="@^P,:@2-1810:@2-18#'18"A`0``4(N],/____PQ MP+G_____\J[WT5'_M3#___]J`VI_C8-';___4.BYI___@\0PBT6$C67T6UY? MR<.-=@"#^`AU[>NID(M5#(72#X1Y"0``_(U]R+D&````\ZN+?0RY"0```/.K MBU4(BT($BTT(B<(#$3G0B85H____B<$/@\@```"-O7K___^-M7C___^-=@"# M[`AFBP%79HF%>/___U:-00*)A6C____HM\W__X/$$(7`B46$#X6N"```9HN% M>O___V8]H+`/AA`(```/M\`MH;```(/X#@^'8P<``(G:*Y2#8.3^___B,1L! M`.`9`0#$&`$`J!KKH(M%S(7` M#X6*````BT4,@^P(@\`$4(V%:/___U#'1%7/___\L!``#IS_S__X/X M"`^%\_S__^O54/^U+/___XN#$`$``/^PB````&HB:@&-@SUO__]0:@!J!.B@ MI/__@\08_[,8`0``_[,4`0``Z+RB__^+@QP!```/M@"#Q!"#^`1T#X/X!'\J M2(/X`0^'^/[__X/L#&H$C46$4&H$C85@____QX5@____R0$``.FK_O__@_@( M#X7/_O__Z]60BT70A<`/A8H```"+10R#[`B#P`A0C85H____4,=%T`$```#H MW-/__X/$$(7`B46$#X2._?__@^P(_[,8`0``_[,4`0``Z":B__^+@QP!```/ MM@"#Q!"#^`1T#X/X!'\J2(/X`0^'`/S__X/L#&H$C46$4&H$C854____QX54 M____T`$``.FS^___@_@(#X77^___Z]51_[4L____BX,0`0``_["(````:B)J M`8V#/6___U!J`&H$Z(2C__^#Q!C_LQ@!``#_LQ0!``#HH*'__XN#'`$```^V M`(/$$(/X!'0/@_@$?RI(@_@!#X?<_?__@^P,:@2-1810:@2-A5C____'A5C_ M___.`0``Z8_]__^#^`@/A;/]___KU9"+5=2%T@^%CP```%"+10R#P!!0BT4, M@\`,4(V%:/___U#'1=0!````Z!O6__^#Q!"%P(E%A`^$;?S__X/L"/^S&`$` M`/^S%`$``.@%H?__BX,<`0``#[8`@\00@_@$=`^#^`1_*DB#^`$/A]_Z__^# M[`QJ!(U%A%!J!(V%3/___\>%3/___]%1/___]X!``#I M%//___^4!``#I4OC__X/X"`^%=OC__^O55O^U+/___XN#$`$` M`/^PB````&HB:@&-@SUO__]0:@!J!.@CH/__@\08_[,8`0``_[,4`0``Z#^> M__^+@QP!```/M@"#Q!"#^`1T#X/X!'\J2(/X`0^'>_K__X/L#&H$C46$4,>% M0/___^$!``!J!(V%0/___^DN^O__@_@(#X52^O__Z]6#[`B-A3C___]0C85H M____4,>%./___P````#H:,___X/$$(7`B46$=1&+A3C___\!A6C____I#?G_ M_X/L"/^S&`$``/^S%`$``.BEG?__BX,<`0``#[8`@\00@_@$=`^#^`1_*DB# M^`$/AW_W__^#[`QJ!(U%A%#'A33____J`0``:@2-A33____I,O?__X/X"`^% M5O?__^O5B?90_[4L____BX,0`0``_[`@`0``:DAJ`8V#/6___U!J`&H$Z`&? M__^#Q!C_LQ@!``#_LQ0!``#'180$````Z!:=__^+@QP!```/M@"#Q!"#^`1T M#X/X!'\J2(/X`0^'\/;__X/L#&H$C46$4&H$C85P____QX5P____O0$``.FC M]O__@_@(#X7']O__Z]6#[`C_LQ@!``#_LQ0!``#HMYS__XN#'`$```^V`(/$ M$(/X!'0/@_@$?RI(@_@!#X>1]O__@^P,:@2-1810:@2-A73____'A73___^W M`0``Z43V__^#^`@/A6CV___KU8/L#&H`:@+_M2S___^+@Q`!``#_<&AJ&FH! MC8,];___4&H`:@3H$I[__X/$*/^S&`$``/^S%`$``,=%A`0```#H)YS__XN# M'`$```^V`(/$$(/X!'0/@_@$?RI(@_@!#X&H>:@&-@SUO__]0:@!J%\=%I!<```#H MB9S__X/$*/^S&`$``/^S%`$``.BEFO__BX,<`0``#[8`@\00@_@$=`N#^`1_ M4TB#^`%W0H/L#&H$C46D4&H$C468QT6890(``%"+O5C____\,<"Y______*N M]]%1_[58____:@-J?XV#1V___U#H^IO__X/$,(M%I(UE]%M>7\G#@_@(=?#K MK)"#[`Q0Z,N9__^#Q!"%P(E%C`^$504``%+_=8AJ`%#H<9O__U]8BT6,B460 MC4604(U]C%>-=8A6:@"+30C_,6BQL```B85<____Z+;*__^#Q""%P(E%I'1H M@^P(_W6(_W6,Z):\__]97O^S&`$``/^S%`$``.B[F?__BX,<`0``#[8`@\00 M@_@$=`^#^`1_)$B#^`$/AU3___^#[`QJ!(U%I%!J!(U%A,=%A'@"``#I#?__ M_X/X"`^%,?___^O;B?:#[`C_M5S___]75FH`BT4(_W`$:+*P``#H)\K__X/$ M((7`B46D=&:#[`C_=8C_=8SH![S__UA:_[,8`0``_[,4`0``Z"R9__^+@QP! M```/M@"#Q!"#^`1T#X/X!'\D2(/X`0^'Q?[__X/L#&H$C46D4&H$C46`QT6` M?`(``.E^_O__@_@(#X6B_O__Z]N#[`C_M5S___]75FH`BTT(_W$(:+.P``#H MFLG__X/$((7`B46D=&R#[`C_=8C_=8SH>KO__U]8_[,8`0``_[,4`0``Z)^8 M__^+@QP!```/M@"#Q!"#^`1T#X/X!'\J2(/X`0^'./[__X/L#&H$C46D4&H$ MC85\____QX5\____@`(``.GK_?__@_@(#X4/_O__Z]6#[`C_M5S___]75FH` MBT4(_W`,:+2P``#H!\G__X/$((7`B46D=&R#[`C_=8C_=8SHY[K__UE>_[,8 M`0``_[,4`0``Z`R8__^+@QP!```/M@"#Q!"#^`1T#X/X!'\J2(/X`0^'I?W_ M_X/L#&H$C46D4&H$C85X____QX5X____A`(``.E8_?__@_@(#X5\_?__Z]6# M[`C_M5S___]75FH`BTT(_W$0:+6P``#H.-3__X/$((7`B46D=&R#[`C_=8C_ M=8SH5+K__UA:_[,8`0``_[,4`0``Z'F7__^+@QP!```/M@"#Q!"#^`1T#X/X M!'\J2(/X`0^'$OW__X/L#&H$C46D4&H$C85T____QX5T____B`(``.G%_/__ M@_@(#X7I_/__Z]6#[`C_M5S___]75HM%"&H`@\`44&BVL```Z.#>__^#Q""% MP(E%I'1L@^P(_W6(_W6,Z,"Y__]>7_^S&`$``/^S%`$``.CEEO__BX,<`0`` M#[8`@\00@_@$=`^#^`1_*DB#^`$/AW[\__^#[`QJ!(U%I%!J!(V%% M_[,8`0``_[,4`0``Z+V5__^+@QP!```/M@"#Q!"#^`1T#X/X!'\J2(/X M`0^'5OO__X/L#&H$C46D4&H$C85H____QX5H____F`(``.D)^___@_@(#X4M M^___Z]6)]H/L"/^U7/___VB_L```Z''E__^#Q!"%P(E%I'4>BT60BU6,*="+ M30R)`8E1!,=%I``````QP.GQ^O__@^P(_W6(_W6,Z.^W__]86O^S&`$``/^S M%`$``.@4E?__BX,<`0``#[8`@\00@_@$=`^#^`1_*DB#^`$/AZWZ__^#[`QJ M!(U%I%#'A63___^;`@``:@2-A63____I8/K__X/X"`^%A/K__^O5D/]UB/^U M8/___XN#$`$``/]P;&H;:@&-@SUO__]0:@!J!NAREO__@\08_[,8`0``_[,4 M`0``Z(Z4__^+@QP!```/M@"#Q!"#^`1T"X/X!']92(/X`7="@^P,:@2-1:10 M:@2-1910QT64;@(``(N]6/____PQP+G_____\J[WT5'_M5C___]J`VI_C8-' M;___4.CCE?__@\0PN`8```#'1:0&````Z=OY__^#^`AUZNNF@^P,:@!J`O^U M8/___XN#$`$``/]P:&H::@&-@SUO__]0:@!J!.B^E?__@\0H_[,8`0``_[,4 M`0``Z-J3__^+@QP!```/M@"#Q!"#^`1T"X/X!']92(/X`7="@^P,:@2-1:10 MQT6<6`(``&H$C46<4(N]6/____PQP+G_____\J[WT5'_M5C___]J`VI_C8-' M;___4.@OE?__@\0PN`0```#'1:0$````Z2?Y__^#^`AUZNNF@^P,:@!J`5"+ M@Q`!``#_<&AJ&FH!C8,];___4&H`:@3H#Y7__X/$*/^S&`$``/^S%`$``.@K MD___BX,<`0``#[8`@\00@_@$=`N#^`1_($B#^`%WDX/L#&H$C46D4&H$C46@ MQT6@4`(``.E,____@_@(#X5P____Z]N)]E6)Y5=64X'LW````.@`````6X'# M*PD!`(V#CF___XU5B(G7B<;\N04```")A2#___^)E1S____'180`````\Z6+ M?0B+30B%_XLQ#Y3"A?8/GL`)T(/@`74+BTD$A7\G#D(/X"'7OZZN0BU4,A=(/ MA.4+``#\C7W(N0@```#SJXM]#+D,````\ZN+50B+0@2+30B)P@,1.=")A6C_ M__^)P0^#R````(V]>O___XVU>/___XUV`(/L"&:+`5=FB85X____5HU!`HF% M:/___^B3N?__@\00A<")180/A1H+``!FBX5Z____9CVPL`^&?`H```^WP"VQ ML```@_@.#X?/"0``B=HKE(.$^/[__^(-!P$`X`4!`+@$`0"0`P$`:`(!`#P! M`0`0``$`Y/X``+C]``"X_0``N/T``+C]``"X_0``N/T``$`'`0"+30B+402+ M"8T$$8F%:/___XUV`(T$$8N-:/___SG!#X)'____QT6$`````#'`Z=S^__^+ M1%9/___P$# M``#I'?[__X/X"`^%0?[__^O5C78`4/^U(/___XN#$`$``/^PB````&HB:@&- M@SUO__]0:@!J!.C%D?__@\08_[,8`0``_[,4`0``QT6$!````.C:C___BX,< M`0``#[8`@\00@_@$=`^#^`1_*DB#^`$/A]K]__^#[`QJ!(U%A%!J!(V%;/__ M_\>%;/____\"``#IC?W__X/X"`^%L?W__^O5C78`BT7,A<`/A8T```"+10R# M[`B#P`10C85H____4,=%S`$```#H^,#__X/$$(7`B46$#X3._O__@^P(_[,8 M`0``_[,4`0``Z$*/__^+@QP!```/M@"#Q!"#^`1T#X/X!'\J2(/X`0^'0OW_ M_X/L#&H$C46$4&H$C85<____QX5<____!@,``.GU_/__@_@(#X49_?__Z]6- M=@!6_[4@____BX,0`0``_["(````:B)J`8V#/6___U!J`&H$Z)V0__^#Q!C_ MLQ@!``#_LQ0!``#'180$````Z+*.__^+@QP!```/M@"#Q!"#^`1T#X/X!'\J M2(/X`0^'LOS__X/L#&H$C46$4&H$C85@____QX5@____!`,``.EE_/__@_@( M#X6)_/__Z]6-=@"+3="%R0^%C0```(M%#(/L"(/`"%"-A6C___]0QT70`0`` M`.C0O___@\00A<")180/A*;]__^#[`C_LQ@!``#_LQ0!``#H&H[__XN#'`$` M``^V`(/$$(/X!'0/@_@$?RI(@_@!#X<:_/__@^P,:@2-1810:@2-A53____' MA53___\+`P``Z*^___@^P,:@2-1810 M:@2-A5C____'A5C___\)`P``Z3W[__^#^`@/A6'[___KU8UV`(M%U(7`#X6- M````BT4,@^P(@\`,4(V%:/___U#'1=0!````Z*B^__^#Q!"%P(E%A`^$?OS_ M_X/L"/^S&`$``/^S%`$``.CRC/__BX,<`0``#[8`@\00@_@$=`^#^`1_*DB# M^`$/A_+Z__^#[`QJ!(U%A%!J!(V%3/___\>%3/___Q`#``#II?K__X/X"`^% MR?K__^O5C78`4/^U(/___XN#$`$``/^PB````&HB:@&-@SUO__]0:@!J!.A- MCO__@\08_[,8`0``_[,4`0``QT6$!````.ABC/__BX,<`0``#[8`@\00@_@$ M=`^#^`1_*DB#^`$/AV+Z__^#[`QJ!(U%A%!J!(V%4/___\>%4/___PX#``#I M%?K__X/X"`^%.?K__^O5C78`BT78A<`/A9$```!0BT4,@\`04(V%1/___U"- MA6C___]0QT78`0```.B_R?__@\00A<")180/A%'[__^#[`C_LQ@!``#_LQ0! M``#HQ8O__XN#'`$```^V`(/$$(/X!'0/@_@$?RI(@_@!#X?%^?__@^P,:@2- M1810:@2-A4#____'A4#___\5`P``Z7CY__^#^`@/A9SY___KU8GV4/^U(/__ M_XN#$`$``/^PB````&HB:@&-@SUO__]0:@!J!.@AC?__@\08_[,8`0``_[,4 M`0``QT6$!````.@VB___BX,<`0``#[8`@\00@_@$=`^#^`1_*DB#^`$/AS;Y M__^#[`QJ!(U%A%!J!(V%2/___\>%2/___Q,#``#IZ?C__X/X"`^%#?G__^O5 MC78`BT79^/__@^P,:@2-1810:@2-A3C____'A3C_ M__\;`P``Z4SX__^#^`@/A7#X___KU8GV4?^U(/___XN#$`$``/^PB````&HB M:@&-@SUO__]0:@!J!.CUB___@\08_[,8`0``_[,4`0``QT6$!````.@*BO__ MBX,<`0``#[8`@\00@_@$=`^#^`1_*DB#^`$/APKX__^#[`QJ!(U%A%!J!(V% M//___\>%//___QD#``#IO??__X/X"`^%X??__^O5C78`BT7@A<`/A9$```!0 MBT4,@\`D4(M%#(/`(%"-A6C___]0QT7@`0```.CCP/__@\00A<")180/A/GX M__^#[`C_LQ@!``#_LQ0!``#H;8G__XN#'`$```^V`(/$$(/X!'0/@_@$?RI( M@_@!#X=M]___@^P,:@2-1810:@2-A3#____'A3#___\B`P``Z2#W__^#^`@/ MA43W___KU8GV4/^U(/___XN#$`$``/^PB````&HB:@&-@SUO__]0:@!J!.C) MBO__@\08_[,8`0``_[,4`0``QT6$!````.C>B/__BX,<`0``#[8`@\00@_@$ M=`^#^`1_*DB#^`$/A][V__^#[`QJ!(U%A%!J!(V%-/___\>%-/___QX#``#I MD?;__X/X"`^%M?;__^O5C78`BT7DA<`/A9$```!0BT4,@\`L4(M%#(/`*%"- MA6C___]0QT7D`0```.BWO___@\00A<")180/A,WW__^#[`C_LQ@!``#_LQ0! M``#H08C__XN#'`$```^V`(/$$(/X!'0/@_@$?RI(@_@!#X=!]O__@^P,:@2- M1810:@2-A2C____'A2C___\I`P``Z?3U__^#^`@/A1CV___KU8GV4/^U(/__ M_XN#$`$``/^PB````&HB:@&-@SUO__]0:@!J!.B=B?__@\08_[,8`0``_[,4 M`0``QT6$!````.BRA___BX,<`0``#[8`@\00@_@$=`^#^`1_*DB#^`$/A[+U M__^#[`QJ!(U%A%!J!(V%+/___\>%+/___R4#``#I9?7__X/X"`^%B?7__^O5 MC78`@^P(C85$____4(V%:/___U#'A43___\`````Z-BX__^#Q!"%P(E%A'41 MBX5$____`85H____Z:'V__^#[`C_LQ@!``#_LQ0!``#H%8?__XN#'`$```^V M`(/$$(/X!'0/@_@$?RI(@_@!#X<5]?__@^P,:@2-1810QX4D____+@,``&H$ MC84D____ZST___KU8GV4/^U(/___XN#$`$``/^P(`$``&I( M:@&-@SUO__]0:@!J!.AQB/__@\08_[,8`0``_[,4`0``QT6$!````.B&AO__ MBX,<`0``#[8`@\00@_@$=`^#^`1_*DB#^`$/AX;T__^#[`QJ!(U%A%!J!(V% M%&__^+@QP!```/M@"#Q!"#^`1T#X/X!'\J2(/X`0^')_3__X/L#&H$C46$ M4&H$C85T____QX5T____\@(``.G:\___@_@(#X7^\___Z]6#[`QJ`&H"_[4@ M____BX,0`0``_W!H:AIJ`8V#/6___U!J`&H$Z(*'__^#Q"C_LQ@!``#_LQ0! M``#'180$````Z)>%__^+@QP!```/M@"#Q!"#^`1T#X/X!'\J2(/X`0^'E_/_ M_X/L#&H$C46$4&H$C85\____QX5\____Y`(``.E*\___@_@(#X5N\___Z]55 MB>564^@`````6X'#EOL``(MU"(M&!(/X`70X@_@"=`LQP(UE^%M>R<.)]HM& M$(7`=0VX)@````-&%(/`".OC@^P,4.@7T/__@\`@@\00Z^>-=@"+1@R#P"3K MW%6)Y5=64X'LG````.@`````6X'#,_L``(V#HF___XU5J/RY!````(G7B<;' M1:0`````B85H____B95@____\Z5FI8MU"(7V#X15!@``BTT,A M_[,8`0``_[,4`0``Z$N#__^+@QP!```/M@"#Q!"#^`1T#X/X!'\D2(/X`0^' M5/___X/L#&H$C46D4&H$C46$QT6$SP,``.D-____@_@(#X4Q____Z]N)]H/L M"%;_M63___]7:@"+50C_<@1HPK```.BWL___@\0@A<")1:1T9H/L"/]UB/]U MC.B7I?__6%K_LQ@!``#_LQ0!``#HO(+__XN#'`$```^V`(/$$(/X!'0/@_@$ M?R1(@_@!#X?%_O__@^P,:@2-1:10:@2-18#'18#3`P``Z7[^__^#^`@/A:+^ M___KVX/L"%;_M63___]7:@"+30C_<0AHP[```.@JL___@\0@A<")1:0/A8`" M``"+50B+0@2#^`$/A-D!``"#^`(/A#8!``!05O^U9/___U=J`(M5"/]R%/]R M&&C%L```Z"*X__^#Q""%P(E%I'1L@^P(_W6(_W6,Z,:D__]97O^S&`$``/^S M%`$``.CK@?__BX,<`0``#[8`@\00@_@$=`^#^`1_*DB#^`$/A_3]__^#[`QJ M!(U%I%!J!(V%%BT60BU6,*="+30R)`8E1!,=%I``````QP.F6 M_?__@^P(_W6(_W6,Z"2D__]86O^S&`$``/^S%`$``.A)@?__BX,<`0``#[8` M@\00@_@$=`^#^`1_*DB#^`$/AU+]__^#[`QJ!(U%I%#'A6S____O`P``:@2- MA6S____I!?W__X/X"`^%*?W__^O5@^P(5O^U9/___U=J`(M%"/]P$&C$L``` MZ%7,__^#Q""%P(E%I`^$G_[__X/L"/]UB/]UC.B-H___6%K_LQ@!``#_LQ0! M``#HLH#__XN#'`$```^V`(/$$(/X!'0/@_@$?RI(@_@!#X>[_/__@^P,:@2- M1:10:@2-A73____'A73____D`P``Z6[\__^#^`@/A9+\___KU8UV`(/L"%;_ MM63___]7:@"+30C_<1!HQ+```.@#M/__@\0@A<")1:0/A`7^__^#[`C_=8C_ M=8SH\Z+__UE>_[,8`0``_[,4`0``Z!B`__^+@QP!```/M@"#Q!"#^`1T#X/X M!'\J2(/X`0^'(?S__X/L#&H$C46D4&H$C85X____QX5X____W@,``.G4^___ M@_@(#X7X^___Z]60@^P(_W6(_W6,Z(:B__]?6/^S&`$``/^S%`$``.BK?___ MBX,<`0``#[8`@\00@_@$=`^#^`1_*DB#^`$/A[3[__^#[`QJ!(U%I%!J!(V% M?/___\>%?/___]<#``#I9_O__X/X"`^%B_O__^O5_W6(_[5H____BX,0`0`` M_W!L:AMJ`8V#/6___U!J`&H&Z`J!__^#Q!C_LQ@!``#_LQ0!``#'1:0&```` MZ!]___^+@QP!```/M@"#Q!"#^`1T#X/X!'\D2(/X`0^'*/O__X/L#&H$C46D M4&H$C464QT64Q@,``.GA^O__@_@(#X4%^___Z]N)]H/L#&H`:@+_M6C___^+ M@Q`!``#_<&AJ&FH!C8,];___4&H`:@3H?H#__X/$*/^S&`$``/^S%`$``,=% MI`0```#HDW[__XN#'`$```^V`(/$$(/X!'0/@_@$?R1(@_@!#X><^O__@^P, M:@2-1:10:@2-19S'19RQ`P``Z57Z__^#^`@/A7GZ___KVX/L#&H`:@%0BX,0 M`0``_W!H:AIJ`8V#/6___U!J`&H$Z/E___^#Q"C_LQ@!``#_LQ0!``#'1:0$ M````Z`Y^__^+@QP!```/M@"#Q!"#^`1T#X/X!'\D2(/X`0^'%_K__X/L#&H$ MC46D4&H$C46@QT6@J0,``.G0^?__@_@(#X7T^?__Z]N058GE5U93@>S<```` MZ`````!;@<,+]```C8/.;___C56(B=>)QORY!0```(F%+/___XF5)/___\=% MA`````#SI8M]"(M-"(7_BS$/E,*%]@^>P`G0@^`!=0N+202%R0^%N````(/L M#/]U"&H!_[4L____BX,0`0``_W!H:AIJ`8V#/6___U!J`&H$Z`E___^#Q"C_ MLQ@!``#_LQ0!``#'180$````Z!Y]__^+@QP!```/M@"#Q!"#^`1T"X/X!']4 M2(/X`7="@^P,:@2-1810:@2-18#'18!2!```4(N])/____PQP+G_____\J[W MT5'_M23___]J`VI_C8-';___4.AS?O__@\0PBT6$C67T6UY?R<.0@_@(=>_K MJY"+50R%T@^$/1$``/R-?___BX,<`0``#[8`@\00@_@$=`^#^`1_*DB#^`$/AS;^__^#[`QJ!(U%A%#' MA3#___^N!```:@2-A3#____IZ?W__X/X"`^%#?[__^O5@^P(_W(44.B'G?__ M@\00ZXF#[`AJ`5+H)\7__X/$$.EL____@^P(BT4,_W`,4NA@G?__Z^>)]HM% MR(7`#X7M````@^P(_W4,C85H____4,=%R`$```#H!*S__X/$$(7`B46$=0^+ M50B+"HG0BU`$Z:O^__^+30R+41"%TG01BT$$@_@!#X22````@_@"='J+50R+ M0AB%P'5?@^P(_[,8`0``_[,4`0``Z!YZ__^+@QP!```/M@"#Q!"#^`1T#X/X M!'\J2(/X`0^'/OW__X/L#&H$C46$4&H$C85D____QX5D____=P0``.GQ_/__ M@_@(#X45_?__Z]6#[`C____BTT,BU$0@\0@A=)T%8M!!(/X`0^$G0```(/X`@^$ M@0```(M5#(M"&(7`=6:#[`C_LQ@!``#_LQ0!``#'180$````Z"YY__^+@QP! M```/M@"#Q!"#^`1T#X/X!'\J2(/X`0^'3OS__X/L#&H$C46$4&H$C85L____ MQX5L____=00``.D!_/__@_@(#X4E_/__Z]6#[`C_4` M``"+10R#[`B#P`10C85H____4,=%S`$```#H&*K__X/$$(7`B46$#X00_O__ MBTT,BU$0A=)T$8M!!(/X`0^$D@```(/X`G1ZBU4,BT(8A/__BX,<`0``#[8`@\00@_@$=`^#^`1_*DB#^`$/AUW[__^# M[`QJ!(U%A%!J!(V%7/___\>%7/___WP$``#I$/O__X/X"`^%-/O__^O5@^P( M_W(44.BNFO__@\00ZY"#[`AJ`5+H3L+__X/$$.ES____@^P(BT4,_W`,4NB' MFO__Z^>05O^U+/___XN#$`$``/^PB````&HB:@&-@SUO__]0:@!J!.AE>?__ MBTT,BU$0@\0@A=)T%8M!!(/X`0^$G0```(/X`@^$@0```(M5#(M"&(7`=6:# M[`C_LQ@!``#_LQ0!``#'180$````Z$YW__^+@QP!```/M@"#Q!"#^`1T#X/X M!'\J2(/X`0^';OK__X/L#&H$C46$4&H$C85@____QX5@____>@0``.DA^O__ M@_@(#X5%^O__Z]6#[`C_4```"+10R#[`B#P`A0C85H M____4,=%T`$```#H.*C__X/$$(7`B46$#X0P_/__BTT,BU$0A=)T$8M!!(/X M`0^$D@```(/X`G1ZBU4,BT(8A%5/___X$$``#I,/G__X/X"`^%5/G__^O5@^P(_W(44.C.F/__@\00ZY"# M[`AJ`5+H;L#__X/$$.ES____@^P(BT4,_W`,4NBGF/__Z^>04O^U+/___XN# M$`$``/^PB````&HB:@&-@SUO__]0:@!J!.B%=___BTT,BU$0@\0@A=)T%8M! M!(/X`0^$G0```(/X`@^$@0```(M5#(M"&(7`=6:#[`C_LQ@!``#_LQ0!``#' M180$````Z&YU__^+@QP!```/M@"#Q!"#^`1T#X/X!'\J2(/X`0^'COC__X/L M#&H$C46$4&H$C858____QX58____?P0``.E!^/__@_@(#X5E^/__Z]6#[`C_ MD``&+I``!7 MZ0``F^H``$SI``!!Z0``-ND``*3J```KZ0``QP8`````C58$QP(`````@\($ MQP(`````@\($9L<"``#&0@(`@^P(5HV%:/___U#H5,'__X/$$(7`B46$=0N+ M30R)<1#I0____XM-#(M1$(72=!&+002#^`$/A)(```"#^`)T>HM5#(M"&(7` M=5^#[`C_LQ@!``#_LQ0!``#HSG/__XN#'`$```^V`(/$$(/X!'0/@_@$?RI( M@_@!#X?N]O__@^P,:@2-1810:@2-A43____'A43___^:!```Z:'V__^#^`@/ MA<7V___KU8/L"/]R%%#H/Y;__X/$$.N0@^P(:@%2Z-^]__^#Q!#I<____X/L M"(M%#/]P#%+H&);__^OGB?;&`@#I&/___V;'`@``Z0[____'`@````#I`___ M_\<"`````(/"!.O8QP(`````@\($Z]7'`@````"#P@3KU,<"`````(/"!.O4 MQP(`````@\($Z]3'`@````"#P@3KU,<&`````(U6!.O4QP8`````C58$Z]3' M!@````"-5@3KU(M-#(M1$(72=!6+002#^`$/A.P```"#^`(/A-````"+50R+ M0AB%P`^%K@```&H(_[4L____BX,0`0``_W!L:AMJ`8V#/6___U!J`&H&Z$IT M__^#Q!C_LQ@!``#_LQ0!``#H9G+__XN#'`$```^V`(/$$(/X!'0+@_@$?UA( M@_@!=TB#[`QJ!(U%A%!J!(V%2/___U#'A4C___^5!```B[TD_____#'`N?__ M___RKO?14?^U)/___VH#:G^-@T=O__]0Z+5S__^#Q#"X!@```.D[]?__@_@( M=?'KIX/L"/]R%%#HK93__X/$$.D^____@^P(:@%2Z$J\__^#Q!#I'?___X/L M"(M%#/]P#%+H@Y3__^OGD%"+10R#P!!0BT4,@\`,4(V%:/___U#HD:;__X/$ M$(7`B46$#X0I]___BTT,BU$0A=)T$8M!!(/X`0^$D@```(/X`G1ZBU4,BT(8 MA%3/___XH$``#I*?3__X/X M"`^%3?3__^O5@^P(_W(44.C'D___@\00ZY"#[`AJ`5+H9[O__X/$$.ES____ M@^P(BT4,_W`,4NB@D___Z^>)]E#_M2S___^+@Q`!``#_L(@```!J(FH!C8,] M;___4&H`:@3H?7+__XM-#(M1$(/$((72=!6+002#^`$/A)T```"#^`(/A($` M``"+50R+0AB%P'5F@^P(_[,8`0``_[,4`0``QT6$!````.AF% M4/___X0$``#I.?/__X/X"`^%7?/__^O5@^P(_W(44.C7DO__@\00ZXF#[`AJ M`5+H=[K__X/$$.EL____@^P(BT4,_W`,4NBPDO__Z^>)]HM%V(7`#X7I```` M4(M%#(/`&%"+10R#P!10C85H____4,=%V`$```#H"Z?__X/$$(7`B46$#X1# M]?__BTT,BU$0A=)T$8M!!(/X`0^$D@```(/X`G1ZBU4,BT(8A%//___Z0$``#I0_+__X/X"`^%9_+__^O5 M@^P(_W(44.CAD?__@\00ZY"#[`AJ`5+H@;G__X/$$.ES____@^P(BT4,_W`, M4NBZD?__Z^=0_[4L____BX,0`0``_["(````:B)J`8V#/6___U!J`&H$Z)EP M__^+30R+41"#Q""%TG05BT$$@_@!#X2=````@_@"#X2!````BU4,BT(8AB\?__@^P,:@2-1810:@2-A4#____'A4#___^@!```Z57Q M__^#^`@/A7GQ___KU8/L"/]R%%#H\Y#__X/$$.N)@^P(:@%2Z).X__^#Q!#I M;/___X/L"(M%#/]P#%+HS)#__^OGB?:#[`B-A3C___]0C85H____4,>%./__ M_P````#H=)___X/$$(7`B46$=1&+A3C___\!A6C____I`?G__XM-#(M!$(7` M=!&+402#^@$/A)(```"#^@)T>HM-#(M!&(7`=5^#[`C_LQ@!``#_LQ0!``#H MC&W__XN#'`$```^V`(/$$(/X!'0/@_@$?RI(@_@!#X>L\/__@^P,:@2-1810 M:@2-A33____'A33___^I!```Z5_P__^#^`@/A8/P___KU8/L"/]Q%%#H_8__ M_X/$$.N0@^P(:@%0Z)VW__^#Q!#I<____X/L"(M5#/]R#%#HUH___^OG4/^U M+/___XN#$`$``/^P(`$``&I(:@&-@SUO__]0:@!J!.BU;O__BU4,BT(0@\0@ MA<#'180$````=!&+4@2#^@$/A)(```"#^@)T>HM-#(M!&(7`=5^#[`C_LQ@! M``#_LQ0!``#HHFS__XN#'`$```^V`(/$$(/X!'0/@_@$?RI(@_@!#X?"[___ M@^P,:@2-1810:@2-A7#____'A7#___]N!```Z77O__^#^`@/A9GO___KU8/L M"/]Q%%#H$X___X/$$.N0@^P(:@%0Z+.V__^#Q!#I<____X/L"(M5#/]R#%#H M[([__^OGB?:+50R+0A"%P'01BU($@_H!#X22````@_H"='J+30R+01B%P'5? M@^P(_[,8`0``_[,4`0``Z.=K__^+@QP!```/M@"#Q!"#^`1T#X/X!'\J2(/X M`0^'!^___X/L#&H$C46$4&H$C85T____QX5T____:`0``.FZ[O__@_@(#X7> M[O__Z]6#[`C_<110Z%B.__^#Q!#KD(/L"&H!4.CXM?__@\00Z7/___^#[`B+ M50S_<@Q0Z#&.___KYXUV`(/L#&H`:@+_M2S___^+@Q`!``#_<&AJ&FH!C8,] M;___4&H`:@3H"FW__X/$*/^S&`$``/^S%`$``,=%A`0```#H'VO__XN#'`$` M``^V`(/$$(/X!'0/@_@$?RI(@_@!#X<_[O__@^P,:@2-1810:@2-A7S____' MA7S___]:!```Z?+M__^#^`@/A1;N___KU56)Y5=64X/L#.@`````6X'#&N$` M`(M]"(M'!(/X`71D@_@"=`\Q]HUE]%N)\%Y?R<.-=@"+1Q"%P'4WOB8```"+ M1Q2-=$8(BT<@A575E.![+P```#H`````%N!PW?@``"-5:B-@^)O__^)U_RY!0`` M`(G&B95$____QT6D`````(F%3/____.EBU4(A=(/A',*``"+10R%P`^$W@D` M`(/L#/]U".C__O__@\00A<")18@/A;T```"#[`S_M4S___]J`(V#]F___U"+ M@Q`!``#_<'AJ'FH!C8,];___4&H`:A?H9FO__X/$*/^S&`$``/^S%`$``,=% MI!<```#H>VG__XN#'`$```^V`(/$$(/X!'0+@_@$?U5(@_@!=T*#[`QJ!(U% MI%!J!(U%F,=%F%X%``!0B[U$_____#'`N?_____RKO?14?^U1/___VH#:G^- M@T=O__]0Z-!J__^#Q#"+1:2-9?1;7E_)PXGV@_@(=>[KJI"#[`Q0Z)]H__^# MQ!"%P(E%C`^$:0@``%?_=8AJ`%#H16K__XM%C%E>B460C4604(U]C%>-=8A6 M:@"+50C_,FCAL```B85(____Z(J9__^#Q""%P(E%I'1H@^P(_W6(_W6,Z&J+ M__]86O^S&`$``/^S%`$``.B/:/__BX,<`0``#[8`@\00@_@$=`^#^`1_)$B# M^`$/AU+___^#[`QJ!(U%I%!J!(U%A,=%A'`%``#I"____X/X"`^%+____^O; MB?:#[`C_M4C___]75FH`BT4(_W`$:.*P``#H^YC__X/$((7`B46D=&:#[`C_ M=8C_=8SHVXK__U]8_[,8`0``_[,4`0``Z`!H__^+@QP!```/M@"#Q!"#^`1T M#X/X!'\D2(/X`0^'P_[__X/L#&H$C46D4&H$C46`QT6`=`4``.E\_O__@_@( M#X6@_O__Z]N#[`C_M4C___]75FH`BU4(_W((:..P``#H;IC__X/$((7`B46D M#X6;__^#Q""%P(E%I`^%O00``(M5"(M"!(/X`0^$%@0``(/X M`@^$=0,``%'_M4C___]75FH`BT4(_W`D_W`H:.:P``#H(YW__X/$((7`B46D M=&R#[`C_=8C_=8SHQXG__UA:_[,8`0``_[,4`0``Z.QF__^+@QP!```/M@"# MQ!"#^`1T#X/X!'\J2(/X`0^'K_W__X/L#&H$C46D4&H$C85D____QX5D____ MH04``.EB_?__@_@(#X6&_?__Z]6#[`C_M4C___]75FH`BU4(_W(L:.>P``#H M5)?__X/$((7`B46D=&R#[`C_=8C_=8SH-(G__UY?_[,8`0``_[,4`0``Z%EF M__^+@QP!```/M@"#Q!"#^`1T#X/X!'\J2(/X`0^''/W__X/L#&H$C46D4&H$ MC85@____QX5@____I04``.G/_/__@_@(#X7S_/__Z]51_[5(____5U9J`(M% M"/]P,/]P-&CHL```Z/R;__^#Q""%P(E%I'1L@^P(_W6(_W6,Z*"(__]86O^S M&`$``/^S%`$``.C%9?__BX,<`0``#[8`@\00@_@$=`^#^`1_*DB#^`$/AXC\ M__^#[`QJ!(U%I%!J!(V%7/___\>%7/___ZL%``#I._S__X/X"`^%7_S__^O5 M4/^U2/___U=6:@"+50C_T__^#Q!"%P(E%I`^%EP`` M`(M5D(M-C"G*C4+_BW6(.?!W%HM%#(D0B4@$QT6D`````#'`Z8/[__^#[`A6 M4>A;A___6%K_LQ@!``#_LQ0!``#'1:07````Z'ED__^+@QP!```/M@"#Q!"# M^`1T#X/X!'\J2(/X`0^'//O__X/L#&H$C46D4,>%4/___[L%``!J!(V%4/__ M_^GO^O__@_@(#X43^___Z]6#[`C_=8C_=8SHZ(;__UE>_[,8`0``_[,4`0`` MZ`UD__^+@QP!```/M@"#Q!"#^`1T#X/X!'\J2(/X`0^'T/K__X/L#&H$C46D M4&H$C854____QX54____M`4``.F#^O__@_@(#X6G^O__Z]6)]H/L"/^U2/__ M_U=6:@"+50C_6__^#Q""%P(E% MI`^$R/O__X/L"/]UB/]UC.BWA?__6%K_LQ@!``#_LQ0!``#HW&+__XN#'`$` M``^V`(/$$(/X!'0/@_@$?RI(@_@!#X>?^?__@^P,:@2-1:10:@2-A6S____' MA6S___^3!0``Z5+Y__^#^`@/A7;Y___KU9"#[`C_=8C_=8SH2H7__UE>_[,8 M`0``_[,4`0``Z&]B__^+@QP!```/M@"#Q!"#^`1T#X/X!'\J2(/X`0^',OG_ M_X/L#&H$C46D4&H$C85P____QX5P____C`4``.GE^/__@_@(#X4)^?__Z]6# M[`C_M4C___]75FH`BU4(_W(0:.2P``#H>ZW__X/$((7`B46D#X2!^O__@^P( M_W6(_W6,Z+.$__]?6/^S&`$``/^S%`$``.C88?__BX,<`0``#[8`@\00@_@$ M=`^#^`1_*DB#^`$/AYOX__^#[`QJ!(U%I%!J!(V%=/___\>%=/___X4%``#I M3OC__X/X"`^%%?/___W@%``#I2??__X/X"`^% M;??__^O5_W6(_[5,____BX,0`0``_W!L:AMJ`8V#/6___U!J`&H&Z#)B__^# MQ!C_LQ@!``#_LQ0!``#'1:0&````Z$=@__^+@QP!```/M@"#Q!"#^`1T#X/X M!'\D2(/X`0^'"O?__X/L#&H$C46D4&H$C464QT649P4``.G#]O__@_@(#X7G M]O__Z]N)]H/L#&H`:@+_M4S___^+@Q`!``#_<&AJ&FH!C8,];___4&H`:@3H MIF'__X/$*/^S&`$``/^S%`$``,=%I`0```#HNU___XN#'`$```^V`(/$$(/X M!'0/@_@$?R1(@_@!#X=^]O__@^P,:@2-1:10:@2-19S'19Q2!0``Z3?V__^# M^`@/A5OV___KVX/L#&H`:@%0BX,0`0``_W!H:AIJ`8V#/6___U!J`&H$Z"%A M__^#Q"C_LQ@!``#_LQ0!``#'1:0$````Z#9?__^+@QP!```/M@"#Q!"#^`1T M#X/X!'\D2(/X`0^'^?7__X/L#&H$C46D4&H$C46@QT6@2@4``.FR]?__@_@( M#X76]?__Z]N058GE5U93@>P<`0``Z`````!;@<,SU0``C8,2%=/___P````#SI6:EBTT(BW4(A?:+ M,0^4PH7V#Y[`"="#X`%U"XM1!(72#X7(````@^P,_W4(:@'_M>S^__^+@Q`! M``#_<&AJ&FH!C8,];___4&H`:@3H*6#__X/$*/^S&`$``/^S%`$``,>%=/__ M_P0```#H.U[__XN#'`$```^V`(/$$(/X!'0+@_@$?V%(@_@!=TN#[`QJ!(V% M=/___U!J!(V%%OK MGI"+30R%R0^$?2D``(U]N/RY"@```/.KC006.<*)E5C___\/@]8```"-A6K_ M__^)A>C^__^-O6C___^-=@"#[`AFBP+_M>C^__]FB85H____5XU"`HF%6/__ M_^B.A?__@\00A<")A73___\/A?4G``!FBX5J____9CW@L`^&C"8```^WP"WA ML```@_@.#X<;)0``B=DKC(.,+/___^&%\/[__\,&``!J M!(V%\/[__^G"_?__@_@(#X7F_?__Z]*#[`C_<210Z'1^__^#Q!#K@X/L"/]R M,%#H8W[__X/$$.EE____@^P(:@%2Z`"F__^#Q!#I1/___X/L"(M%#/]P'%+H M.7[__^OG@^P(:@%2Z-RE__^#Q!#I`?___X/L"(M%#/]P#%+H%7[__^OGC78` MBT6XA<`/A5D!``"#[`C_=0R-A5C___]0QT6X`0```.BXC/__@\00A<")A73_ M__]U$HUV`(M5"(L*B="+4`3I-?[__XM%#(M0$(72=!6+0`2#^`$/A/H```"# M^`(/A-X```"+10R+4""%TG05BT`$@_@!#X2W````@_@"#X2;````BU4,BT(T MAK_/__@^P,:@2-A73___]0:@2-A53____'A53_ M__]6!@``Z5O\__^#^`@/A7_\___KTH/L"/]Q)%#H#7W__X/$$.N-@^P(_W(P M4.C\?/__@\00Z6____^#[`AJ`5+HF:3__X/$$.E2____@^P(BTT,_W$<4NC2 M?/__Z^>#[`AJ`5+H=:3__X/$$.D/____@^P(BTT,_W$,4NBN?/__Z^>+30R+ M41"%TG05BT$$@_@!#X0V`0``@_@"#X0:`0``BTT,BU$@A=)T%8M!!(/X`0^$ M\P```(/X`@^$UP```(M5#(M"-(7`#X6U````BTT,BT$HA<`/A9,```!0_[7L M_O__BX,0`0``_["(````:B)J`8V#/6___U!J`&H$Z#-;__^#Q!C_LQ@!``#_ MLQ0!``#'A73___\$````Z$59__^+@QP!```/M@"#Q!"#^`1T#X/X!'\M2(/X M`0^'4?O__X/L#&H$C85T____4&H$C85<____QX5<____5`8``.D!^___@_@( M#X4E^___Z]*#[`C_<210Z+-[__^#Q!#I6?___X/L"/]R,%#HGWO__X/$$.DW M____@^P(:@%2Z#RC__^#Q!#I%O___X/L"(M%#/]P'%+H=7O__^OG@^P(:@%2 MZ!BC__^#Q!#IT_[__X/L"(M%#/]P#%+H47O__^OGC78`BT6\A<`/A5$!``"+ M10R#[`B#P`10C858____4,=%O`$```#H\(G__X/$$(7`B85T____#X0W_?__ MBT4,BU`0A=)T%8M`!(/X`0^$^@```(/X`@^$W@```(M%#(M0((72=!6+0`2# M^`$/A+<```"#^`(/A)L```"+50R+0C2%P'5]BTT,BT$HA%3/___UL&``#IH?G__X/X"`^%Q?G__^O2 M@^P(_W$D4.A3>O__@\00ZXV#[`C_%4/___UD&``#I1?C__X/X"`^%:?C__^O2@^P(_W$D4.CW>/__ M@\00Z5G___^#[`C__K__XM%#(M0$(72=!6+0`2#^`$/A/H` M``"#^`(/A-X```"+10R+4""%TG05BT`$@_@!#X2W````@_@"#X2;````BU4, MBT(TA7V__^#^`@/A0GW___KTH/L"/]Q)%#HEW?__X/$$.N-@^P( M_W(P4.B&=___@\00Z6____^#[`AJ`5+H(Y___X/$$.E2____@^P(BTT,_W$< M4NA<=___Z^>#[`AJ`5+H_Y[__X/$$.D/____@^P(BTT,_W$,4N@X=___Z^>) M]HM%#(M0$(72=!6+0`2#^`$/A#8!``"#^`(/A!H!``"+10R+4""%TG05BT`$ M@_@!#X3S````@_@"#X37````BU4,BT(TA<`/A;4```"+30R+02B%P`^%DP`` M`%?_M>S^__^+@Q`!``#_L(@```!J(FH!C8,];___4&H`:@3HNU7__X/$&/^S M&`$``/^S%`$``,>%=/___P0```#HS5/__XN#'`$```^V`(/$$(/X!'0/@_@$ M?RU(@_@!#X?9]?__@^P,:@2-A73___]0:@2-A4C____'A4C___]>!@``Z8GU M__^#^`@/A:WU___KTH/L"/]Q)%#H.W;__X/$$.E9____@^P(_W(P4.@G=O__ M@\00Z3?___^#[`AJ`5+HQ)W__X/$$.D6____@^P(BTT,_W$<4NC]=?__Z^># M[`AJ`5+HH)W__X/$$.G3_O__@^P(BTT,_W$,4NC9=?__Z^>-=@"+=<2%]@^% M304``,=%Q`$```"+50R+0@2#^`$/A.<#``"#^`)T#(GVBT4(BPCIS??__X/L M#&H(Z'!2__^#Q!"%P(G#`@``B<*)V"N#&#?____@C78`H,@``%3'``!, MQP``J<@``$+'```WQP``+,<``++(```AQP``%L<```O'``"[R````,<``/7& M``#JQ@``Q,@``-_&``#'!@````"-5@3'`@````"#P@3'`@````"#P@1FQP(` M`,9"`@"#[`A6C858____4.ATG___@\00A<")A73___]U"XM%#(EP$.D0]___ MBT4,BU`0A=)T%8M`!(/X`0^$^@```(/X`@^$W@```(M%#(M0((72=!6+0`2# M^`$/A+<```"#^`(/A)L```"+50R+0C2%P'5]BTT,BT$HA%-/___WD&``#I>O/__X/X"`^%GO/__^O2 M@^P(_W$D4.@L=/__@\00ZXV#[`C_%./___W0&``!0B[WD M_O___#'`N?_____RKO?14?^UY/[__VH#:G^-@T=O__]0Z#A1__^#Q#"X!@`` M`.FM\?__@_@(=?'KI(/L"/]Q)%#H,'+__X/$$.DZ____@^P(_W(P4.@<# M[`AJ`5+HE9G__X/$$.FT_O__@^P(BTT,_W$,4NC.+10Q2@\`04(M% M#(/`#%"-A5C___]0Z-V#__^#Q!"%P(F%=/___P^$Q//__XM-#(M1$(72=!6+ M002#^`$/A/H```"#^`(/A-X```"+30R+42"%TG05BT$$@_@!#X2W````@_@" M#X2;````BU4,BT(TA#[`AJ`5+H2)C__X/$$.D/____@^P(BT4,_W`, M4NB!-=@"+10R+4!"%TG05BT`$@_@!#X0V`0``@_@"#X0:`0``BT4, MBU`@A=)T%8M`!(/X`0^$\P```(/X`@^$UP```(M5#(M"-(7`#X6U````BTT, MBT$HA<`/A9,```!1_[7L_O__BX,0`0``_["(````:B)J`8V#/6___U!J`&H$ MZ`-/__^#Q!C_LQ@!``#_LQ0!``#'A73___\$````Z!5-__^+@QP!```/M@"# MQ!"#^`1T#X/X!'\M2(/X`0^'(>___X/L#&H$C85T____4&H$C85`____QX5` M____8P8``.G1[O__@_@(#X7U[O__Z]*#[`C_<210Z(-O__^#Q!#I6?___X/L M"/]R,%#H;V___X/$$.DW____@^P(:@%2Z`R7__^#Q!#I%O___X/L"(M-#/]Q M'%+H16___^OG@^P(:@%2Z.B6__^#Q!#IT_[__X/L"(M-#/]Q#%+H(6___^OG MC78`BT7(A<`/A54!``!0BT4,@\`84(M%#(/`%%"-A5C___]0QT7(`0```.@; M@?__@\00A<")A73___\/A`+Q__^+10R+4!"%TG05BT`$@_@!#X3Z````@_@" M#X3>````BT4,BU`@A=)T%8M`!(/X`0^$MP```(/X`@^$FP```(M5#(M"-(7` M=7V+30R+02B%P'5B@^P(_[,8`0``_[,4`0``Z+!+__^+@QP!```/M@"#Q!"# M^`1T#X/X!'\M2(/X`0^'O.W__X/L#&H$C85T____4&H$C84L____QX4L____ M@P8``.EL[?__@_@(#X60[?__Z]*#[`C_<210Z!YN__^#Q!#KC8/L"/]R,%#H M#6[__X/$$.EO____@^P(:@%2Z*J5__^#Q!#I4O___X/L"(M-#/]Q'%+HXVW_ M_^OG@^P(:@%2Z(:5__^#Q!#I#____X/L"(M-#/]Q#%+HOVW__^OGD(M-#(M1 M$(72=!6+002#^`$/A#8!``"#^`(/A!H!``"+30R+42"%TG05BT$$@_@!#X3S M````@_@"#X37````BU4,BT(TA<`/A;4```"+30R+02B%P`^%DP```%#_M>S^ M__^+@Q`!``#_L(@```!J(FH!C8,];___4&H`:@3H0TS__X/$&/^S&`$``/^S M%`$``,>%=/___P0```#H54K__XN#'`$```^V`(/$$(/X!'0/@_@$?RU(@_@! M#X=A[/__@^P,:@2-A73___]0:@2-A3#____'A3#___]_!@``Z1'L__^#^`@/ MA37L___KTH/L"/]Q)%#HPVS__X/$$.E9____@^P(_W(P4.BO;/__@\00Z3?_ M__^#[`AJ`5+H3)3__X/$$.D6____@^P(BT4,_W`<4NB%;/__Z^>#[`AJ`5+H M*)3__X/$$.G3_O__@^P(BT4,_W`,4NAA;/__Z^>-=@"+=#[`AJ`5+HQI+__X/$ M$.D/____@^P(BTT,_W$,4NC_:O__Z^>0BTT,BU$0A=)T%8M!!(/X`0^$-@$` M`(/X`@^$&@$``(M-#(M1((72=!6+002#^`$/A/,```"#^`(/A-<```"+50R+ M0C2%P`^%M0```(M-#(M!*(7`#X63````4?^U[/[__XN#$`$``/^PB````&HB M:@&-@SUO__]0:@!J!.B#2?__@\08_[,8`0``_[,4`0``QX5T____!````.B5 M1___BX,<`0``#[8`@\00@_@$=`^#^`1_+4B#^`$/AZ'I__^#[`QJ!(V%=/__ M_U!J!(V%&/___\>%&/___Z(&``#I4>G__X/X"`^%=>G__^O2@^P(_W$D4.@# M:O__@\00Z5G___^#[`C_#[`AJ`5+H"Y#__X/$$.D/____@^P(BTT,_W$,4NA$:/__ MZ^>)]HM%#(M0$(72=!6+0`2#^`$/A#8!``"#^`(/A!H!``"+10R+4""%TG05 MBT`$@_@!#X3S````@_@"#X37````BU4,BT(TA<`/A;4```"+30R+02B%P`^% MDP```%#_M>S^__^+@Q`!``#_L(@```!J(FH!C8,];___4&H`:@3HQT;__X/$ M&/^S&`$``/^S%`$``,>%=/___P0```#HV43__XN#'`$```^V`(/$$(/X!'0/ M@_@$?RU(@_@!#X?EYO__@^P,:@2-A73___]0:@2-A1#____'A1#___^I!@`` MZ97F__^#^`@/A;GF___KTH/L"/]Q)%#H1V?__X/$$.E9____@^P(_W(P4.@S M9___@\00Z3?___^#[`AJ`5+HT([__X/$$.D6____@^P(BTT,_W$<4N@)9___ MZ^>#[`AJ`5+HK([__X/$$.G3_O__@^P(BTT,_W$,4NCE9O__Z^>-=@"+1=2% MP`^%50$``%"+10R#P#10BT4,@\`P4(V%6/___U#'1=0!````Z#][__^#Q!"% MP(F%=/___P^$QNC__XM%#(M0$(72=!6+0`2#^`$/A/H```"#^`(/A-X```"+ M10R+4""%TG05BT`$@_@!#X2W````@_@"#X2;````BU4,BT(TA`Y?__@^P,:@2-A73___]0:@2-A03____'A03___^R!@``Z3#E M__^#^`@/A53E___KTH/L"/]Q)%#HXF7__X/$$.N-@^P(_W(P4.C19?__@\00 MZ6____^#[`AJ`5+H;HW__X/$$.E2____@^P(BTT,_W$<4NBG9?__Z^>#[`AJ M`5+H2HW__X/$$.D/____@^P(BTT,_W$,4NB#9?__Z^>0BT4,BU`0A=)T%8M` M!(/X`0^$-@$``(/X`@^$&@$``(M%#(M0((72=!6+0`2#^`$/A/,```"#^`(/ MA-<```"+50R+0C2%P`^%M0```(M-#(M!*(7`#X63````4/^U[/[__XN#$`$` M`/^PB````&HB:@&-@SUO__]0:@!J!.@'1/__@\08_[,8`0``_[,4`0``QX5T M____!````.@90O__BX,<`0``#[8`@\00@_@$=`^#^`1_+4B#^`$/AR7D__^# M[`QJ!(V%=/___U!J!(V%"/___\>%"/___ZX&``#IU>/__X/X"`^%^>/__^O2 M@^P(_W$D4.B'9/__@\00Z5G___^#[`C_%_/[__[D&``#I<.+__X/X"`^%E.+__^O2@^P( M_W$D4.@B8___@\00ZXV#[`C_'__X/L#&H$C85T____4&H$C84` M____QX4`____M08``.D5X?__@_@(#X4YX?__Z]*#[`C_<210Z,=A__^#Q!#I M6?___X/L"/]R,%#HLV'__X/$$.DW____@^P(:@%2Z%")__^#Q!#I%O___X/L M"(M-#/]Q'%+HB6'__^OG@^P(:@%2Z"R)__^#Q!#IT_[__X/L"(M-#/]Q#%+H M96'__^OGC78`BT7````BT4,BU`@ MA=)T%8M`!(/X`0^$MP```(/X`@^$FP```(M5#(M"-(7`=7V+30R+02B%P'5B M@^P(_[,8`0``_[,4`0``Z%(]__^+@QP!```/M@"#Q!"#^`1T#X/X!'\M2(/X M`0^'7M___X/L#&H$C85T____4&H$C84<____QX4<____G`8``.D.W___@_@( M#X4RW___Z]*#[`C_<210Z,!?__^#Q!#KC8/L"/]R,%#HKU___X/$$.EO____ M@^P(:@%2Z$R'__^#Q!#I4O___X/L"(M-#/]Q'%+HA5___^OG@^P(:@%2Z"B' M__^#Q!#I#____X/L"(M-#/]Q#%+H85___^OGC78`Q@(`Z:S^__]FQP(``.FB M_O__QP(`````Z9?^___'`@````"#P@3KV,<"`````(/"!.O5QP(`````@\($ MZ]3'`@````"#P@3KU,<"`````(/"!.O4QP(`````@\($Z]3'!@````"-5@3K MU,<&`````(U6!.O4QP8`````C58$Z]2+10R+4!"%TG05BT`$@_@!#X0K`0`` M@_@"#X0/`0``BT4,BU`@A=)T%8M`!(/X`0^$Z````(/X`@^$S````(M5#(M" M-(7`#X6J````BTT,BT$HA<`/A8@```!J"(V#07#__U"+@Q`!``#_<&QJ&VH! MC8,];___4&H`:@;H9#W__X/$&/^S&`$``/^S%`$``.B`.___BX,<`0``#[8` M@\00@_@$=`^#^`1_+4B#^`$/A]OK__^#[`QJ!(V%=/___U#'A2#___^7!@`` M:@2-A2#____IB^O__X/X"`^%K^O__^O2@^P(_W$D4.CN7?__@\00Z63___^# M[`C_````BTT,BU$@A=)T%8M! M!(/X`0^$MP```(/X`@^$FP```(M5#(M"-(7`=7V+30R+02B%P'5B@^P(_[,8 M`0``_[,4`0``Z"XZ__^+@QP!```/M@"#Q!"#^`1T#X/X!'\M2(/X`0^'.MS_ M_X/L#&H$C85T____4&H$C84D____QX4D____C`8``.GJV___@_@(#X4.W/__ MZ]*#[`C_<210Z)Q<__^#Q!#KC8/L"/]R,%#HBUS__X/$$.EO____@^P(:@%2 MZ"B$__^#Q!#I4O___X/L"(M%#/]P'%+H85S__^OG@^P(:@%2Z`2$__^#Q!#I M#____X/L"(M%#/]P#%+H/5S__^OGC78`BT4,BU`0A=)T%8M`!(/X`0^$-@$` M`(/X`@^$&@$``(M%#(M0((72=!6+0`2#^`$/A/,```"#^`(/A-<```"+50R+ M0C2%P`^%M0```(M-#(M!*(7`#X63````4/^U[/[__XN#$`$``/^PB````&HB M:@&-@SUO__]0:@!J!.B_.O__@\08_[,8`0``_[,4`0``QX5T____!````.C1 M./__BX,<`0``#[8`@\00@_@$=`^#^`1_+4B#^`$/A]W:__^#[`QJ!(V%=/__ M_U!J!(V%*/___\>%*/___X8&``#IC=K__X/X"`^%L=K__^O2@^P(_W$D4.@_ M6___@\00Z5G___^#[`C_%]/[__[X&``#I*-G__X/X"`^%3-G__^O2@^P(_W$D4.C:6?__ M@\00ZXV#[`C_%=/___P0```!T%8M1!(/Z`0^$^@```(/Z`@^$W@`` M`(M-#(M!((7`=!6+402#^@$/A+<```"#^@(/A)L```"+30R+032%P'5]BU4, MBT(HA%8/___TT&``#I MTM?__X/X"`^%]M?__^O2@^P(_W(D4.B$6/__@\00ZXV#[`C_<3!0Z'-8__^# MQ!#I;____X/L"&H!4.@0@/__@\00Z5+___^#[`B+50S_#[`AJ`5#HR'[__X/$$.D/____@^P(BU4, M_W(,4.@!5___Z^>-=@"#[`QJ`&H"_[7L_O__BX,0`0``_W!H:AIJ`8V#/6__ M_U!J`&H$Z-HU__^#Q"C_LQ@!``#_LQ0!``#'A73___\$````Z.PS__^+@QP! M```/M@"#Q!"#^`1T#X/X!'\M2(/X`0^'^-7__X/L#&H$C85T____4&H$C85L M____QX5L____.P8``.FHU?__@_@(#X7,U?__Z]*0D%6)Y593@^PP0)@`` MZ`````!;@<.#J0``:/\/``"*@^5P__]J`(B%B.___XV%B>___U#'A13:__\` M````Z%\T__^#Q`QH_P\``&H`C86)W___BI/EIP``O*<``'*F``#^I0``BJ4``!ZG M```>IP``%J4``%%H``$``(J#Y7#__VH`B(5XWO__C85YWO__4(V]+-K__XVU M>-[__\>%*-K__P$```#HDC+__XD\),>%+-K__P````#H0##__XDT).C8,/__ M@\00A%>-[__W5N:V['A7S>__]O=VX`D(/L#&H$5_PQP(GWN?_____R MKO?1459J!(V%*-K__U!J`VH$C8/@%*-K__P(```#H2#'__XD\),>%)-K__P`` M``#H]B[__XDT).B.+___@\00A<`/A,?^___'A6C=__]U;FMNQX5LW?__;W=N M`.FN_O__5V@``0``BH/E%6-S__W5N:V['A5S<__]O=VX`Z3K^__]6:``!``"*@^5P__]J M`(B%2-O__XV%2=O__U"-O1S:__^-M4C;___'A2C:__\$````Z&`P__^)/"3' MA1S:__\`````Z`XN__^)-"3HIB[__X/$$(7`#X3?_?__QX5(V___=6YK;L>% M3-O__V]W;@#IQOW__U%H``$``(J#Y7#__VH`B(4XVO__C84YVO__4(V]&-K_ M_XVU.-K__\>%*-K__P<```#H["___XD\),>%&-K__P````#HFBW__XDT).@R M+O__@\00A<`/A&O]___'A3C:__]U;FMNQX4\VO__;W=N`.E2_?__B?:+D_P` M``"+`H7`=`T]_P\``'\&QP(`$```@^P,BX,@`0``_S#HLR___X/$$(7`B844 MVO__=3:+@_P```"+`(7`=6V+@PP!``"+`(7`#X0\_/__@^P,4.CQ+O__@\00 MA<")A13:__\/A"+\__^#[`R-A33:__]0Z$$N__]86HV%,-K__U#_M33:___H M;2W__UC_M3#:___H42S__U__M33:___H%2S__X/$$.G?^___@^P,4.BD+/__ M@\00A<")A13:__\/A'G___^#[`R-A33:__]0Z.0M__]?6(V%,-K__U#_M33: M___H$"W__U[_M3#:___H]"O__UG_M33:___HN"O__X/$$.DV____@^P(:,`! M``"-@R:!__]0Z&P%``!86FC``0``C8,[@?__4.A9!0``@\00Z3'[__^0:*0` M``"-@V2!__]0BX,0`0``_W`0:@1J`8V#L('__U!J`&H&Z++O__@\0,C56(4O\V:@.)E03:___H6"S__X/$ M$(7`>`^+19@E`/```#T`0```=%]0:/\/``"+LR`!``#_-E?HWBW__X/L"&HO M5^A#+?__@\0@A<`/A/OY___&``!0_[4$VO__5VH#Z`8L__^#Q!"%P`^(WOG_ M_XM%F"4`\```/0!````/A6+ M30R+`8M5"(E"!,<"`````(L!A7\G#D%!2_W`2+!V;! MR`C!R!!FP<@(B0:#QP2+!V;!R`C!R!!FP<@(B48$@\<$BP=FP<@(P<@09L'( M"(E&"(/'!(L'9L'(",'($&;!R`B)1@R#QP2+!V;!R`C!R!!FP<@(B480@\<$ MBP=FP<@(P<@09L'("(E&%(/'!(L'9L'(",'($&;!R`B)1AB#QP2+!V;!R`C! MR!!FP<@(B48<@\<$BP=FP<@(P<@09L'("(/'!(7`B48@=0N+1?"-9?1;7E_) MPX/L#%#H:RC__X/$$(7`B48D=!!1_W8@5U#HEBG__X/$$.O2:,\```"-@T2" M__]0BX,0`0``_W`0:@1J`8V#D(+__U!J`&H&Z%@J___'1?`&````D(/$(.N< MC78`5HV#KX+__U"+@Q`!``#_<#!J#&H!C8.0@O__4&H`:@?H(RK__\=%\`<` M``#KRHGV5XV#KX+__U"+@Q`!``#_G@``BW4(A?9T&HM&((7`=`>+ M5B2%TG46_+D*````,<")]_.KC67T6UY?R<.)]E%0:@!2Z"XI__]8_W8DZ/4H M__^#Q!#KTE6)Y5=64X/L%.@`````6X'#!IX``(M]"(MU#,=%\`````!65^C7 M)?__@\00A@?*?__QT7P:0```(/$(.O$C78` MZ+LF____,%>+@Q`!``#_<%!J%.O*D(GV58GE5U93@\2`Z`````!;@<-NG0`` M,?:-N\:"__^-18A05VH#B46$Z,PF__^#Q!"%P`^(N0$``(M5F(G0)0#P```] M`$````^$1`$``(/L#%?HTR7__[X!````@\00@_X!=&*%]G0*C67T6XGP7E_) MPU;_=82-N^*"__]7:@/H=B;__X/$$(7`B<9X#XM%F"4`\```/0!```!TS(7V M=!6#[`AH_P$``%?HO/[__XG&@\00Z[.#[`Q7Z&PE__^#Q!#KW8UV`%'_=82- M@_Z"__]0:@/H(B;__X/$$(7`>`^+19@E`/```#T`0```="V#[`B+@Q`!``#_ M<%1J%6H!C8.0@O__4&H`:FGH["?__[YI````@\0@Z4G___]2_W6$C8,-@___ M4&H#B46`Z,HE__^#Q!"%P(G&>`^+19@E`/```#T`0```="&%]G0U@^P(:/\! M``#_=8#H#O[__X/$$(7`B<8/A?_^__^#[`AH_P$``%?H\_W__XG&@\00Z>/^ M__^#[`S_=8#HGB3__X/$$.N[D('B_P$``+C_`0``.=`/A+K^__^#[`AH_P$` M`%?H!R7__X/$$(7`B<8/A)_^___HY23___\P5XN#$`$``/]P2&H2:@&-@Y"" M__]0:@!J:>@5)___OFD```"#Q"#I;?[__[X!````Z6/^__^)]E6)Y5=64X/$ M@.@`````6X'#A2)O__OFD```"#Q"#KLE;_=82-@S># M__]0:@/H-B3__X/$$(7`>`^+19@E`/```#T`0```="V#[`B+@Q`!``#_<%1J M%6H!C8.0@O__4&H`:FGH`";__[YI````@\0@Z5G___^#[`AHZ`$``%?H5?S_ M_XG&@\00Z4'___^-=@"XZ`$``#G0#X0L____@^P(:.@!``!7Z'TC__^#Q!"% MP(G____Z%LC____,%>+@Q`!``#_<$AJ$FH!C8.0@O__4&H`:FGHBR7_ M_[YI````@\0@Z=_^__^)]KX!````Z=/^__^)]E6)Y5=3@^P8Z`````!;@B-1?10B=?\,<"Y______*N]]%14FH":@*-@TZ#__]0Z+PD__^#Q"#K MK9")]E6)Y8M5"%=6,<#\N?____^)U_*N]]$Q]H/I`CG.?1F0BT4(#[84!HG' MB@0!B`0^B!0Y1DDYSGSH7E_)PU6)Y5=64X/L'.@`````6X'##ID``(M-"(7) MB4WL>%XQ]K\*````B?:)R)GW_XU",(M5#(@$%KAG9F9F]^F)5>2)R,'Z`HE5 MX)DI5>"+3>!&A!B+10R#[`S&!`8`4.A9____C67T6UY?R<.+ M50S&!!8M1NO>]]GKGI"0D%6)Y5-2H2@+!@B#^/^[*`L&"'0,@^L$_]"+`X/X M_W7T6%O)PU6)Y5-2Z`````!;@<-JF```Z$(D__^+7?S)PP`````````````` M`````````````````````````P````$``@`````````````````````````` M``````!`*",I-3<@("`Q+C$@("!S7)I M9VAT+F,L(')S8W0L(')S8W1?8!`A,HP0(3Z`$"/6C!`BDH@0(I*($"*2B!`A;HP0(3*,$"$RC!`A,HP0( M3*,$"/6C!`A#5%]44E\`/0!C87-?7V-L96%N7W1R86-E7V5N=FER;VX````` M````+W!R;VIE8W0O2]#05,O8FEN+V-T8V%S7V-O;6TN8P`````````` M``````````````````!`*",I,#$@,2XQ,B`@("`@71E71E0!C87-?7W5N;6%R2]#05,O&1A=&$H M*0`O=F%R+V-T+TE7+W-O8R]C=&-A71E2!S97)V:6-E M(#!X)3(D,#AX+@`````R-C4Q+3`Q,R!397)V:6-E(#!X)3$D,#AX(&ES(&YO M="!S=7!P;W)T960@8GD@8W1C87-D+@``````````````,C8U,2TP,30@17)R M;W(@;VX@=&AR96%D(&]P97)A=&EO;B`H)3$D2`O=F%R+V-T+RX*```````````` M```````````````R-C4Q+3`R,2!4:&4@`I)9B!T:&ES(&9A:6QU&5C=71I;VX@;V8@=&AE($-L=7-T97(@2!A;F0@=71I;&EZ92!A;&P@879A:6QA8FQE(&UE;6]R>2!O M;B!T:&4*&-E961I;F<@:71S M(&QI;6ET+"!C;VYT86-T($E"30I#=7-T;VUE7-T96T@861M:6YI7-T96T*861M:6YI&-E2!T M:&%T('1H92!A<'!L:6-A=&EO;B!I2!U2!T:&%T('1H92!A<'!L:6-A=&EO;B!I2!T:&4@8VQU2!I71E2!T:&4@97AE8W5T:6]N"F5N=FER;VYM96YT+B`@5&AI2!I2!T:&%T('1H92!A<'!L:6-A M=&EO;B!U2!L:6)R87)Y(&1E M=&5C=&5D(&UO2!T:&%T('1H92!A M<'!L:6-A=&EO;B!I2!U2!D971E8W1E9"!A(')E<&5A=&5D(&1A=&$@9FEE;&0@ M=VET:&EN('1H90IM87)S:&%L960@9&%T82X@($ET(&ES('!O2!O=F5R=W)I='1E;B!T:&4@;65M;W)Y('5S960@=&\@2!L96%K M(&%N9"!M96UO6EN9R!T:&ES(&UE;6]R>2X*```````` M```````R-C4Q+3$Q,"!C=&-A7-T96T*=&\@;W1H97(@ M2!R97-O=7)C97,N("!4:&ES(&UA>2!I M;F1I8V%T92!T:&%T('1H90IO<&5R871I;F<@7-T96US(&EN('1H92!C;'5S=&5R+B`@5&AE(&1A96UO;B!A M='1E;7!T960@=&\@8W)E871E('1H92!I;FET:6%L"G!R:79A=&4@:V5Y(&9I M;&4@:6X@=&AE(&9O;&QO=VEN9R!D:7)E8W1O2!I;B!T:&4@86)O=F4@<&%T:"!N86UE(&UA>2!B92!M M:7-S:6YG+"!O&ES=',L(&%N9"!T:&%T('1H90IP97)M:7-S:6]N2!P97)M:70@<')O8V5S2!A;F0@8W)E871E M(&9I;&5S('=I=&AI;B!T:&4@9&ER96-T;W)Y+B`@268@=&AI7-T96T*=&\@;W1H97(@2!I;B!T:&4@86)O=F4@<&%T:"!N86UE(&UA>2!B92!M:7-S:6YG+"!O&ES M=',L(&%N9"!T:&%T('1H90IP97)M:7-S:6]N2!P97)M:70@<')O8V5S2!A;F0@8W)E871E(&9I;&5S('=I=&AI M;B!T:&4@9&ER96-T;W)Y+B`@268@=&AI7-T96T*=&\@;W1H97(@2!F:6QE(&EN('1H92!F;VQL;W=I;F<@ M9&ER96-T;W)Y.@H))3$D7-T96T@8V]N=&%I;FEN9R!T M:&ES(&1I2!D;V5S(&YO="!H879E('-U9F9I8VEE;G0@7-T96T@861M:6YI7-T96US(&EN M('1H92!C;'5S=&5R+B`@5&AE(&1A96UO;B!A='1E;7!T960@=&\@8W)E871E M('1H92!I;FET:6%L"G!U8FQI8R!K97D@9FEL92!I;B!T:&4@9F]L;&]W:6YG M(&1I3H*"24Q)',*5&AE(&9I;&4@7-T96T@861M:6YI7-T96T*=&\@;W1H97(@2!F:6QE(&EN('1H92!F;VQL M;W=I;F<@9&ER96-T;W)Y.@H))3$D2!M87D@2!N86UE(&UA>2!C;VYT86EN"FUO2!F:6QE('1O(&)E M('5S960@9F]R(&AO2!F:6QE(&EN('1H92!F;VQL;W=I;F<@ M9&ER96-T;W)Y.@H))3$D2!M87D@2!N86UE(&UA>2!C;VYT86EN"FUO"4S M)'@*0V]N=&%C="!T:&4@8VQU"4Q)'@*4F5P86ER('1H M92!C=&-A2!A('-U<'!O0IF:6QE(&]N('1H92!L;V-A;"!S>7-T96TN("!4:&4@ M9&%E;6]N(&AA2!C;VYF:6=U7-T96T@:&%S M(&)E96X@8V]R'!E8W1E9"!T;R!F:6YD M('!U8FQI8R!K97D@9FEL92!I;B!T:&4@9F]L;&]W:6YG(&QO8V%T:6]N.@H) M)3$D2!F:6QE2!R96UO=FEN9R!T:&5S92!F:6QE2!F:6QE3H*"24Q)',*26YF;W)M('1H92!S>7-T96T@861M:6YI7-T96T@861M:6YI7-T96TN("!)9B!C;'5S=&5R"G-E8W5R:71Y(&)A7,@87)E(&EN('5S92P@=&AE'!E8W1E9"!T;R!F:6YD('1H:7,@ M9FEL92!I;B!T:&4@9F]L;&]W:6YG(&1I3H*"24Q)',*5&AE('1R M=7-T960@:&]S="!L:7-T(&9I;&4@;6%Y(&)E(&UI2!N86UE(&UA>2!H879E M(&)E96X@;6]D:69I960@=&\@9F]R8FED(&%C8V5S2!A;F0@=&AE(&9I;&4N("!)9B!T:&ES"F-O;F1I=&EO;B!P97)S:7-T2!I;B!T:&4@86)O=F4@<&%T:"!N86UE(&UA>2!B92!M:7-S:6YG+"!O M&ES=',L(&%N9"!T:&%T('1H90IP97)M:7-S:6]N2!P97)M:70@<')O8V5S2!A;F0@8W)E871E(&9I;&5S('=I M=&AI;B!T:&4@9&ER96-T;W)Y+B`@268@=&AI7-T96T@861M:6YI2!E>'1E;F1I;F<*:&4@7-T96T@8V]N=&%I;FEN9R!T:&ES(&1I2X* M````````,C8U,2TQ,C8@8W1C87-D($1A96UO;B!&86EL=7)E.B!4:&4@9&%E M;6]N('=A2!F:6QE('-Y7-T96T@8V%N('-U M<'!O7-T96T@861M:6YI0IN86UE M(&ES('-P96-I9FEE9"!A;F0@8V]N2!M:7,M;6%T M8V@N"@```````````````````````````````````````#(V-3$M,3(X(%1H M92!S>7-T96T@8V%L;"!T;R!R971R:65V92!T:&4@;&]C86P@:&]S=&YA;64@ M9F%I;&5D+@`R-C4Q+3$R.2!4:&4@8W)E9&5N=&EA;',@:&%V92!E>'!I2!H87!P96X@=VAE;B!T:&4@8VQI96YT(&%N M9"!S97)V97(@:&]S=',@:&%V92!D:69F97)N="!T>7!E7,N"@E0;&5A7!E(&]F(&AO7,N M"@`````R-C4Q+3`R-2!L:6)C=%]C87,@9F%I;'5R93H@=&AE(&-T8V%S(&-L M:65N="!L:6)R87)Y(&ES('5N86)L92!T;R!E>&5C=71E"@ET:&4@+W5S7-T96TN"@!34D,@ M7-T96T@)3$D7-T M96T@)3$D7-T96T@)3$D2!O8V-U2!T:&%T('1H92!S M>7-T96T@:&%S('-U9F9I8VEE;G0@=FER='5A;"!M96UO2!S:7IE(&]F('1H92!S>7-T96T@;W(@=&5R;6EN M871I;F<*87!P;&EC871I;VYS('5S:6YG(&5X8V5S2X@($EF('1H:7,@8V]N9&ET:6]N('!E2!O=F5R=W)I='1E;B!T:&4@;65M M;W)Y(`IU2!M;V1I9GEI M;F<@=&AI04(```````````````````` M````````````````````````````H'L%"``````````````````````````` M````````````````!WP%"````````````0````Y\!0@```````````(````2 M?`4(```````````#````%WP%"````````````(T%"``````````````````` M``````````````````!"860@;65S````!,````(````_O__;^B/!`C___]O!0```/#__V\XCP0(```` M```````````````````````````````````````````````````````````` M_____P````#_____```````````H"@8(```````````>DP0(+I,$"#Z3!`A. MDP0(7I,$"&Z3!`A^DP0(CI,$")Z3!`BNDP0(OI,$",Z3!`C>DP0([I,$"/Z3 M!`@.E`0('I0$""Z4!`@^E`0(3I0$"%Z4!`ANE`0(?I0$"(Z4!`B>E`0(KI0$ M"+Z4!`C.E`0(WI0$".Z4!`C^E`0(#I4$"!Z5!`@NE00(/I4$"$Z5!`A>E00( M;I4$"'Z5!`B.E00(GI4$"*Z5!`B^E00(SI4$"-Z5!`CNE00(_I4$"`Z6!`@> ME@0(+I8$"#Z6!`A.E@0(7I8$"&Z6!`A^E@0(CI8$")Z6!`BNE@0(OI8$",Z6 M!`@````````````````````````````````````````````````````````` M````````1T-#.B`H1TY5*2`S+C(N,@``1T-#.B`H1TY5*2`S+C(N,@``1T-# M.B`H1TY5*2`S+C(``$=#0SH@*$=.52D@,RXR``!'0T,Z("A'3E4I(#,N,@`` M1T-#.B`H1TY5*2`S+C(``$=#0SH@*$=.52D@,RXR``!'0T,Z("A'3E4I(#,N M,@``1T-#.B`H1TY5*2`S+C(``$=#0SH@*$=.52D@,RXR``!'0T,Z("A'3E4I M(#,N,@``1T-#.B`H1TY5*2`S+C(``$=#0SH@*$=.52D@,RXR+C(````L```` M`@#7"P``!```````R'(%"!0```#PD@0(#````/R6!`@C```````````````D M`````@`I#```!```````WG(%"`4````%DP0(`@``````````````(0````(` M`````-<+``"_"P``7TE/7W-T9&EN7W5S960``````-,+```"```````$`0`` M``#\E@0(_)8$")L!```+````L`4```$"/`````@"3@,@`0```DT\`````B,` M``1,````4P````5,`````0`&/`0```0'!VEN=``$!0AU````O0<```0#10.M M!````T93`````B,```B>````?0@```@$&P/&`0``!!R>`````B,``U@&```$ M'5,````"(P0`!@,$```$!0@P`0``LP(``"0$*@,`!P``!"M3`````B,``X\( M```$+%,````"(P0#+@$```0M6@````(C"`,J`P``!"Y3`````B,,`^\'```$ M+U,````"(Q`#+`8```0P,`$```(C%`-Z````!#%3`````B,8`Q@(```$,C`0```H$!```$!$,#VP(` M``1"4P````(C```"T`$``!@$4P/-!```!$Y3`````B,``\D#```$3U,````" M(P0#1@<```109`$```(C"`/K"```!%%3`````B,,`S4"```$4G4````"(Q`` M`NP(```@$=`-K`@``!')3`````B,``\D"```$00```0'!`D#```)`P``!4P````#``;C M`````08"-0,```@%2P,9`P``!453`````B,``R8!```%2M,"```"(P0``EH# M```,!AX#0@8```8<6@,```(C``,P"```!AT0`P```B,$``9T`0``!`4"A@,` M`!`&(P-"!@``!B&&`P```B,``S`(```&(A`#```"(P@`!EX'```(!0[2`P`` M!`L%````"P1S!``` M"$0%``"\`P``.`<_`VH%```'Y\&```"(Q@#@`(```=\L08```(C'`/'"```!X!3```` M`B,@`T\!```'@5,````"(R0#TP,```>"4P````(C*`-I`P``!X-3`````B,L M`X,#```'AE,````"(S`#]`@```>(-P$```(C-``+!$H%```(QP4``-8&```D M!T`#*00```>/Y04```(C``/X!```!Y#E!0```B,$`_`$```'E%,````"(P@# M\@(```>84P````(C#`.B!@``!YQ3`````B,0`Y(!```'GK<&```"(Q0#,`@` M``>?$`,```(C&`.="```!Z,S!@```B,@``L$S04``!+2!0``!MH````!"`L$ MQP4```L$Y04```L$T@4```L$,`$```L$.@0``!`;!@```5,````1-P$``!'' M!0``$<<%```1Y04``!'E!0````L$]P4``!,M!@```1$W`0````L$(08```L$ MYP,```K:`0```0L$.08```L$2P8``!()`P``"P0)`P``$(D&```!4P```!%M M!```$40%```1V04``!''!0``$=\%```1ZP4``!%3````$5,`````"P16!@`` M$)\&```!4P```!%M!`````L$CP8``!.Q!@```1%M!`````L$I08```L$$`,` M``CT!@``P`````@'J0,[`0``!ZHP`0```B,``Z\!```'JVT$```"(P0#]`@` M``>L]`8```(C"``$`P<``$H%```43``````"*`<``"P&-`/$`@``!C*]!@`` M`B,``_0(```&,TH%```"(P@`#$<'```L!C4-Q`(```8OO08```T$!0``!C0# M!P```!6+`0``"-52!P``!CP$```$!Q6S`P```B#2!0``%0\#```"(6\'```& M\`$```('%4T"```"(E('```5XP,```(CC`<```8W!```!`<5E@0```(EG@<` M``8R!```"`<5(0,```(FL`<```;^`P``"`45?`<```(QP@<```;<`````085 MI0@```(RT@4``!59"0```C/?!P``!NP#```"!158!````C1O!P``%50````" M-5,````5C@,```(V4@<``!4:!P```CBP!P``%8H"```".9X'```5.`8```([ M*`@```L$I0<``!7V`P```CV3!P``%4D$```"/G8'```5$`@```(_=@<``!73 M`@```D"!!P``%0\&```"078'```5J0<```)"=@<``!5T`0```D.>````%2`) M```"1*4'```5!P,```)%4P```!5\`0```D93````%5L%```"1X$'```5B@`` M``)(DP<``!6B`@```DEV!P``%3D#```"3B4````52@````)14P```!4*"0`` M`E)0!@``%3<````"4YX````5]`````)44@<``!60!0```E6>````%;,'```" M5IX````5O@8```)8G@```!4D"````EM3````%7D#```"7E,````5JP,```)E M4P```!6A!````FAO!P``%88!```";)X````5SP$```)QG@```!7S!0```G*E M!P``%9`'```"=8$'```5``8```)VDP<``!6B`0```GF!!P``%;I,' M```5G@4```)]DP<``!5>!P```H!["```%94"```"@YX````5.`@```*$C`<` M`!6%!0```H=3````%0X'```"BE('```5"P$```0CVPD```L$7@$``!7["``` M!#2E````%3X"```$/#D!```580$```1#:@$``!7(!@``!$92!P``%94````$ M4X$!```5&`8```1:T`$``!6^!```!%Y3````%3P)```$;.P(``!5C!```!(:\`@``%1\$ M```$C(P'```7J`4```A%`9X````7>00```AB`5('```5]P<```5+$`,``!5H M!P``!AXU`P``%0,"```&(V$#```5KP@```=(N0H```L$5@8``!5>````!TO* M"@``"P2/!@``%4@&```'3-L*```+!*4&```5V0@```=5[`H```L$.@0``!5& M"```!UK]"@``"P3W!0``%>@&```'7@X+```+!!0+```0+@L```%3````$44& M```1+@L``!'K!0````L$-`L```L$108``!4/!0``!V%%"P``"P1+"P``$&`+ M```!4P```!%@"P``$44&````"P0W`0``%=H$```'8G$+```+!"$&```5#P(` M``>M@@L```L$O08``!5O````!C4H!P``%40!```&-]\'```5``````8X4P`` M`!44"0``!CEO!P``%9T'```&.E('```88P8```$9T0L```$%`P1S!0@24P`` M``!.`````@`+`0``!`$S`0``+W5S#@V+T)524Q$+V=L:6)C M+3(N,B]C"]S>7-V+VQI;G5X+V)I=',O='EP97,N:``````N M+B]S>7-D97!S+W5N:7@O"]B:71S+W-C:&5D+F@`````+BXO M;&EN=7AT:')E861S+W-Y7!E M+!X>5QX""0`!`0`%`O"2!`@#,0$>+#H"!@`!`0`% M`OR6!`@#&@$>+!X>5QYD9"PL+3H>`@(``0%*`````@`C`````0'[#@H``0$! M`0````$`+W1M<"]C8T913&,V5"YS````````!0+><@4(`R$!.AX"`0`!`0`% M`@63!`@#&`$>`@$``0$````0````_____P$``7P(#`0$B`$``%]'7VEN=#,R M7W0`+W5S%]T`%]?1T-/3E9?24Q,14=!3%]$15-#4DE0 M5$]2`%]?9V-O;G9?:6YF;P!?7W)W7W)E861E0!?7T=#3TY67TY/0T].5@!?7VEN=F]C871I;VY?8V]U;G1E M<@!?7W!I9%]T`%]?=5]S:&]R=`!?7V-O=6YT`%]?<75A9%]T`%]?:6YH97)I M='-C:&5D`%]?9G-I9%]T`%]?'1?9F-T M`%]?=')A;G-?9F-T`%]?F4`7U]Q861D&MI;F0` M7U]I;G0Q-E]T```N6YS='(`+F=N=2YV97)S M:6]N`"YG;G4N=F5R6YA;6EC`"YC M=&]R`````0`````````!`````@```!L```` M"0````(````0D00($!$``.`!```$````"P````0````(````=0````$````& M````\)($"/`2```7```````````````$`````````'`````!````!@````B3 M!`@($P``T`,`````````````!`````0```![`````0````8```#8E@0(V!8` M`/#;``````````````0`````````@0````$````&````R'(%",CR```;```` M```````````$`````````(<````!`````@````!S!0@`\P``\G4````````` M````(`````````"/`````0````,`````\`4(`'`!`"0:`````````````"`` M````````E0````$````#````)`H&""2*`0`$```````````````$```````` M`)\````&`````P```"@*!@@HB@$```$```4`````````!`````@```"H```` M`0````,````H"P8(*(L!``@```````````````0`````````KP````$````# M````,`L&"#"+`0`(```````````````$`````````+8````!`````P```#@+ M!@@XBP$`!```````````````!`````````"[`````0````,````\"P8(/(L! M`"P!``````````````0````$````P`````@````#````:`P&"&B,`0!$```` M```````````$`````````,4````!``````````````!HC`$`U@`````````` M`````0````````#.`````0``````````````0(T!`%@```````````````@` M````````W0````$``````````````)B-`0`E```````````````!```````` M`.T````!``````````````"]C0$`>PP``````````````0````````#Y```` M`0``````````````.)H!`"``````````````````,`'P`````````````````#`"`````````` M`````````P`A``$```````````````0`\?\(```````````````$`/'_$P`` M`/R6!`@``````@`,`",```````````````0`\?\N````*`L&"``````!`!(` M/````#`+!@@``````0`3`$H````D"@8(``````$`$`!=````.`L&"``````! M`!0`:@````CP!0@``````0`/`&X```!T#`8(`0````$`%@!Z````()<$"``` M```"``P`D````'@,!@@8`````0`6`)D```!TEP0(``````(`#``C```````` M```````$`/'_I0```"P+!@@``````0`2`+(````T"P8(``````$`$P"_```` M)`H&"``````!`!``S0```#@+!@@``````0`4`-D```"D<@4(``````(`#``( M```````````````$`/'_[P``````````````!`#Q__L````@\`4(!`````$` M#P`"`0``0/`%"&\#```!``\`#`$`````````````!`#Q__L```#`\P4(!``` M``$`#P`=`0`````````````$`/'_^P````@(!@@$`````0`/`"H!```````` M``````0`\?_[````%`@&"`0````!``\`.0$`````````````!`#Q__L````8 M"`8(!`````$`#P!'`0`````````````$`/'_^P```$`(!@@$`````0`/`%4! M``!@"`8(0`````$`#P!K`0`````````````$`/'_^P```*`(!@@$`````0`/ M`'D!``````````````0`\?^%`0``N-P$"(D````2``P`F0$``"S.!`A.`P`` M$@`,`*X!```8DP0(5@```!(```#%`0``*),$"#L````2````U@$``.#S!0@! M$```$0`/`.$!``#(P00(SP```!(`#`#T`0``.),$"',````2````"@(``,CS M!0@$````$0`/`!,"``!$W00(&P(``!(`#``I`@``2),$"&)4$ M"-8````2````"PH``(B5!`AI`@``$@```!X*```@%P4(]!(``!(`#``R"@`` MF)4$"*H!```2````1`H``&@,!@@$````$0`6`%D*``"HE00(-`,``!(```!W M"@``-,`$"'`````2``P`BPH```#P!0@`````(``/`)8*``#`NP0([````!(` M#`"L"@``R'(%"``````2``T`L@H``+B5!`A"````$@```+H*``#(E00(1@`` M`!(```#,"@``V)4$"+D!```2````WPH``.B5!`A-`0``$@```/L*``#XE00( M5P```!(````/"P````(%")P-```2``P`(PL``$CF!`A)````$@`,`#4+``#T MMP0(>@$``!(`#`!("P``V.T$"#0+```2``P`7@L``'S1!`A#`0``$@`,`'0+ M``!,804(6@```!(`#`"."P``")8$"'L````2````I`L``&@,!@@`````$`#Q M_ZL+```8O00(:P```!(`#`"_"P``/`L&"``````1`/'_U0L``!B6!`C5```` M$@```.4+``"L#`8(`````!``\?_J"P``*)8$"&L````2````^@L``*AA!0AE M!P``$@`,``L,```XE@0(=@(``!(````B#```2'$%")D````2``P`,@P``+QO M!0B*`0``$@`,`$\,``#,J`0(<@$``!(`#`!H#```2)8$"%0````2````>@P` M`%B6!`AD````$@```(T,``!HE@0(C0```!(```"@#```>)8$"$$!```2```` MN`P``-3F!`@#!P``$@`,`,P,``!\Q@0(G````!(`#`#A#```<`P&"`0````1 M`!8`\PP``&2^!`BI````$@`,``4-```$#0``(.($ M"-P"```2``P`>`T``&QI!0@@````$@`,`)`-``"H#`8(!````!$`%@":#0`` M^`\%""<'```2``P`K`T``(B6!`AK````$@```+P-``"8E@0(*````!(```#3 M#0```/`%"``````0``\`X`T``*B6!`@Z````$@```/(-```,"`8(!````!$` M#P#_#0`````````````@````$PX``!C'!`C@````$@`,`"8.``"XE@0(,P`` M`!(````[#@``A/D$"'H(```2``P`30X`````````````(````%P.``#(E@0( M,````!(`````:6YI="YC`&EN:71F:6YI+F,`8V%L;%]G;6]N7W-T87)T`&-R M='-T=69F+F,`7U]#5$]27TQ)4U1?7P!?7T143U)?3$E35%]?`%]?14A?1E)! M345?0D5'24Y?7P!?7TI#4E],25-47U\`<"XP`&-O;7!L971E9"XQ`%]?9&]? M9VQO8F%L7V1T;W)S7V%U>`!O8FIE8W0N,@!F0!?7T-43U)? M14Y$7U\`7U]$5$]27T5.1%]?`%]?1E)!345?14Y$7U\`7U]*0U)?14Y$7U\` M7U]D;U]G;&]B86Q?8W1O&1A=&$`;F%N;W-L965P0$!'3$E"0U\R+C``=')A8V4`8V%S M7U]S971U<%]U=&8X7VAD;',`=F%L:61O<'1S`&-A&1A=&$`:&)A7VUA0!T&ET`&-A5]M M96UC86QC`&-A71E'R/(WA\L"MX?![X M`)'"``"1X@`$@C$``(%"`"@Y(```92D$`RT1``"1*@``0((`$$@``)%@```` M2```%(/B`#!(``&!@$$`%'QN&WA!B@`<@!$``)!!`!1\"0.F@%$`!$Z`!"&` M00`4@.(`.#D```!]PW-X?>1[>'X%@WB1!P``2``!:6````"`X@`<+`<``$&" M``B`8@`@2``#(8!!`!1\@0@(```````,($``````````K``'7U]S=&%R=``` M`(!B``A\"`*F+`,``)0A_\"0`0!(08(`P(%C``"000`4?6@#IH%C``B`0P`$ M3H``(8!!`!2`8@`,+`,``$&"`!R``P``@6,`"'P(`Z:`0P`$3H``(8!!`!2` M8@`0+`,``$&"`!R``P``@6,`"'P(`Z:`0P`$3H``(8!!`!2`8@`4+`,``$&" M`!R``P``@6,`"'P(`Z:`0P`$3H``(8!!`!2`8@`8+`,``$&"`!R``P``@6,` M"'P(`Z:`0P`$3H``(8!!`!2!@0!(."$`0'V(`Z9.@``@."$`0$Z``"`````` M```@08````````#<``Y?7W1H&$!!@@!0.&$`0$@``2F`00`4D&$!0'P>&$!!@@`< M@(,``&/C``!(``$U@$$`%&/#``!(```X@&(`.("#```X?P`D2``!&8!!`!0X M8``"2```'(!B`#B`@P``.'\`4$@``/V`00`4.&```8`!`5A\"`.F."$!4+O! M__A.@``@````````($&``@(!`````````,P`!&UA:6XP("@$`!!\IBMX?*'RH*WA!@0`0?($#IGR@'2I.@``@5(#9?WRI*WA\JBMX?*LK>'RL*WA!@O_@ M?`D#IC@``"!\`0.F5(0&_GR@'2HP8P`@0@#_^$O__\````````P@0``````` M``!8``5?9FEL;`"!@@!`D$$`%(`,``"`3``$?`D#IDZ`!"````````R@```` M```````8@8(`1)!!`!2`#```@$P`!'P)`Z9.@`0@```````,H``````````` M&(&"`$B000`4@`P``(!,``1\"0.F3H`$(```````#*```````````!B!@@!, MD$$`%(`,``"`3``$?`D#IDZ`!"````````R@```````````80"@C*38Q"3$N M,3,@('-R8R]B;W,O=7-R+V-C7-T96T@*&5R6YA;64```M?7VUO9%]I;FET```0``$J````$`\#$``!/@```#`/`Q`` M`4(````R#P,0``%*````$@\#$``!8````$"9&A```6X````6#P,0``%P```` M8)D:$``!F@```!H/`Q```;````!6F1H0``&Z````-`\#$``!Q@```#8/`Q`` M`<@```!EF1H0``'R````1H\#$``")@```$B/`Q```DH```!*CP,0``)N```` M3(\#$``"D@```$Z/`Q```NX````4CP,0``+R````&`\#$``#*@```!R/`Q`` M`T0```!;F1H0``-8````:ID:$``#<````&^9&A```XP```!TF1H0``.>```` M&H\#$``#J````'29&A```[H````:CP,0``/$````=)D:$``$`````%L`#Q`` M!'(````>#P,0``2:````(`\#$``$P@```"(/`Q``!.H````D#P,@``5L```` M,!\`(``%<````$0?`"``!@`````H'P`@``8$````#A\`(``&"````$`?`"`` M!@P````.'P`@``8X````.!\`(``&/`````P?`"``!D````!"'P`@``9$```` M+A\`(``&2`````H?`"``!DP`````'P`@``90````6!\`(``&5`````(?`"`` M!E@````('P`@``9<````!A\`(``&8`````0?`&5R```````````" M`0``````````````"@```````%]?8W)T,'8````````````"`0`````````` M````!0```````%1/0P``````(``&%``"``!K`0`````````````1#P`````` M```````````I(``&.``"``!K`0````0````````1`P```````%]?8W)T,'8` M(``&/``"``!K`0````0````````1`P```````%\D4U1!5$E#(``&0``"``!K M`0````0````````1`P`````````````````^(``&1``"``!K`0````0````` M```1`P`````````````````>(``&2``"``!K`0````0````````1`P`````` M`&5R&%R9V,` M(``&%``"```"`0````0````````3$````````'!?>&%R9W8`(``&&``"```" M`0````0````````3$````````'!?>')C9F<`(``&,``"```"`0````0````` M```3$````````'!?>')C````(``&-``"```"`0````0````````3$``````` M```````````I(``&9``#```"`0````0````````3!0```````"YF:6QE```` M````4/_^``-G`P````````!3``````````````````````"2`````````0`` M``````````"L`````````@``````````````$``!\``!``!K`0```0`````` M```1``````````````````#;$``!\``!`"`"`0```#X````````"```````` M`%\D4U1!5$E#(``%$``"``!K`0```%H````````9!0````````````````#< M(``&"``"```"`0````P````````1"@````````````````#K(``&'``"```" M`0````0````````3$`````````````````$!(``&(``"```"`0````0````` M```3$`````````````````$3(``&)``"```"`0````0````````3$``````` M``````````$I(``&*``"```"`0````0````````3$`````````````````$[ M(``&+``"```"`0````0````````3$````````"YF:6QE````````6O_^``-G M`VQO8V%L;F%M92YC``````````````````%5`````````0````````````%O M`````````@``````````````$``#&``!``!K`0```.@````````1```````` M`"YM86EN````$``#&``!`"`"`0```%0````````"`````````%\D4U1!5$E# M(``%>``"``!K`0```(4````````9!0```````&YO;F%M90``````7?_^#`-G M`"Y?9FEL;```$``$```!```"`0```&\````````1`````````&=L:6YK+G,` M````8O_^#`-G``````````&<$``"\``!``!K`0```"@````````1!@`````` M``````````&<$``"\``!```"`0```%X````````"!@```````&=L:6YK+G,` M````9__^#`-G`"YE>&ET````$``$Z``!``!K`0```"@````````1!@`````` M`"YE>&ET````$``$Z``!```"`0```&,````````"!@```````&=L:6YK+G,` M````;/_^#`-G``````````&H$``$<``!``!K`0```"@````````1!@`````` M``````````&H$``$<``!```"`0```&@````````"!@```````&=L:6YK+G,` M````6YA;64` ` end begin 755 getRemoteHostName.aix M`=\`!#U_2SP```DD````:@!($`(!"P`!```#2````3@````$(``%2!```2@@ M``1P(``%7``"``$``@`"``0``P`"``,Q3``````````````````````````` M```N=&5X=````!```2@0``$H```#2````2@```=L```````<```````@+F1A M=&$````@``1P(``$<````3@```1P```(A```````$```````0"YB'R/(WA\L"MX?![X M`)'"``"1X@`$@C$``(%"`"@Y(```92D$`RT1``"1*@``0((`$$@``)%@```` M2```%(/B`#!(``&!@$$`%'QN&WA!B@`<@!$``)!!`!1\"0.F@%$`!$Z`!"&` M00`4@.(`.#D```!]PW-X?>1[>'X%@WB1!P``2``!:6````"`X@`<+`<``$&" M``B`8@`@2``"@8!!`!1\@0@(```````,($``````````K``'7U]S=&%R=``` M`(!B``A\"`*F+`,``)0A_\"0`0!(08(`P(%C``"000`4?6@#IH%C``B`0P`$ M3H``(8!!`!2`8@`,+`,``$&"`!R``P``@6,`"'P(`Z:`0P`$3H``(8!!`!2` M8@`0+`,``$&"`!R``P``@6,`"'P(`Z:`0P`$3H``(8!!`!2`8@`4+`,``$&" M`!R``P``@6,`"'P(`Z:`0P`$3H``(8!!`!2`8@`8+`,``$&"`!R``P``@6,` M"'P(`Z:`0P`$3H``(8!!`!2!@0!(."$`0'V(`Z9.@``@."$`0$Z``"`````` M```@08````````#<``Y?7W1H&$!!@@`D M@($`;("$``2`HP``.'\`'$@``&6`00`48\,``$@``"2`80!L@(,`!(!B`#B` MHP``.'\`1$@``$&`00`4.&```H`!`%A\"`.F."$`4+O!__A.@``@```````` M($&``@(!`````````,``!&UA:6XP(`````"!@@!`D$$`%(`,``"`3``$?`D# MIDZ`!"````````R@```````````8@8(`1)!!`!2`#```@$P`!'P)`Z9.@`0@ M```````,H```````````&(&"`$B000`4@`P``(!,``1\"0.F3H`$(``````` M#*```````````!A`*",I-C$),2XQ,R`@`````@```8@````=```!IF5R6YA;64`7U]M;V1?:6YI M=`!?7T-?'1I7W1L:5]I;FET7W)O=71I;F4`7VYS;%]I;FET7W)O M=71I;F4`7U]D8V5?8V]M<&%T7VEN:71?'RP M*WA\'O@`D<(``)'B``2",0``@4(`+#D@``!E*00#+1$``)$J``!`@@`02``` MD6````!(```4@^(`1$@``A&`00`4?&X;>$&*`!R`$0``D$$`%'P)`Z:`40`$ M3H`$(8!!`!2`X@!,.0```'W#)$'``!(``'Y8````(#B`"`L M!P``08(`"(!B`"1(`$?I@$$`%'R!"`@```````P@0`````````"L``=?7W-T M87)T````?`@"IH!B``B4(?_`D$$`%)`!`$B``@`,+(,``(""`#PL````@*,` M`(%C``A!@@`(D`0``'RH`Z9!A@"@@$,`!$Z``"&`00`4@&(`$"P#``"``P`` M@6,`"'P(`Z9!@@`0@$,`!$Z``"&`00`4@&(`%"P#``"``P``@6,`"'P(`Z9! M@@`0@$,`!$Z``"&`00`4@&(`&"P#``"``P``@6,`"'P(`Z9!@@`0@$,`!$Z` M`"&`00`4@&(`'"P#``"``P``@6,`"'P(`Z9!@@`0@$,`!$Z``"&`00`4@8$` M2#@A`$!]B`.F3H``(````````"!!@````````.@`#E]?=&AR96%D0ZO``T.H``!#I@``$\8`7V.;P`3#G<`-PY_`$\.AP`Y#H\``PZ7`!<.+P` M]#ACX0`XW`%4.1P`9#D\`/R101'HD6$1[)&!$?"1H1'TD<$1^)'A$?R2`1(` MDB$2!))!$@@X'`%@.)P`;#C\`$0Y7`#4.7P`=)"A$@R081(0D,$2%)$!$AB1 M(1($`Z#G#``@2``O+8!!`!2`80"`2``J48!!`!2`80!\2``J;8!!`!2300!8 M8:,``$@`+K6`00`42``!F$@`-F%@````D&$`6"P#``!AHP``.($`^$&"`&@X M80"$@!D``"P```!!@@%<2``IK8!!`!2`80"$.($`B$@`*<6`00`4@($`B#AX M`"!(`"ZM@$$`%(!A`(A(`"G1@$$`%(!A`(1(`"GM@$$`%)-!`%AAHP``2``N M-8!!`!1(``$82``NH6````"080!8+`,``#AA`/@X@0$808(`:#AA`(R`&0`` M+````$&"`-Q(`"DM@$$`%(!A`(PX@0"02``I18!!`!2`@0"0.'@`($@`+BV` M00`4@&$`D$@`*5&`00`4@&$`C$@`*6V`00`4DT$`6&&C``!(`"VU@$$`%$@` M`)A(`"$98````)!A`%@L`P``.&$`E(`!`2A!@@!D@!D``"P```!!@@!@2``H ML8!!`!2`80"4.($`F$@`*,F`00`4@($`F#AX`"!(`"VQ@$$`%(!A`)A(`"C5 M@$$`%(!A`)1(`"CQ@$$`%)-!`%AAHP``2``M.8!!`!1(```<*```9$&"``B3 M00!88:,``$@`+1V`00`4.&$`^$@`.[&`00`4.&$!`$@`.Z6`00`4.&$!&$@` M&0U@````@`$`6"R```!(```,@`$`6"R```!!A@$X@&$`>"P#`,@X`P`!D`$` M>$"``!B3X0!8.&```3B@```X@``!2__[I$&&`""('0`"+````$&"`!0X?`"L M.(``>D@`*F&`00`4@!D``"P```!!@@"@@`$`6"P```!`@@`L@1@X@`!L M.*```3C!`*@XX``$2``C38!!`!2`&0``+````$&"`&R!%P#P.&```3B```"` MH1'P.,```3C@`#R!(1'L2``3A8!!`!0X80"L2``D`8!!`!2`80"L.($`L$@` M)!F`00`4@($`L#AX`"!(`"D!@$$`%(!A`+!(`"0E@$$`%(!A`*Q(`"1!@$$` M%))A`%@X```!2__VJ(@=``*(?```B)P`")AA`%`L````F($`44&"`!2`81'T M.(``;T@`)BF`00`4@!D``"P```!!@@!L@1<`^#A@``$X@```@*$1_#C```$X MX``^@2$1^$@`$MF`00`4.&$`M$@`(U6`00`4@&$`M#B!`+A(`"-M@$$`%("! M`+@X>``@2``H58!!`!2`80"X2``C>8!!`!2`80"T2``CE8!!`!2`81($@($2 M`#BA`%`XP0!1..```#D```!(`#<-@$$`%"P#W+LL@P``D&$`7$"$`+!!@@1@ MB!T``BP```!!@@`@.,$`7#A\`%0X@`!P.*```3C@``1(`"'1@$$`%(`9```L M````08(`;($7`/PY/`#L.+P!2#A@``$X@```.,```3C@`#](`!()@$$`%#AA M`+Q(`"*%@$$`%(!A`+PX@0#`2``BG8!!`!2`@0#`.'@`($@`)X6`00`4@&$` MP$@`(JF`00`4@&$`O$@`(L6`00`4.```*I`!`%A+__LDB!T``BP```!!@@"T M@&$2&#B``'(XH``!.,$`7#C@``1(`"$I@$$`%(`9```L````08+^2$@``)2` M&0``+````$&"_CB!%P$(@4$`7#A@``$X@```@*$2%#C```$XX`!"@2$2#$@` M$4V`00`4.&$`Q$@`(``@2``F MR8!!`!2`80#(2``A[8!!`!2`80#$2``B"8!!`!2280!8.````4O_]'"`&0`` M+````$&"_;2!%P$`@4$`7#A@``$X@```@*$2(#C```$XX`!`@2$2'$@`$,F` M00`4.&$`S$@`(46`00`4@&$`S#B!`-!(`"%=@$$`%("!`-`X>``@2``F18!! M`!2`80#02``A:8!!`!2`80#,2``AA8!!`!1+__U$+!H``$""_KB`81(0B!T` M`CM:``&380!D+````))A`%B080$,D^$!"$&"`!2`81(D.(``=4@`(V6`00`4 M.&$!"#B!`1!(`"6U@$$`%"P#__]`@O.42``>]8!!`!2``P``.&$!"#B!`1`L M```$0(+S>'RR1*I\L46J2``E@8!!`!0L`___08+_T(`!`%@L```J08+SD$O_ M\UR('0`"+````$&"`!2`81(H.(``;D@`(NV`00`4@!D``"P```!!@OR$@1<` M]#A@``$X@```8@4``#C```$XX``]@2$2+$@`#YV`00`4.&$`U$@`(!F`00`4 M@&$`U#B!`-A(`"`Q@$$`%("!`-@X>``@2``E&8!!`!2`80#82``@/8!!`!2` M80#42``@68!!`!2280!8.````4O_\L`L@]R@+````$"&`"!!@@`4@&$2,#B` M`&E(`")-@$$`%)-A`&1+__$D08(`(#C!`%PX?`!\.(`` MG8!!`!2`&0``+````$&"_3B!%P$$.3P!!#B\`6PX8``!.(```#C```$XX`!! M2``.U8!!`!0X80#<2``?48!!`!2`80#<.($`X$@`'VF`00`4@($`X#AX`"!( M`"11@$$`%(!A`.!(`!]U@$$`%(!A`-Q(`!^1@$$`%#@``"J0`0!82__W\(!Y M``!(`#,Y@$$`%)!Z``!\`\``0('N-)+Z``"`O```@&$1V&.D``!(``#-@$$` M%$O_[BR`F0``2``,96````!+_^X(.,$`6#A\`+PX@`!H.*```3C@``1(`!V] M@$$`%(&!$H2``1*(@&$`6#@A$H!\"`.F?8"!(+FA_[1.@``@B!T``BP```!! M@OQ\@&$2"#B``'%(`"$)@$$`%(`9```L````08+ZH$O__&@````````@0X`3 M`@`````````34``$;6%I;@```````(&"`%"000`4@`P``(!,``1\"0.F3H`$ M(```````#*```````````!B!@@!E\HP6J.&,`($(`__B('P``?(D#IGRC M]:J8`0GH.&$)Z7RC!:HX8P`@0@#_^(,"`'P[8```?*/UJH-8```XGP#<8T,` M`$@`!Z5@````+`,``$&"`=1C0P``2``(P8!!`!0X`P`!*``#_X"8``!`@0!( M.&$%Z#B@`_](``CQ8````("8```X80GH.*`#_T@`"-U@````.'\!`$@`"HF` M00`4D'@``"P#``!!@@$T.V```4@``70X80GH.*`#_D@`"HU@````@)@``#AA M!>@XH`/^2``*>6````"`>```.($`8$@`#"&`00`4+`,``$&``$"``0!H5``$ M)B@`0`!`@@`P.'\!)$@`"AV`00`4D'@``'QD&WE`@O^8.&$%Z#B@`_Y(``HI M8````$@``!B`F```.&$%Z#B@`_Y(``H18````#AA!>@X@``O2__^,8!!`!0L M`P``0((`)#A_`4A(``G%@$$`%)!X```L`P``08(`<#M@``%(``"PFZ,``#AA M!>@X@0!@2``+?8!!`!0L`P``0(``)#A_`6Q(``F)@$$`%)!X```L`P``08(` M-#M@``%(``!T@`$`:%0`!"8H`$``08(`9#A_`9!(``E9@$$`%)!X```L`P`` M0(+^U(""`)`Y/P)D.+\`G#A@``:!!``0.(```#C```$XX``$.4``I$@`"RF` M00`4@8$.&(,!#?`X8``&."$.$'V(`Z:[0?_H3H``(#A@`#](``LI@$$`%(!X M```XGP&T2``%L6`````L`P``0((`)#A_`*@X@`'`2``+*6`````X?P#`.(`! MP$@`"QE@````.&``?T@`"N6`00`42``$W8!B`,R``P``+````$&"`-R#0@#0 M@!H``"P```!!@@`4+``0`$"```PX`!``D!H``(!X``!(`!JU@$$`%'Q\&WE` M@@!T@'H``"P#``!!@@!(2``:P8!!`!1\?!MY08(`.#AA`$!(`!K5@$$`%(!A M`$`X@0!$2``:[8!!`!2`80!$2``;"8!!`!2`80!`2``;)8!!`!2`8@#L@&,` M`"P#``!!@@!(2``;-8!!`!1\?!MY08(`.#AA`$!(`!J!@$$`%(!A`$`X@0!$ M2``:F8!!`!2`80!$2``:M8!!`!2`80!`2``:T8!!`!2#0@"T@`(`](AZ``,H M`P`'5&,6^GQ^&A2`8P`@?`,"%$&!`R1\"`.F3H``(#A@``B('P`(.(```7QI M`Z9\O@2JD($`2)@!`-0X80#5?*,%JCAC`"!"`/_XDZ$`3#AA`$Q(`!JY@$$` M%#AA`-1(`!K5@$$`%"P#``!!@@`4.&$`U#B?`'1(`!KE8````#AA`-1(``4I M@$$`%#DC``$X```$.,$`2#A_`#PX@``$.*```SC@``0Y`0#4D`$`.#E!`$Q( M`!BA@$$`%$@``GPX8``(B!\`##B```)\:0.F?+X$JI"!`$B8`0'8.&$!V7RC M!:HX8P`@0@#_^).A`%`X80!02``:&8!!`!0X80'82``:-8!!`!0L`P``08(` M%#B?`'PX80'82``:16`````X80'82``$B8!!`!0Y(P`!.```!#C!`$@X?P!$ M.(``!#B@``,XX``$.0$!V)`!`#@Y00!02``8`8!!`!1(``'<.&``"(@?`!`X M@``#?&D#IGR^!*J0@0!(F`$"W#AA`MU\HP6J.&,`($(`__B3H0!4.&$`5$@` M&7F`00`4.&$"W$@`&96`00`4+`,``$&"`!0XGP"$.&$"W$@`&:5@````.&$" MW$@``^F`00`4.2,``3@```0XP0!(.'\`3#B```0XH``#..``!#D!`MR0`0`X M.4$`5$@`%V&`00`42``!/#A@``B('P`4.R``!'QI`Z9\O@2JDR$`2)@!`^`X M80/A?*,%JCAC`"!"`/_XDZ$`6#AA`%A(`!C9@$$`%#AA`^!(`!CU@$$`%"P# M``!!@@`4.)\`C#AA`^!(`!D%8````#AA`^!(``-)@$$`%#DC``$XP0!(.'\` M5#B```0XH``#..``!#D!`^`Y00!8DR$`.$@`%L6`00`42```H#A@``B('P`8 M.(``!WQI`Z9\O@2JD($`2)@!!.0X803E?*,%JCAC`"!"`/_XDZ$`7#AA`%Q( M`!@]@$$`%#AA!.1(`!A9@$$`%"P#``!!@@`4.)\`E#AA!.1(`!AI8````#AA M!.1(``*M@$$`%#DC``$X```$.,$`2#A_`%PX@``$.*```SC@``0Y`03DD`$` M.#E!`%Q(`!8E@$$`%"P;``%`@@!LB!H``BP````L@``!+P``!"^```A!@@!4 M3$;3@D&"``A`G@!(.&$)Z$@``D6`00`4.\,``8.X``!CHP``2``",8!!`!0Y M(P`!.'\`9#B``%0XH``".,$)Z&/'``!CJ```2``5M8!!`!1C@P``@8$.&#@A M#A"[`?_@?8@#IDZ``"`````````@08`(``````=D`!!C87-?7W-E='5P7W1R M86-E``!\"`*FE"'_L#AA`$"0`0!82``648!!`!2`8@!X@((`M#C```0XHP'8 M.&,`-$@`&%6`00`4D&$`2(!A`$!(`!AM@$$`%(!B`0A(`!B)@$$`%(!A`$B! M@0!8."$`4'V(`Z9.@``@````````($&`````````9``98V%S7U]T^$&!`!1\I00P?.<$,'R%.$!(```'S$,WA@````8````&````!@````8``` M`(%B`(!4H-E_@8L`!$"!`0AQC``/0*(!$'R#($!-A@`@080`$'P$*A1\@!A` M084`C'!I``-!@@`\.(3__SC#__\A*0`$?2D#IHSD``&C^?*D#ID@``!APJ``'5*7H_GRI`Z8XA/_\.,/__(3D M``2%)``$E.8`!)4F``1"`/_P38(`('T)`Z8XA``#.,8``XSD``&_+(```B\```-\J0.F39X`(#"$__\PH___08(`2$&&`!Q!F@`LC.0``2P' M``"`$R, MQ``!C.0``8T$``&-)``!+`8``"R'```O"```+XD``$O__["0"3X?_\?`@"IGQ_&WF0`0`(E"'_P$&"`%PX M@```@+\`("P%``!!@@`D@'\`)"P#``!!@@`82``-@8!!`!2`?P`D2``-G8!! M`!1CXP``.(```#B@`"A(``UA@$$`%(&!`$@X(0!`@^'__'V(`Z9.@``@@^$` M/#@A`$!.@``@````````($&``0$``````````'P`$F-A&ET````?`@"IK_!__B0 M`0`(E"'_P#O```!@?P``2__X]8!!`!0T@___?'\:%#B$__\XO___.]X``4"! M`#A\'B``B`/__XC%``$[W@`!G`4``3B$__^(`"(`___B,4` M`3O>``%+___@@8$`2#@A`$"[P?_X?8@#IDZ``"`````````@08`"`0`````` M````@``,8V%S7U]R979EF`00`4?'\;>8!B`)!!@@!4@^,`2$@`":F`00`4@4,``#D^ M`6PX8`!I.+X`=#B````XP``!..``$F/H``!+__JQ@$$`%#O@`&ECXP``@8$` MR#@A`,"[P?_X?8@#IDZ``"`L'P`!0((`?#B!`$`X?@"H2__Z58!!`!2``0!( M+`,``#A^`80X@`'H5``$)H#"`)`H@$``.+X`@$&```A!A@`\@08`5#A@`&DX MP``!.(```#C@`!5+__HY@$$`%#O@`&ECXP``@8$`R#@A`,"[P?_X?8@#ID@` M`'1+__IE8'\``#A^`9PL'P``0((`3$@`">F`00`4+`,``(!B`)!`@``X@^,` M8$@`"+F`00`4@2,``#B^`(PX8`!I.(```#C```$XX``88^@``$O_^<6`00`4 M.^``:6/C``"!@0#(."$`P+O!__A]B`.F3H``(````````"!!@`(``````<`` M'&-A0X@0!`2__Y*8!!`!2``0!(+`,``#A^`@!4!`0F5``% M_BB``?\K!$``08``B#B``?]!F@`@2``(X8!!`!0X@0!`.'X`F$O_^.F`00`4 M2```=#A^`AQ!A@!42``']8!!`!1\?QMY@&(`D$&"`$"#XP!(2``'M8!!`!2! M0P``.3X".#A@`&DXO@!<.(```#C```$XX``28^@``$O_^+V`00`4.^``:4@` M`3`L'P`!0((`V#B!`$`X?@"82__X=8!!`!2``0!(+`,``#A^`-PX@0!`5``$ M)H#"`)`H@$``.+X`:$&```A!A@`\@08`5#A@`&DXP``!.(```#C@`!5+__A9 M@$$`%#O@`&ECXP``@8$`R#@A`,"[P?_X?8@#ID@``,Q+__@-@$$`%(`!`$@L M`P``.'X`]%0`!"8H@$``08``"$&&`"1`@@`,2``'S8!!`!0X@`'_.'X!#$O_ M^$U\?QMY0((`=#B``?\X?@)42__X.7Q_&WDX@0!`.'X"<$""`%A(```4+!\` M`#B!`$`X?@)P0((`1$O_]YF`00`4@`$`2'Q_&WDX?@*,5``$)BB`0`!!@``( M088`($""``Q(``=9@$$`%#B``?\X?@*H2__WV6!_``!CXP``@8$`R#@A`,"[ MP?_X?8@#IDZ``"`````````@08`"``````((`!UC87-?7V-H96-K7W-O8VME M=%]D:7)E8W1O``0X80!`.*``!&/$``!+__*58````(`!`$`[W@`$8\0``#AA`$"0'P`` M.*``!$O_\G5@````@`$`0#O>``1CQ```.&$`0)`?``0XH``$2__R56````"` M`0!`.]X`!&/$```X80!`D!\`"#B@``1+__(U8````(`!`$`[W@`$8\0``#AA M`$"0'P`,.*``!$O_\A5@````@`$`0#O>``1CQ```.&$`0)`?`!`XH``$2__Q M]6````"``0!`.]X`!&/$```X80!`D!\`%#B@``1+__'58````(`!`$`[W@`$ M8\0``#AA`$"0'P`8.*``!$O_\;5@````@`$`0#O>``1CQ```.&$`0)`?`!PX MH``$2__QE6````"`80!`.]X`!)!_`"`L`P``08(`8$@`!4F`00`4@*(`H"P# M``"0?P`D@.(`D#DE`Q`XP``!.*4`.#B```!`@@`D@0<`$#A@``8Y0`#/..`` M!$O_]/V`00`4.Z``!D@``!1CQ```@+\`($O_\25@````8Z,``(&!`%@X(0!0 MNZ'_]'V(`Z9.@``@````````($&``P(``````````G0`%&-A```X M8``&@04`$#BF`"`X@```.,```3E``&``98V%S7U]R96U?96QE;5]F4&"_\1( M```4?2E`^'TI4'E!@O_,?0=#>#BE``-TYO\`5.=`/ISE``%`@O_T3H``(``` M````#"!``````````/``!G-T8&"`0"000`4@`P``(!,``1\"0.F3H`$ M(```````#*```````````!B!@@$$D$$`%(`,``"`3``$?`D#IDZ`!"`````` M``R@```````````8@8(!#)!!`!2`#```@$P`!'P)`Z9.@`0@```````,H``` M````````&(&"`12000`4@`P``(!,``1\"0.F3H`$(```````#*`````````` M`!B!@@$4&"_\1(```4?2E`^'TI4'E!@O_,?05#>#CG``-TIO\` M5*5`/IRG``%`@O_T3H``(```````#"!``````````7@`!G-T0``D($`0#@#__\H```!0($`("P#```L M@P`$+P,`"$S&$0),0M-"088`"$&"`&0X80!02__C'8!!`!0XXP`!.0$`0#A_ M`&0X@``^.*```CC!`%`Y(``$2__VH8!!`!2`@0!`2```+']CV!`N&P``?UH: M%$&"`HACPP``8T0``&-E```XP```0)+_&("!`$`L!```0((#4(!A`$20?``` M+`,``$""`""3H0!`B!D``BP````L@``(3$(S0D&"`VQ(``,X2__VK8!!`!20 M?``$+`,``$""`*R`@@"0.3\!K#B_`60X8``&@00`$#B````XP``!..``!#E` M`/Q+_^9E@$$`%#@```:(>0``D`$`0#@#__\H```!0($`("P#```L@P`$+P,` M"$S&$0),0M-"088`"$&"`K`X80!02__B%8!!`!0XXP`!.0$`0#A_`'0X@``^ M.*```CC!`%`Y(``$2__UF8!!`!2(&0`"+````"R```A,0C-"08("L$@``GR# M7```8'L``"P:``!.````08("(&/#``!C9```.,```&-%``!(``EE@$$`%"P# M``!`@`'<2__T?8!!`!2``P``+```!$&"`=B`8@"0@\,`'$O_]&&`00`4@4,` M`#D_`*PX8``*.+\!<#B````XP``!..``!V/(``!+_^5I@$$`%#B```J(>0`` MD($`0#@#__\H```!0($`("P#```L@P`$+P,`"$S&$0),0M-"088`"$&"`80X M80!02__A&8!!`!0XXP`!.0$`0#A_`'PX@``^.*```CC!`%`Y(``$2__TG8!! M`!2`@0!`2``!3(#"`)`XOP%\.&``"CB```"!!@`L.,```3C@``M+_^39@$$` M%#B```J(>0``D($`0#@#__\H```!0($`("P#```L@P`$+P,`"$S&$0),0M-" M088`"$&"`/0X80!02__@B8!!`!0XXP`!.0$`0#A_`(0X@``^.*```CC!`%`Y M(``$2__T#8!!`!2`@0!`2```O(#"`)`XOP%8.&``"CB```"!!@`L.,```3C@ M``M+_^1)@$$`%#B```J(>0``D($`0#@#__\H```!0($`("P#```L@P`$+P,` M"$S&$0),0M-"088`"$&"_4`X80!02__?^8!!`!0XXP`!.0$`0#A_`&PX@``^ M.*```CC!`%`Y(``$2__S?8!!`!2`@0!`2__]"']#T!`N&@``?WL:%$&"_M1C MPP``8V0``&-%```XP```0)+]^("!`$`L!```08(`+(`<```L````08(`&(!\ M``0L`P``08(`#$O_\M6`00`4D[P``).\``2(&0`"+````"R```A,0C-"08(` M-#AA`%!+_]]5@$$`%#CC``$Y`0!`.'\`C#B``#TXH``".,$`4#D@``1+__+9 M@$$`%(!A`$"!@2"T@`$@N#@A(+!\"`.F?8"!(+LA_^1.@``@````````($.` M!P(`````````!Q@`$6-AD8!!`!0XXP`!.'\`V#B``#PXH``! M.,$`4$O_\AV`00`4.&$`D#B````XH!``2__QD8!!`!17P`;^5\3H^CA@``%_ M82(4?'H`,(`;`)`X81"0.(```'P`TW@XH!``D!L`D$O_\5V`00`4@!L0D#A@ M`#R080!(DZ$`3#A^``%_0`-XD!L0D#CA`$@X@```.*$`D#C!$)!(``6)@$$` M%)!A`$`L`P``0(``N(!B`)"#PP`<2__PO8!!`!2!0P``.3\`M#A@``HXOP#, M.(```#C```$XX``'8\@``$O_X<6`00`4.```"HAY``"0`0!`.`/__R@```%` M@0`@+`,``"R#``0O`P`(3,81`DQ"TT)!A@`(08($C#AA`%!+_]UU@$$`%#CC M``$Y`0!`.'\`##B``#XXH``".,$`4#D@``1+__#Y@$$`%(@9``(L````+(`` M"$Q",T)!@@2,2``$6$""`*2`P@"0.+\`X#A@`&8X@```@08`)#C```$XX``) M2__A(8!!`!0X``!FB'D``)`!`$`X`___*````4"!`"`L`P``+(,`!"\#``A, MQA$"3$+30D&&``A!@@/H.&$`4$O_W-&`00`4..,``3D!`$`X?P`$.(``/CB@ M``(XP0!0.2``!$O_\%6`00`4B!D``BP````L@``(3$(S0D&"`^A(``.TDZ$` M0(`;$)!_0``Y0((`M(`;`)!\`-`Y08(`J(`<```X@0!$8\,``#B@``20`0!$ M.,```$@`!#F`00`48&H``"@#``1!@@'P+`H``(!B`)!`@`%$@\,`'$O_[Q6` M00`4@4,``#D_`)0X8``*.+\`^#B````XP``!..``!V/(``!+_^`=@$$`%#@` M``J(>0``D`$`0#@#__\H```!0($`Q"P#```L@P`$+P,`"$S&$0),0M-"088` MK$&"`N1(``"D@,(`D#B_`.PX8``*.(```($&`"`XP``!..``"$O_W\&`00`4 M.```"HAY``"0`0!`.`/__R@```%`@0`@+`,``"R#``0O`P`(3,81`DQ"TT)! MA@`(08("B#AA`%!+_]MQ@$$`%#CC``$Y`0!`.'\`%#B``#XXH``".,$`4#D@ M``1+_^[U@$$`%(@9``(L````+(``"$Q",T)!@@*(2``"5#AA`%!+_]LI@$$` M%#CC``$Y`0!`.'\`'#B``#XXH``".,$`4#D@``1+_^ZM@$$`%$@``@R!`P`H M.+\!!#A@``HX@```.,```3C@``HY(``$2__>[8!!`!0X```*B'D``)`!`$`X M`___*````4"!`"`L`P``+(,`!"\#``A,QA$"3$+30D&&``A!@@&T.&$`4$O_ MVIV`00`4..,``3D!`$`X?P`D.(``/CB@``(XP0!0.2``!$O_[B&`00`4B!D` M`BP````L@``(3$(S0D&"`;1(``&`@)P`!("\``!CPP``.,```$@``BF`00`4 M8&H``($\``!\`T@`08(!1"P*``"`8@"00(``M(/#`!Q+_^T!@$$`%(%#```Y M/P"<.&``"CB_`1`X@```.,```3C@``=CR```2__>"8!!`!0X```*B'D``)`! M`$`X`___*````4"!`"`L`P``+(,`!"\#``A,QA$"3$+30D&&``A!@@#0.&$` M4$O_V;F`00`4..,``3D!`$`X?P`L.(``/CB@``(XP0!0.2``!$O_[3V`00`4 MB!D``BP````L@``(3$(S0D&"`-!(``"<@0,`*#B_`1PX8``*.(```#C```$X MX``*2__=;8!!`!0X```*B'D``)`!`$`X`___*````4"!`"`L`P``+(,`!"\# M``A,QA$"3$+30D&&``A!@@`T.&$`4$O_V1V`00`4..,``3D!`$`X?P`T.(`` M/CB@``(XP0!0.2``!$O_[*&`00`4B!D``BP````L@``(3$(S0D&"`#0X80!0 M2__8V8!!`!0XXP`!.0$`0#A_`#PX@``].*```CC!`%`Y(``$2__L78!!`!2` M80!`@8$@N#@A(+"[(?_D?8@#IDZ``"`````````@08`'`@`````````&3``. M8V%S7U]S96YD7V1A=&&!@@$\D$$`%(`,``"`3``$?`D#IDZ`!"````````R@ M```````````8@8(!0)!!`!2`#```@$P`!'P)`Z9.@`0@```````,H``````` M````&(&"`42000`4@`P``(!,``1\"0.F3H`$(```````#*```````````!B! M@@%(D$$`%(`,``"`3``$?`D#IDZ`!"````````R@```````````8@8(!4)!! M`!2`#```@$P`!'P)`Z9.@`0@```````,H```````````&(&"`52000`4@`P` M`(!,``1\"0.F3H`$(```````#*```````````!B!@@%8D$$`%(`,``"`3``$ M?`D#IDZ`!"````````R@```````````8@8(!7)!!`!2`#```@$P`!'P)`Z9. M@`0@```````,H```````````&(&"`6"000`4@`P``(!,``1\"0.F3H`$(``` M````#*```````````!B!@@%DD$$`%(`,``"`3``$?`D#IDZ`!"````````R@ M```````````8``````````````````````````````````````````````;< M```#Q```!&0```4$```%I```!MP```;<```&0``````````````````````` M```````````````````````+1```#?0``!"H```0J```$*@``!%````/9``` M#V0```]D```/9```#?1)0DT@24)-($E"32!)0DT@("`@`$`H(RDR,R`@,2XT M("!SF5O9BAC M87-?7W1R86-E7V1E=&%I;%]L979E;',I+W-I>F5O9BAC87-?7W1R86-E7V1E M=&%I;%]L979E;'-;,%TI`$`H(RDY-B`@(#$N-B`@('-R8R]R7-T96T@)3$D'!I2`O=F%R+V-T+RX*`````%-20R!S>7-T96T@)3$D2!A;&QO8V%T:6]N M(&5R7-T96T@)3$D2!T;R!R96-E:79E(')E<75E7-T96T@)3$D2<@8V]N9&ET:6]N```R-C4Q+3$S,B!%;G9I7-T96T@ M)3$D2!S97)V:6-E(#!X)3(D,#AX+@````!34D,@71E&ES=',@86YD(&ES(&$@=F%L:60*"7!R M;V=R86T@;W(@=&AA="!S>7-T96T@2!T:&4*"7-Y"4S M)'@*0V]N=&%C="!T:&4@8VQU"4Q)'@*4F5P86ER('1H M92!C=&-A2!A('-U<'!O2!L:6)R87)Y(&ES M('5N86)L92!T;PII;FET:6%L:7IE('1H92!D871A('-T`I) M9B!T:&ES(&9A:6QU&5C M=71I;VX@;V8@=&AE($-L=7-T97(@2P@;W(@=&AA="!A9&1I=&EO;F%L(')E7-T M96T@:6X@=7-E"F]N('1H92!S>7-T96T@86YD('!E2!T:&]S90IS;W5R8V5S+@H` M````,C8U,2TQ,#,@;&EB8W1?8V%S($9A:6QU2!T:&%T('1H92!A<'!L:6-A=&EO;B!I2!U2!O=F5R=W)I='1E;B!T:&4@;65M;W)Y('5S960*=&\@2!L96%K"F%N M9"!M96UO6EN9R!T:&ES(&UE;6]R>2X*`#(V-3$M,3`Y M(&QI8F-T7V-A2!H879E(&EN861V97)T96YT;'D@;W9E2!U M2!I71E2!T:&4@97AE8W5T:6]N M"F5N=FER;VYM96YT+B`@5&AI2!I2!T:&%T('1H92!A<'!L:6-A=&EO;B!U2!O=F5R=W)I='1E;B!T M:&4@=F%R:6%B;&4@8V]N=&%I;FEN9R!T:&4@861D2!H879E(&EN861V97)T96YT;'D@ M;W9E0IU2!M;V1I9GEI;F<@=&AI&%M:6YE('1H M92!F:6QE"G-YF4@;V8@=&AE(&9I;&4@ M2!F:6QE('1O(&)E('5S M960@9F]R(&AO2!F:6QE(&EN('1H92!F;VQL;W=I;F<@9&ER M96-T;W)Y.@H))3$D7-T96T@8V]N=&%I;FEN9R!T:&ES M(&1I2!D;V5S(&YO="!H879E('-U9F9I8VEE;G0@&%M:6YE('1H M92!F:6QE('-Y7-T96T@861M:6YI2!E>'1E;F1I;F<@=&AE('-I>F4*;V8@=&AE(&9I;&4@ M2!F:6QE('1O(&)E('5S M960@9F]R(&AO3H*"24Q)',*5&AE(&9I;&4@2!F:6QE+B`@0V]N=&%C M="!T:&4@7-T96T@861M:6YI7-T96T@8V]N=&%I;FEN9R!T:&ES(&1I2X*```R-C4Q+3$R M-"!C=&-A7-T96US('=I=&AI;@IT:&4@8VQU2!L:7-T960@86)O=F4@97AI2X@ M($EF('1H:7,@8V]N9&ET:6]N"G!E2!F:6QE('1O(&)E('5S960@9F]R(&AO2!F:6QE M(&EN('1H92!F;VQL;W=I;F<@9&ER96-T;W)Y.@H))3$D2!L:7-T960@ M86)O=F4@97AI2X@($EF('1H:7,@8V]N9&ET:6]N M"G!E7-T96US(&EN M('1H92!C;'5S=&5R+B`@5&AE(&1A96UO;B!A='1E;7!T960@=&\@8W)E871E M('1H92!I;FET:6%L"G!R:79A=&4@:V5Y(&9I;&4@:6X@=&AE(&9O;&QO=VEN M9R!D:7)E8W1O2!I;B!T M:&4@86)O=F4@<&%T:"!N86UE(&UA>2!B92!M:7-S:6YG+"!O&ES=',L(&%N M9"!T:&%T('1H90IP97)M:7-S:6]N2!P97)M M:70@<')O8V5S2!A;F0@8W)E871E(&9I;&5S('=I=&AI;B!T:&4@ M9&ER96-T;W)Y+B`@268@=&AI'!E8W1E9"!T;R!F:6YD('1H:7,@9FEL92!I;B!T:&4@9F]L;&]W:6YG(&1I M3H*"24Q)',*5&AE('1R=7-T960@:&]S="!L:7-T(&9I;&4@;6%Y M(&)E(&UI2!N86UE(&UA>2!H879E(&)E96X@;6]D:69I960@=&\@9F]R8FED M(&%C8V5S2!A;F0@=&AE(&9I;&4N("!)9B!T:&ES M"F-O;F1I=&EO;B!P97)S:7-T2!B92!M:7-S:6YG+"!T M:&4@<&5R;6ES2!H879E"F)E96X@;6]D M:69I960@=&\@9F]R8FED(&%N>2!P2!N86UE M(&UA>2!H879E(&)E96X@;6]D:69I960@=&\@9F]R8FED(&%C8V5S2!T:&%T"G1H92!P=6)L:6,@86YD('!R:79A=&4@:V5Y(&9I;&5S(&5X M:7-T+"!A;F0@=&AA="!T:&4@<&5R;6ES3H* M"24Q)',*5&AI2!F:6QE('-Y7-T96T@8V%N('-U<'!O7-T96T@861M:6YI0IN86UE(&ES('-P96-I9FEE9"!A M;F0@8V]N7-T96US(&EN('1H M92!C;'5S=&5R+B`@5&AE(&1A96UO;B!A='1E;7!T960@=&\@8W)E871E('1H M92!I;FET:6%L"G!U8FQI8R!K97D@9FEL92!I;B!T:&4@9F]L;&]W:6YG(&1I M3H*"24Q)',*5&AI2!F:6QE('-Y7-T96T@8V%N('-U<'!O7-T96T@861M:6YI0IN86UE(&ES('-P M96-I9FEE9"!A;F0@8V]N7-T96T*=&\@;W1H97(@2!F:6QE(&EN('1H92!F M;VQL;W=I;F<@9&ER96-T;W)Y.@H))3$D2!M87D@ M2!N86UE(&UA>2!C;VYT86EN"FUO MF4@86QL(&%V86EL M86)L92!M96UO2!T:&%T('1H92!A M;&QO8V%T:6]N(&ET2!P2!A;F0@ M8V]N0IF:6QE(&]N('1H92!L;V-A;"!S>7-T96TN("!4:&4@9&%E;6]N(&AA2!C;VYF M:6=U7-T96T@:&%S(&)E96X@8V]R'!E8W1E9"!T;R!F:6YD(&)O=&@@=&AE('!U M8FQI8R!A;F0@=&AE('!R:79A=&4@:V5Y(&9I;&5S(&EN('1H92!F;VQL;W=I M;F<*9&ER96-T;W)Y.@H))3$D2!F:6QE2!R96UO=FEN9R!T:&5S92!F:6QE2!F:6QE3H*"24Q)',*26YF;W)M('1H92!S>7-T96T@ M861M:6YI7-T96T@861M:6YI M7-T96TN("!)9B!C;'5S=&5R"G-E8W5R M:71Y(&)A7,@87)E(&EN('5S92P@=&AE2]#05,O8FEN+V-T8V%S7W5T:6QS+F,L(&-T2]# M05,O8FEN+V-T8V%S7V-O;6TN8P!`*",I.3D@("`Q+C<@("!S2]#05,O8FEN+V-T8V%S7V-O;6TN8RP@8W1S96,L(')S8W1?"``?Q0````````````` M````````(``?4````````````````"``<(@`````````````````````(`!W MN```````````````````````````(`!_&"``?QP````````````````````` M```````````@`'\@`````!``%T``````````````````````(`!_*``````@ M``L8````````````````$`!)\```````````````````````````(`!WP``` M```````````````````0``.````````````````````````````````````` M`0```#H```"G````J0````@```UD```!H```#@UE&ET`````````````$`* M`````0````!F'!G-2YO``!L:6)C=%]C=2YA`'-HF5?,0``#G1R7W-E=%]S:7IE M7S$``!AT rexec ls 3) Invoke the script (as root) on the HMC like so: DiagnoseHMC --target= --password= To provide multiple targets, use quotes and separate them with a comma: DiagnoseHMC --target="lpar1, lpar2, lpar3" --password= -------------------------------------------------------------------------------- Known problems / future work -------------------------------------------------------------------------------- Basic NLS support is present. Each sub-command exports "LC_ALL=C" so the output should now be parsable by the script even if the default locale is something other than C. I have not tested this feature too much - let me know how it goes. The output can be a bit too wordy and ugly looking. igu kV0PB7u0 @ @ @ 0./opt/csm/csmbin/getSourceIP2Targetnd_R@ Q vH f t( h1L.text(((_ .data fD:@.bss ( (.loader("(|nx|#x|+x|1Bh9 e)-*@H `HH!A|nxAA| QN!A9}sx}{x~xHY` ,Ab$H A| @__start|b,0!;8 `?\XHՀA8`PHA8;@DH@D8`PHAH,@dH A, @4@H AD8D`PHA@HH H,@8`cHAH,A@D8`PKtL@H8LdTTd6@|!n8@P8TH TLP<8 T|).|*8 PHUTPX<@,@ЀP *}|(.Tg8|:}e8.| @AD, AH9A}8c}Tf8|2}e0.| @@̃<T;| <@,P *}|(.Tg8|:}e8.KH(H8`cHA8`HA0T8d XH̀AT|@P H`@H!A!}N (!X0 X|!֐|Hd 8,A4`f|c"8| .,A`f|c"8| .,K`N H|```}!b\;:b/A8e,Ap,Ah,@H@$H{YA 8H8 8Hcc$Hр/Hh,@ AlA/HD |@@8T~c||@@ | @A *c$Hi/A8|{||e||K`8`z|@@cHA|@@~/Al8e,A\,AT,@8@Hz A H8 HccdHЕ,Hl,@$A|B|@@tHl |@@4T~|d|@@ d|@A |"HcdcH),A~~CH|@@`,A/A(e,A ,A8`|@`@cH}A|@@~/Ah8e,AX,AP,@@$HxA 8H8 8Hh,@ AlA/HD |@@8T~|d|@@ d|@A`"ccdHـ/A8|`|KU`8`|@@cH|}A|@@/Al8e,A\,AT,@8@HwA H8 HccH ,Hp,@(Ax8!pc}N  |@@4T~|d|@@ d|@A |"HccH͝,A8~x8!pc}N /A@8e,A0,A(,@ @KccdH-,H,@$A8e,A,@K (A |@@dAH8e,A ,@(Hv A ccdH̭H$8 ccdH̉,A$~cceK`~~x8!pc}N ALR__ct__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FPCc؃c|`;!P`cv,@b|B; @,@,@ ;|@@`,A<|,@8`|||(8|KaA,A T`H$|@@ 8H8A8TA,@0Hc,@@,K4D,@|B; A,@,@ <|@@`,A<},@8`|||(8|K]A,A T`H$|@@ 8H8A8TAc,@,H,@A,K4aDaLaHalahPaTaX8Papa\cdBHmaP8!}N A t{count__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__CFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__|,!``AH8e,A ,@(HpـA8`s A4H$88`s AcHpAcH8!@}N AP__dt__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fvԃ|``~!p`;@:,@; |c~!@!A,@,@ 5X|@@`,A<|,@8`|||(8|KAA,A TwH$|@@ 8H8A8TA{,@4H{,@ c~!@!A,K0,HcAH|L@<8Pc8ccHD)P]8!}H,A0H`;`aAaC,#@H,@H`,@,c,@c,KaHHp,@L|@@@H`,@(|@@H`,K܈,@ H`;`aAaC,#@ |,@ dE|@@`,A%AccH> AH$8ccH=Ac[,@cKx,AH8e,A ,@(H=AcH=AH$8cH=aAc,@}cz,K܀c8ccx8!p!}N Acerase__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FQ3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__8iteratorT1|!`HH:iAH8!@}N A(g_Freenode__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node|;`~!T8` H;A`}`d@8`H;A,A @8D8`H;A,A D88`H;eA,A T8~c~c~cx8!p}N A1_Init__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__Fvԃc|``!`cu,@;`B|; a@,@,@ x:|@@`,A<|,@8`|||(8|KA,A T`H$|@@ 8H8A8TA,@0Hc,@a@,K4D,@;B|; A,@,@ :|@@`,A<~,@8`|||(8|KA,A T`H$|@@ 8H8A8TAc,@,H,@A,K4aHDH8!}N A Tequal_range__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__CFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__|!ahaDX@H,}X8!P}N A,_Distance__3stdHQ3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__14const_iteratorUl_Q3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__14const_iteratorT1RUl_v88c N @b_Key__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node|,!;@$b|,@8|@@`,APd,@c|`||(8|KـA,ATcX8!P}N |@@8`X8!P}N A;WX8!P}N A__cl__Q2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___CFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__RCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__a|;=}&9|@@!8`?`~a(,4`̘0\Xa`dA B;?hlp:ӓtbH.}A`vl,A|@Ap|| @@88|@:;@8hH.]Apl/A H:l`x~d|@@8hH.MAp|s|@@c~|@;:@8hH.Ap|v|@@`u,Al/ADe,A(,A 8`|@`@8hH-Ap|@@pl/A,At,Al,@L8e@$H(Alpt8H8lpt8H8hbHl/Hl,@$AppAl,OHDt|@@8T~8h||@@ | @A~*bH~l/A8l|vp||v*||K|!`p8`~|@@8hH,IAp|@@pl/Al,A`,AX,@<8e@H'QAlptH8lptH8hbH},Hl,@$A|pBp|@@tHlt|@@4T~|d|@@ d|@A |"Hb8hH}m,AlpCpHp|@@`,AĀl,A(e,A ,A8`|@`@8hH*Ap|@@pl,Ah,A\,AT,@8e@$H%Al|pt8H8l|pt8Hh,@ AlpAl,HDt|@@8T~|d|@@ d|@A~"8hbH|l,A8l|*p`|Ky`p8`~|@@8hH)Ap|@@pl/Al,A`,AX,@<8e@H$ɀAlptH8lptH8hbH{Q,H,@HA̓pB8z88|@[|x_p@Ht|@@4T~|d|@@ d|@A |"Hb8hHz,AHlpC8z88|@[|xH4pl/A@,A4,A,,@8e@K8hbHzE,H,@$A8e,A,@Kt(A |@@dAH8e,A ,@(H#!Alpt8hbHyH$8lpt8hbHy,A(lbbKw1`lpD8z88|@[|x_p@Zy; 8A8H'EA|z|@@`y,Ax/A(e,A ,A8`|@`@8H&ŀA|@@/Ah,A\,AT,@8e@$H!̀A8H88Hh,@ AlF/HD|@@8T~|d|@@ d|@A"8cHw/A8|z||e||Kui`8`Y|@@8H%A|@@_/Al,A`,AX,@<8e@H AH8H8cDHw!,H|,@4AxG88x88xH%)`Hh|@@4T~|d|@@ d|@A |"HcD8Hv,A_HѮ88x88xH$`H.Al,@$|,@ cH`d,@L@(b|,@ cH_t8HL8|@@8H#A,A<,A0,A(@8e@XK<8cDHu,H@$A@8e,A,@ K(A |@@dAH8e,A ,@(HiA8cDHu H$88cDHt,ALl,@ b|,@ ccEKrU`_IѮ88x88xH"`[l,AL8e,A ,@,HAlpt8` H!]AH(8lpt8` H!5A`|`dL8`H!EA,A L8P8`H!!A,A P88`H!A,A 8`[T8| H [~| @8@tHX8`H)A(TcHqA8`H,e`8`KpA4~| @8@~~HX0,A4~|@@8c,@H0~|@@c,@89`|(@@,@4cc,@8H$| @@`,@e|0@@8dHx|0@@8dH4d,@|8@@H|8@@HȐH,@4cc,@H| @@`,@e|0@@8dHx|0@@8dH4d,@|8@@$,@dHP|8@@$,@4H ,@|(@K~!8,c|} aN (c X_Insert__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FbPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_NodeRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__,AN ,@D,@,,@,K쐣N ,@L|@@@`,@(|@@`,K܈,L N @9_Dec__Q3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__8iteratorFv|!8d`d`?PXT\8`HՀA|~yAd8Sc8K%cd88H!}N 8`HA8`H"i`8`H"]`!}N (aP7_Construct__3stdHQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___PQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__RCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___v|A}&!`|(@`~``@HA|@@c|@@;|@@cHQA||@@`},;`A/A(e,A ,A8`|@`@cH̀A|@@/Ah8e,AX,AP,@@$HՀA~~~ 8H8~~~ 8Hh,@ Al~a@e/HD |@@8T~|d|@@ d|@A"ccHe/A8|||*||Kcq`8`|@@cHA|@@/Ap8e,A`,AX,;@8@HA~~~ H8~~~ HccHe%,H,@$A~aAe|@@H |@@DT~c||@@ |(@;A|"HdH;cHdH;,A~aB}H|@@`,A/A@e,A$,A8`|@`@cH%A|@@/A8e,Ap,Ah,@H@$H -A~~~ 8H8~~~ 8HccHc/Hh,@ Al~a@e/HD |@@8T~c||@@ | @A*cHc=/A8|*`|K``8`|@@cHA|@@/Ap8e,A`,AX,;@8@H A~~~ H88~~~ H ccHbm,H,@0A~edh8!`c|} AN  |@@HT~||@@$ | @;A|cHaH;ccHaH;,A|~}dh8!`c|} AN .A|@@;;`,@ |b,@ c,@,AH8e,A ,@(H uA~~~ ,@DH$8~~~ ,@ |b,@ c ~ 8H\;;`8|@@cHA~,A<8e,A,,A$@ @KccH`U,H@$A8e,A,@K (A |@@dAH8e,A ,@(H 5A~~~ ccH_H$8~~~ ccH_,AT,@(|b,@ c|H|~cK]`~}dh8!`c|} AN Cpassign__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__UlT2N @ __dl__FPvT1N @N_Iter_cat__3stdHQ2_3std26bidirectional_iterator_tagQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__lPCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__RCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___RCQ2_3std8iteratorXTQ2_3std26bidirectional_iterator_tagTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TlTPCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc____Q2_3std26bidirectional_iterator_taga88|M 8,@,@Hh,@,h,@h,KaHd,@L|@@@a,@(|@@a,Kܑa|M 8,K,N @ _Distance2__3stdHQ3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__14const_iteratorUl_Q3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__14const_iteratorT1RUlQ2_3std26bidirectional_iterator_tag_v|,!;@$|,@8|@@`,APc,@c|`||(8|KVɀA,ATcX8!P}N |@@8`X8!P}N A;WX8!P}N A__lt__3stdHcQ2_3std11char_traitsXTc_Q2_3std9allocatorXTc__RCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__RCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___b|,!;@$|,@8,A8c,@c|`||(8|KUA,@4|@@ ;cX8!P}N A;cX8!P}N Acompare__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__CFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__N @y_Destroy__3stdHPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node_PPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node_v|``d!8`HqA,A H8!@}N AH_Construct__3stdHPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_NodePQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node_PPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_NodeRCPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node_v`|,!AP8e,A ,@0HA8 H8!@}N 88 H8!@}N A_Destroy__3stdHQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___PQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___vN @swap__3stdHc_RcT1_v,A| @Ac||@@ 8`N 8`N @4U_Inside__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FPCc|8|@!``}T>@ HA,A8}/AH |@@}/A,A,A|,@`,A@8e,A ,@ HaA8`}}} Hx88`}}} H\ccHI8`HH,@|A`,A@8e,A ,@ HA8 H088 HA88`HȀ A(A |@@,AL8e,A ,@,HYA8c cHHH`88c cHHH8|@@0T~|d|@@ d|@A"ccHH8`X8!P}N APS_Grow__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FUlb܃|!,@`;b|B; @,@,@ ;|@@`,A<~,@8`|||(8|KFA,A T`H$|@@ 8H8A8TA,@0Hc,@@,K4cx8!p}N A 0}_Lbound__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__CFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__؃|``!,@;`B|; a@,@,@ x:|@@`,A<},@8`|||(8|KCՀA,A T`H$|@@ 8H8A8TAc,@,H,@a@,K4x8!p}N A 4upper_bound__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__CFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__|8` !|`HA`~;@8`cHA,A @8D8`HuA,A D8;|8`HQA,A ch8!`}N Ag_Buynode__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Nodecc||4T~hN @l__ne__Q3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__8iteratorCFRCQ3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__8iterator,L ,@D,@,,@,K쐣N ,@L|@@@`,@(|@@`,KܐN @9_Inc__Q3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__8iteratorFv|}&;! 8萡X\a`d``},A blpt;cHA`yl,A|@Ap|| @@48|@;@@8ahHApl/AHԀl;@~|@@8ahHՀAp|v|@@c#6|@;@8ahH祀Ap|y|@@`x,Al/ADe,A(,A 8`|@`@8ahH%Ap|@@pl/A,At,Al,@L8e@$H-Alpt8H8lpt8H8ahbH8l/Hl,@$AppAl,OHDt|@@8T~8ah||@@ | @A~*bH89l/A8l|yp||y*||K5`p8`8|@@8ahHՀAp|@@!pl/Al,A`,AX,@<8e@H݀AlptH8lptH8ahc$H7e,Hl,@$A|pBp|@@tHlt|@@4T~|d|@@ d|@A |"Hc$8ahH6,Aal!pCɮpHp|@@`,Al,A(e,A ,A8`|@`@8ahHyAp|@@!pl,Ah,A\,AT,@8e@$H߁Al|pt8H8l|pt8Hh,@ AlpAl,HDt|@@8T~|d|@@ d|@A "8ahc$H5l,A8l|*p`|K3%`p8`6|@@8ahHMAp|@@!pl/Al,A`,AX,@<8e@HUAlptH8lptH8ahc$H4,H,@DAȓpB!p88A[.|axA@Ht|@@4T~|d|@@ d|@A |"Hc$8ahH4Q,AHal!pCɮ!p88A[.|axH4pl/A@,A4,A,,@8e@K8ahc$H3,H,@$A8e,A,@Kt(A |@@dAH8e,A ,@(HܱAlpt8ahc$H3UH$8lpt8ahc$H31,A(alcc%K0`al!pDɮ!p88A[.|axAal,@$|,@ DcH`d,@L@(b|,@ CcHa!t8Hx8|@@8aH1A,Ah,A\,AT@<8e@HIAH8H8ac$H1,H@$A8e,A,@K(A |@@dAH8e,A ,@(HڱA8ac$H1UH$88ac$H11,ALl,@ b|,@ Ccac%K.`a!Iɮ88(x8a8xH `[l,AT8e,A ,@4HـAlptL8a,@H08lptL8a,@,@H,@,,@,K쐃LH`e,@L|@@@a`dc,@(|@@a`dc,KܐaPe``,A eHT,@Dd,@,d,@d,K`d|@@X,@|@@e|@@H<|@@d|@@Hd|@@p,A|@@HT`g,@,,@,K|@@8,A,@H `g,@,,@,KHЀ|@@`|@@HH<,@d|@@ HD|@@0,@H,,@|@A|,@p8|(@@T,@,@|8@@$,A\HP|8@@$,A,H ,A `Hp,@,AH,@8,@|@@88Hx|@@88H48,@|@@H@|@@H H,@,@|8@@$,@HP|8@@$,@H ,@,@,@`|(@A,@|(@K8,A8e,A ,@HqAcHYAH,@8,@|@@88Hx|@@88H48,@|@@Kx|@@KXKH8cHɀA},A 88!|} N (C PXaerase__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FQ3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__8iterator|a!`,`@XaD;c,@aDK{,AH8e,A ,@(H͕AcH}AH$8cHYAc|,@aDKx,AH8e,A ,@(H AcHAH$8cHрAc,@c,K܁h8!`a}N X8!`N Ad_Erase__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node88H%d @ __dftdt__Q2_3std12length_errorFv<`8cN @ 5max_size__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__CFv!|;;`b}&| @8c8 !$`;@@;y; 8AcHՀA|{|@@`y,A /A(e,A ,A8`|@`@cHUA|@@_ /Ah8e,AX,AP,@@$H]A 8H8 8Hh,@ AlA /HD|@@8T~|d|@@ d|@A@"ccDH /A8 |{||e||K`8`Y|@@cH!A|@@_ /Ap8e,A`,AX,;`@8@H%A H8 HccDH,H,@8At8x8!pc|} !N |@@HT~||@@$ | @;`A|cH1H;`cDcHH;`,A _t8x8!pc|} !H.A{;@,@ b|,@ Cc,@\{,@(b|,@ C cH  8HL;@8|@@cHA ,A<8e,A,,A$@ @,Kcc$H,H@$A8e,A,@K؀(A |@@dAH8e,A ,@(HɀA cc$HmH$8 cc$HI,AH,@ b|,@ Cc c%K` ?t8x8!pc|} !N C\f__ct__Q2_3std12length_errorFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__,@c|@@N d|@@N N @xf_Lrotate__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node,@c|@@N d|@@N N @xf_Rrotate__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node,L c,L c,KN @<b_Max__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Nodec||4T~hN @z__ne__Q3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__14const_iteratorCFRCQ3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__14const_iterator,L ,@D,@,,@,K쐣N ,@L|@@@`,@(|@@`,KܐN @@_Inc__Q3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__14const_iteratorFv!|HHAH8!@}N A$_Allocate__3stdHc_UlPc_Pc|!`HHAH8!@}N A(*allocate__Q2_3std9allocatorXTc_Hv_UlPCv_Pc8`N @>__eq__3stdHcc_RCQ2_3std9allocatorXTc_RCQ2_3std9allocatorXTc__b!|HKy`H8!@}N A$©__Q2_3std11char_traitsXTc_FPcPCcUl|!`HHAH8!@}N A(&deallocate__Q2_3std9allocatorXTc_FPcUlc,L |b,L 88N @4Rc_str__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__CFv|b,L 88N @(T_Nullstr__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FvcN @Qsize__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__CFvc N @Ucapacity__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__CFv|!`| @``D`@HA||@@`,A<8`,A|~|D||(8|KA,@0|@@8`h8!`}H 8`A8`h8!`}N A\compare__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__CFUlT1PCcT18|)N @Q_Eos__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FUl8dN @U_Refcnt__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FPCc|a!`| @``@HɀA||@@`,A;`/A@,A(,A 8`||@@cHAA|@@/A8e,Ap,Ah,@H@$HIA 8H8 8HccH/Hh,@ Aha@e/HD |@@8T~c||@@ | @A*cHY/A 8||}|(|(|"K`8|@@cHA|@@/Ap8e,A`,AX,;@8@HA H8 HccH,H,@(Aech8!`a}N  |@@HT~||@@$ | @;A|cHH;ccHH;,A}ch8!`a}N ATerase__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FUlT1`|c!,AT,A(,A 8|@@cHA|@@/A8e,Ap,Ah,@H@$H A8`| H88`| HccH,Hl,@$AX8,ATHH |@@0T~|d|@@ d|@A"ccH,A 8H8!@}N <8!@N A|S_Freeze__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fv8`N @Umax_size__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__CFvA|;`!8|@8`?`zaHLaPT@`88~KH̀AK`};,A\HD8`H=A_8~HA`}8`KŀA;,AcK``,A\8d,A ,@at;@;`@a@cd| D;DH@| D;DALatK|{x@LeD}@H| AatK,@,A8aP8888Ke8a`8888$KMatc88H,@at8PK`{atc88Hi,@at8`K|{xcc8!a}N A\__print_all_entries__7ACLFileFRQ2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__bc,@8N N @$Ibegin__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FvN @ Gend__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__Fvc||4T~hN @__ne__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorCFRCQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorc8cN @ R__ml__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorCFvN @ Q__pp__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorFi|,!pT>`A8@,@xD@;X|` XAHx,@HaHaxaPaTxHnA88`HD@;X|` XA\a8HrqA,a@Ala\a`X@| Aa8K8`8!}N A8\_entry_exists__7ACLFileFRQ2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__PcbN @ __as__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorFRCQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iterator|!@p8p`~`a@aDHlрA~p8X8!P}N A|erase__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorN @_Next__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__4_AccFPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Nodec 8|4T~N @_lineIsComment__7ACLFileFv|}&! ``K],@.,A`cK,@PcKi,AHc88 K-,A|8`8!|} N 8`HhAPc8@K},@ c8@8K,@ c88 K,@cK,A88`8!|} N C$d_copy_stanza_to_outfile__7ACLFileFRQ2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__i8HL @1AddOrUpdateEntries__7ACLFileFPCcCPC11StanzaEntryi|`;}&b!84```ԓГܓcK,Ah8!`a}8`N cK,A$cK]h8!`a}8`N c4K`z;8` Hl9AaD`d,A ;!H;!D8`Hl5A,A aD,8A ;!H;!D8`HkA,A D,8`aӐc@D;;ēH8a8HH-;9|@;ēH8a8HK,,AA$cKcK%Ӏ,@(P|c;;AH(P|c;;A;aXaa`adHfAa|\8A(aXaa`adKĐaT`HfaAh8!`}8`N ,@䃢c48K,A$cKcKݛӀ,@(h|c;;AH(h|c;;A;aXaa`adHeuAa|\8A(aXaa`adKĐal`HeAh8!`}8`N ;8a8888K;a 8a 8888$Kᓁp8p8aHEax8x8aH1c88Ku,A,cKcKEӀ,@(|c;;AH(|c;;A;aXaa`adHc݀Aa|\8A(aXaa`adKĐa`HcAh8!`}8`N .A48 c8K,AcKcKӀ,@(|c;;AH(|c;;A;aXaa`adHbAa|\8A(aXaa`adKĐa`Hb9A8`H,@,c88K,AcKcK͛Ӏ,@(|c;;AH(|c;;A;aXaa`adHaeAa|\8A(aXaa`adKĐa`Ha A8`H@c88K,Hc88K,@cKacK㉛Ӏ,@(|c;;AH(|c;;A;aXaa`adH`!Aa|\8A(aXaa`adKĐa`H_ŀA8`Ht,@X8 c8K5,AcK)cKQӀ,@(|c;;AH(|c;;A;aXaa`adH^Aa|\8A(aXaa`adKĐa`H^A8`H,H,@DAȓxBx88|HS.aA@H||@@4T~|d|@@ d|@A |"Hb8apH>],AHatxCx88|HS.aH4xt/A@,A4,A,,@8e@K8apbH=,H,@$A8e,A,@K|(A |@@dAH8e,A ,@(HNAtx|8apbH=aH$8tx|8apbH==,A(atbbK`atxDx88|HS.aAat,@$8,@ cH`d,@L@(b8,@ cHa|8Hx8|@@8aHR%A,Ah,A\,AT@<8e@HM=AH8H8abH;,H@$A8e,A,@K(A |@@dAH8e,A ,@(HLA8abH;aH$88abH;=,ALt,@ b8,@ cabK`aI8h8 8a8HP`St,AX8e,A ,@8HK̀Atx|~888`HOAH48tx|~888`HOA,A _z|8!C} N (C  <P_Insert__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorRCP11StanzaEntry|a!;`;|(A`{;X@a@aXaHaLHIAX{D8c{|(A0@a@aXaHaLKx8!pa}N Aerase__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorT1|!`HHH̀AH8!@}N A(_Freenode__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node|!8`dH8hlKuAH8!@}N A<dump__11StanzaEntryCFvN @_Destroy__3stdHPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_PPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_vN @/_Destroy__3stdHP11StanzaEntry_PP11StanzaEntry_v|``d!8`HJ}A,A H8!@}N AHO_Construct__3stdHP11StanzaEntryP11StanzaEntry_PP11StanzaEntryRCP11StanzaEntry_v|``d!8`HÌA,A H8!@}N AHG_Construct__3stdHPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_NodePQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_PPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_NodeRCPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_v|!c HHH AH8!@}N A(_Allocate__3stdHQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_UlPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_PQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node|!d HHFрAH8!@}N A(allocate__Q2_3std9allocatorXTQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_Hv_UlPCv_PQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_NodeN @__ct__Q2_3std9allocatorXTQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_GP11StanzaEntry_RCQ2_3std9allocatorXTP11StanzaEntry_N @__ct__Q2_3std9allocatorXTPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_GP11StanzaEntry_RCQ2_3std9allocatorXTP11StanzaEntry_N @Q__pp__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorFv`|,!AP8e,A ,@0H?A8 H8!@}N 88 H8!@}N AS__dftdt__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fv88H 8 @ __dftdt__Q2_3std12length_errorFv<`@8cN @ Mmax_size__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__CFv;|`~ !``HBɀA`{,A|@A|| @@48|@;@cHBA/AH;|@@cHBA|||@@cc||@;@c@cHBmA|{|@@`z,A/A@e,A$,A8`|@`@cHAA|@@>/A8e,Ap,Ah,@H@$HA|@@/Al8e,A\,AT,@8@H9!A H8 HccH',Hp,@(Ax8!pc}N  |@@4T~|d|@@ d|@A |"HccH'Q,A8~x8!pc}N /A@8e,A0,A(,@ @KccdH&,H,@$A8e,A,@K (A |@@dAH8e,A ,@(H7A ccdH&aH$8 ccdH&=,A$~cceK`~~x8!pc}N ALR__ct__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FPCc!|;;`b}&| @8c8H !$`;@@;y; 8AcH;!A|{|@@`y,A /A(e,A ,A8`|@`@cH:A|@@_ /Ah8e,AX,AP,@@$H5A 8H8 8Hh,@ AlA /HD|@@8T~|d|@@ d|@A@"ccDH#逿 /A8 |{||e||KE`8`Y|@@cH9mA|@@_ /Ap8e,A`,AX,;`@8@H4qA H8 HccDH#,H,@8At8hx8!pc|} !N |@@HT~||@@$ | @;`A|cH"H;`cDcH"H;`,A _t8hx8!pc|} !H.A{;@,@ b8,@ Cc,@\{,@(b8,@ C cH  8HL;@8|@@cH7iA ,A<8e,A,,A$@ @,Kcc$H!M,H@$A8e,A,@K؀(A |@@dAH8e,A ,@(H2A cc$H H$8 cc$H ,AH,@ b8,@ Cc c%K` ?t8hx8!pc|} !N C\f__ct__Q2_3std12length_errorFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__|`p!A\,AP8e,A ,@0H0A8 H8!@}N 88 H8!@}N AQ_Tidy__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fb|`}&c,!L`A| @A|c|@@88|@;;@cH41A/AH;; |@@cH4!A|x|@@c~|@;`@cH3A|||@@`{,Ac/A(e,A ,A8`|@`@cH3iA|@@?/Ah8e,AX,AP,@@$H.qAO 8H8O 8Hh,@ Al@/HD |@@8T~|d|@@ d|@A "cCc$H/A8||||e||K `8`|@@cH25A|@@/Al8e,A\,AT,@8@H-=A H8 HccH,Hl,@$A|A|@@tHl |@@4T~|d|@@ d|@A |"HccHq,ABH|@@`,Axc/A(e,A ,A8`|@`@cH0ՀA|@@/Ah8e,AX,AP,@@$H+݀AO 8H8O 8Hh,@ Al@/HD |@@8T~|d|@@ d|@A`"ccdH/A8|`|K`8`|@@cH/A|@@/Al8e,A\,AT,@8@H*A H8 HccHQ,Hx,@0A|tx8!pc|} N  |@@4T~|d|@@ d|@A |"HccH,Atx8!pc|} N /Al8e,A\,AT,@8@H)A H8 HccH5,H,@$A8e,A,@K (A |@@dAH8e,A ,@(H(A ccHH$8 ccH,A$LcK} `x8!pc}N ClVassign__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FPCcUl|A}&!`|(@`~``@H,A|@@c|@@;|@@cH,qA||@@`},;`A/A(e,A ,A8`|@`@cH+A|@@/Ah8e,AX,AP,@@$H&A~~~ 8H8~~~ 8Hh,@ Al~a@e/HD |@@8T~|d|@@ d|@A"ccH5/A8|||*||Kz`8`|@@cH*A|@@/Ap8e,A`,AX,;@8@H%A~~~ H8~~~ HccH],H,@$A~aAe|@@H |@@DT~c||@@ |(@;A|"HH;cHH;,A~aB}H|@@`,A/A@e,A$,A8`|@`@cH)EA|@@/A8e,Ap,Ah,@H@$H$MA~~~ 8H8~~~ 8HccH݀/Hh,@ Al~a@e/HD |@@8T~c||@@ | @A*cHu/A8|*`|Kw`8`|@@cH(A|@@/Ap8e,A`,AX,;@8@H#A~~~ H88~~~ H ccH,H,@0A~edh8!`c|} AN  |@@HT~||@@$ | @;A|cH1H;ccHH;,A|~}dh8!`c|} AN .A|@@;;`,@ 8b,@ c,@,AH8e,A ,@(H!A~~~ ,@DH$8~~~ ,@ 8b,@ c ~ 8H\;;`8|@@cH%A~,A<8e,A,,A$@ @KccH,H@$A8e,A,@K (A |@@dAH8e,A ,@(H UA~~~ ccHH$8~~~ ccH,AT,@(8b,@ c|H|~cKt5`~}dh8!`c|} AN Cpassign__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__UlT2|`8`8h`8!8Da@HLC8c8HsAcHAch8!`}N (A@__dt__Q2_3std12length_errorFv|a!`| @``@H"ՀA||@@`,A;`/A@,A(,A 8`||@@cH"MA|@@/A8e,Ap,Ah,@H@$HUA 8H8 8HccH 倿/Hh,@ Aha@e/HD |@@8T~c||@@ | @A*cH }/A 8||}|(|(|"Kp`8|@@cH!A|@@/Ap8e,A`,AX,;@8@HA H8 HccH ,H,@(Aech8!`a}N  |@@HT~||@@$ | @;A|cH 9H;ccH %H;,A}ch8!`a}N ATerase__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FUlT18b,L 88N @(T_Nullstr__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fv|8|@!``}T>@ HA,A8}/AH |@@}/A,A,A|,@`,A@8e,A ,@ HmA8`}}} Hx88`}}} H\ccH8`HH,@|A`,A@8e,A ,@ HA8 H088 HA88`HȀ A(A |@@,AL8e,A ,@,HeA8c cHH`88c cHH8|@@0T~|d|@@ d|@A"ccH8`X8!P}N APS_Grow__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FUlb,A| @Ac||@@ 8`N 8`N @4U_Inside__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FPCc88H< @ __dftbdt__Q2_3std11logic_errorFv| `8;88~H,8!@`HDLCAP8e,A ,@0H As8~( CA__eq__3stdHcc_RCQ2_3std9allocatorXTc_RCQ2_3std9allocatorXTc__b8(N @__dftbdt__Q2_3std9exceptionFv|`p!8(A HՀAcH8!@}N AH__dt__Q2_3std9exceptionFv`|c!,AT,A(,A 8|@@cHA|@@/A8e,Ap,Ah,@H@$HA8`| H88`| HccH,Hl,@$AX8,ATHH |@@0T~|d|@@ d|@A"ccH,A 8H8!@}N <8!@N A|S_Freeze__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fv8`N @Umax_size__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__CFvA|;`!8|@8`?`zaHLaPT@`88~KHAK`};,A\HD8`H%A_8~HyA`}8`KdA;,AcKd``,A\8d,A ,@, @8pA08 T?@ TA8p Ad|`8|@@8T>| @88d,@8c@(@8c|T:HT:HW:||.}"| .,@d|A|d|@|@A@h@H@o|@< ,@|.s,`T>@HtpAHo ,A<:8aH8D8@bc9PHHp||.|*A|(.s,`T>@bcH`H ,A bcH`,@$H,A A@ TA target can be a hostname or an IP address. prints: IP address that would be used to connect to the target host. returns: 0 - success 1 - bad parameters passed 2 - no such host found 3 - socket/connect error 4 - memory allocation error 5 - internal error - bad api call 6 - internal error - unexpected return code from function IBMno such host found socket/connect error IBmemory allocation error IBMinternal error - bad api call Iinternal error - unexpexted return code from function I%s @(#)69 1.8 src/csm/common/HostNameUtils.C, csm_clients, csm_rveg, rvegs004a 6/30/04 11:43:43Q2_3std12length_error:0,Q2_3std11logic_error:0,Q2_3std9exception:0logic errorQ2_3std12out_of_range:0,Q2_3std11logic_error:0,Q2_3std9exception:0logic errorstd::logic_errorstd::length_errorQ2_3std12length_errorstd::logic_errorstd::out_of_rangestd::logic_errorstd::length_errorstd::out_of_rangeQ2_3std12out_of_rangestd::exceptionQ2_3std9exceptionstd::logic_errorQ2_3std11logic_errorQ2_3std11logic_error:0,Q2_3std9exception:0Q2_3std12length_error:0,Q2_3std11logic_error:0,Q2_3std9exception:0Q2_3std12out_of_range:0,Q2_3std11logic_error:0,Q2_3std9exception:0IBM%s calledIBCSM_COMMON::ip2hostname(ct_char_ptr_t, ct_char_ptr_t, ct_uint32_t)I returning [%s] for hostname of [%s]IB%s exiting, returning %dIBMCSM_COMMON::ip2hostname(ct_char_ptr_t, ct_char_ptr_t, ct_uint32_t)I cu_gethostbyaddr() returned %dIBM cu_gethostbyaddr() returned %d, but did not set host_pIBM%s exiting, returning %dIBMCSM_COMMON::ip2hostname(ct_char_ptr_t, ct_char_ptr_t, ct_uint32_t)I%s calledIBCSM_COMMON::fetchConnectivityNames(char **, ct_array_ptr_t *, ct_uint64_t)I%s exiting, returning %dIBMCSM_COMMON::fetchConnectivityNames(char **, ct_array_ptr_t *, ct_uint64_t)I%s exiting, returning %dIBMCSM_COMMON::fetchConnectivityNames(char **, ct_array_ptr_t *, ct_uint64_t)I cu_gethostbyname(%s) failed with code %dI [%s] was already added to result, skipping it this timeIB adding [%s] to result%s exiting, returning %dIBMCSM_COMMON::fetchConnectivityNames(char **, ct_array_ptr_t *, ct_uint64_t)I%s exiting, returning %dIBMCSM_COMMON::fetchConnectivityNames(char **, ct_array_ptr_t *, ct_uint64_t)I%s exiting, returning %dIBMCSM_COMMON::fetchConnectivityNames(char **, ct_array_ptr_t *, ct_uint64_t)I%s exiting, returning %dIBMCSM_COMMON::fetchConnectivityNames(char **, ct_array_ptr_t *, ct_uint64_t)I added [%s] to resultI%s exiting, returning %dIBMCSM_COMMON::fetchConnectivityNames(char **, ct_array_ptr_t *, ct_uint64_t)I%s calledIBCSM_COMMON::fetchConnectivityNames(const ct_char_ptr_t, ct_array_ptr_t *, ct_uint64_t)I%s exiting, returning %dIBMCSM_COMMON::fetchConnectivityNames(const ct_char_ptr_t, ct_array_ptr_t *, ct_uint64_t)I%s(%s) called ICSM_COMMON::isValidNonLoopbackIPAddress(char *)inet_aton(%s) returned an error%s is a local loopback addressI%s(%s) called ICSM_COMMON::isValidNonLocalMachineName(char *)IlocalhostIBhname is 'localhost', returning falseIBloopbackIBMhname is 'loopback', returning falseIBMlocalhost.localdomainIBhname is 'localhost.localdomain', returning falseIBhname is not a local hostname, returning trueIB%s calledIBCSM_COMMON::isElementOf(ct_value_t, ct_array_ptr_t, ct_int32_t, ct_uint64_t)IBMGEEFDFFG %s exiting, returning %dIBMCSM_COMMON::isElementOf(ct_value_t, ct_array_ptr_t, ct_int32_t, ct_uint64_t)IBM%s exiting, returning %dIBMCSM_COMMON::isElementOf(ct_value_t, ct_array_ptr_t, ct_int32_t, ct_uint64_t)IBM%s exiting, returning %dIBMCSM_COMMON::isElementOf(ct_value_t, ct_array_ptr_t, ct_int32_t, ct_uint64_t)IBM%s exiting, returning %dIBMCSM_COMMON::isElementOf(ct_value_t, ct_array_ptr_t, ct_int32_t, ct_uint64_t)IBM%s exiting, returning %dIBMCSM_COMMON::isElementOf(ct_value_t, ct_array_ptr_t, ct_int32_t, ct_uint64_t)IBM%s exiting, returning %dIBMCSM_COMMON::isElementOf(ct_value_t, ct_array_ptr_t, ct_int32_t, ct_uint64_t)IBMcomparing [%s] to [%s], case insensitivelyI%s exiting, returning %dIBMCSM_COMMON::isElementOf(ct_value_t, ct_array_ptr_t, ct_int32_t, ct_uint64_t)IBMcomparing [%s] to [%s], case sensitivelyIBM%s exiting, returning %dIBMCSM_COMMON::isElementOf(ct_value_t, ct_array_ptr_t, ct_int32_t, ct_uint64_t)IBM%s exiting, returning %dIBMCSM_COMMON::isElementOf(ct_value_t, ct_array_ptr_t, ct_int32_t, ct_uint64_t)IBM%s calledIBCSM_COMMON::areEqual(ct_array_ptr_t, ct_array_ptr_t, ct_int32_t, ct_uint64_t)IBboth are empty - so they are the sameIB%s exiting, returning %dIBMCSM_COMMON::areEqual(ct_array_ptr_t, ct_array_ptr_t, ct_int32_t, ct_uint64_t)IB%s exiting, returning %dIBMCSM_COMMON::areEqual(ct_array_ptr_t, ct_array_ptr_t, ct_int32_t, ct_uint64_t)IB%s exiting, returning %dIBMCSM_COMMON::areEqual(ct_array_ptr_t, ct_array_ptr_t, ct_int32_t, ct_uint64_t)IB%s calledIBCSM_COMMON::hostname2ip(ct_char_ptr_t, ct_char_ptr_t, ct_uint32_t)I%s exiting, returning %dIBMCSM_COMMON::hostname2ip(ct_char_ptr_t, ct_char_ptr_t, ct_uint32_t)I%s calledIBCSM_COMMON::hostname2ip(ct_char_ptr_t, ct_char_ptr_t *) returning [%s] for ip of [%s] cu_gethostbyname() returned %dIBM%s exiting, returning %dIBMCSM_COMMON::hostname2ip(ct_char_ptr_t, ct_char_ptr_t *)%s calledIBCSM_COMMON::ip2hostname(ct_char_ptr_t, ct_char_ptr_t *) returning [%s] for hostname of [%s]IB%s exiting, returning %dIBMCSM_COMMON::ip2hostname(ct_char_ptr_t, ct_char_ptr_t *) cu_gethostbyaddr() returned %dIBM cu_gethostbyaddr() returned %d, but did not set host_pIBM%s exiting, returning %dIBMCSM_COMMON::ip2hostname(ct_char_ptr_t, ct_char_ptr_t *)%s calledIBCSM_COMMON::fetchLocalHostPrimaryHostnames(ct_array_ptr_t *, ct_uint64_t)IB%s exiting, returning %dIBMCSM_COMMON::fetchLocalHostPrimaryHostnames(ct_array_ptr_t *, ct_uint64_t)IB gethostname() returned %d, errno=[%s]%s exiting, returning %dIBMCSM_COMMON::fetchLocalHostPrimaryHostnames(ct_array_ptr_t *, ct_uint64_t)IBgethostname() returns [%s]I cu_gethostbyname() returned %dIBM%s exiting, returning %dIBMCSM_COMMON::fetchLocalHostPrimaryHostnames(ct_array_ptr_t *, ct_uint64_t)IB%s exiting, returning %dIBMCSM_COMMON::fetchLocalHostPrimaryHostnames(ct_array_ptr_t *, ct_uint64_t)IB added [%s] to resultI%s exiting, returning %dIBMCSM_COMMON::fetchLocalHostPrimaryHostnames(ct_array_ptr_t *, ct_uint64_t)%Z%%M% %I% %W% %G% %U%IBMmarshalSD() called, count == %dData was NULL or count < 1, returning 1Ptt\%iIadding %d to size for CT_INT32 type [%s]IBM%uIadding %d to size for CT_INT32 type [%s]IBM%lliIBMadding %d to size for CT_INT32 type [%s]IBM%lluIBMadding %d to size for CT_INT32 type [%s]IBMSize was zero, returning 3Iunable to allocate buffer for munged dataIBX,ll%iICopying %d bytes of string [%s], was originally a CT_INT32I%lliIBMCopying %d bytes of string [%s], was originally a CT_INT64I%uICopying %d bytes of string [%s], was originally a CT_UINT32Copying %d bytes of string [%s]Copying %d bytes of binary dataadding %d to size for Char type [%s]IBMadding %d to size for Binary typeIB%lluIBMCopying %d bytes of string [%s], was originally a CT_UINT64convertASCIIToKey(%s) called, converting %d bytesIB%c%cIBMafter strtoul %x IBCSM_COMMON::SecBufferConvert::convertKeyToASCII(key,%d) calledI%02xIBMSecBufferConvert::convertKeyToASCII, returnString=[%s]ICSM_COMMON::sec2binary() calledCSM_COMMON::sec2binary() returing 0CSM_COMMON::sec2binary() allocation error, returing 1IBCSM_COMMON::signSD() called, count == %dIBMsigning marshaled data bufferIBfreeing marshalled data bufferIsec_prepare_message() call failed with error code == %d, returning thatCSM_COMMON::signSD() returning 0@(#)32 1.11.1.8 src/csm/common/ACLFile.C, dms, csm_rveg, rveg0414a 8/5/03 09:17:53CR*rwrwQ2_3std12length_error:0,Q2_3std11logic_error:0,Q2_3std9exception:0logic errorstd::exceptionQ2_3std9exceptionstd::length_errorQ2_3std12length_errorstd::logic_errorQ2_3std11logic_errorQ2_3std11logic_error:0,Q2_3std9exception:0I[%s][%d][%d][%s] IB/var/ct/lck/ctrmc.acls.lock%s.orig%sI %30s %s %-2sIB # %s I IBroot@LOCALHOSTIroot on this node always has accessLOCALHOSTIBevery one else on this node can read onlyIB/bin/cp %s %s 2>&1I/usr/sbin/rsct/cfg/ctrmc.aclsIB%s.%sIBnew_fileIBM%s /var/ct/cfg/ctrmc.acls |ޭ ޭ @(#)23 1.4 src/bos/usr/ccs/lib/libpthreads/init.c, libpth, bos520 8/19/99 12:20:14@(#)61 1.14 src/bos/usr/ccs/lib/libc/__threads_init.c, libcthrd, bos520 7/11/00 12:04:14 h     \hxόϠ ϸ <P (άZZZ(Dޭh   ޭ ޭ  ޭ     l x (    H    h    ޭh  ޭ  ޭ , ޭ 8 D͘ޭ P  0  ####################################################################### # Licensed Materials - Property of IBM # # # # 5765-E61 # # # # (C) COPYRIGHT International Business Machines Corp. 1996,2001 # # All Rights Reserved # # # # US Government Users Restricted Rights - Use, duplication or # # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # # #######################################################################  0 @ $t( 0@ $tZZDޭ < ޭp Hޭ Tޭ `    l x          ޭ  Hޭ  ޭ ޭ ޭ \ ####################################################################### # Licensed Materials - Property of IBM # # # # 5765-E61 # # # # (C) COPYRIGHT International Business Machines Corp. 1996,2001 # # All Rights Reserved # # # # US Government Users Restricted Rights - Use, duplication or # # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # # ####################################################################### ( h h h h h< h h h h1 h h0@ h2 h h hx h4 h^t hw h( hx h h hl h h h h h h h h h h8 h,H h2` hr< h h2 h2 h/ h2@ h     (ʠ  p  ͘  x  0   4  S: wr__quous3@@@errno@close@ link@ @ open@ rename@ unlink@ socket@ '@ 6@ D@malloc@ free@ _Errno@ exit@ atexit@ strlen@ fopen@ strchr@ \@ fprintf@ atoi@ printf@ isdigit@ fclose@ fflush@ j@ snprintf@ fgets@ sscanf@ strdup@ fseek@ stat@ system@ isalpha@ memcmp@ strerror@ connect@ v@ @ @ @ @ __crt0v@@@ @ @ @ @ @ )@ 8@ U@ j@ x@ @ @ @ @ @@ @ *@ B@ fcntl@ Q@ sleep@ ^@ w@ @ @@@ @  @ -@ O@ d@ __start t!       M M  M  M     N    (N , 0 < @ HN L P \ ` hN l p |           $ D X \ ` h p x |                 4 H d x     M M  M    N   N     N   $ ( 4 D L d t                  ( 0 D X t      t x |                             $ ( 0 4 < @ H L T X ` d l p x |                              $ , 0 8 < D H P T \ ` p xH             7    ) 1 B F  2   0       J     E 3  ! $' (& ,* 0  4 8% < @D D  HC LG PI T X \, `  d" h( l# p  t x |  4 5 K L  Q R  ;  ? : < = >  8 6  @ A O P 9  -   T +  .  S   $  /     $/usr/lib:/lib:/usr/ibmcxx/liblibc.ashr.olibC.ashr.olibpthread.ashr_comm.olibpthread.ashr_xpg5.olibbsd.ashr.olibct_tr.ashr.olibC.ashr2.olibC.ashr3.olibC.aansi_32.olibct_cu.ashr.o ___memset ___memmove loadquery ngetsockname gethostname_system_configuration strncasecmp vsnprintf fdatasync inet_aton inet_ntoa strcasecmp __mod_init__malloc_user_defined_name __dl__FPv __nw__FUl __nw__FUlPvterminate__Fv__CleanupCatch__vec__delete2 __BadRethrow__SaveNonVolatileRegisters__CurrentException __frame_ptr__my_pc_address__ExtractRegs#__setUncaughtExceptionFlag__3stdFb__RestoreRegsAndJump__ResetStackPointer__pthread_tracepthread_mutex_unlockpthread_mutex_lockpthread_mutex_destroy pthread_init __bsd_inittr_record_fmt_string_1 __vn__FUl __vd__FPv0__vft24__DynaCastDesc_si_public14__DynaCastDesc__vft13eti_cplusplus9type_infoterminate__3stdFvunexpected__3stdFv _Xlen__Q2_3std12_String_baseCFv _Xran__Q2_3std12_String_baseCFvcu_gethostbyaddr_1cu_gethostbyname_1*>BJ`np(Třh&R$0f:LdpďFƏnƏVrƏ|fvďď &ď \F     B j      @ LN   ԏBf ֏Ώ$4bҏjޏ 0Pޏ ޏ ޏ ޏ ޏ ޏ  .ޏ8 vvzC"&<CC>BXCC ,WD\h\\V jDٙ`MCٙ `( DޙX*ho  ,l,tRTpRR XRRLVV R!$C!DC!d!!""`"R###R%%LR&$&D&R(,R((),V+*+hV++,$C,H,`,C,,C--HC--%-C-..^.b.xC0xR1dW1|\1\1\468R6PR6tR6R6R6R7TR7pR8ޙ9"9J9N9`C9xj9H9999C:C:.:2:@C:hC:::C:C;@;;;?4R?@@`RARB4BVCC2CpVDVDD6DtVG RGTRHVHHRHVJ~VJJVMM&M*M<CMZM^MtCMMM܏M[MMCNCN4MNRNVNhCNCNCNNOOCOD OhOOOCOCPVPvPzPCPjPHP=PPQCQ8CQVQZQhCQCQQQCQCR^R~RRCRMR=RRSCS&S*S8CSNSRShCSSSSCTTT(CTTTTCTTUCU0CU^UbUxCVV V CVVVVCVW WlWLCWCWCXCX\CXCXCXtYCY8CYHYxCYYYCZnZZZCZZZC[[[ t[>[LC[|t[[C[t[\C\*\8C\\\\C]]]C],j]J]N]`C] ]]]]]^C^WbWiRjjk0kkRllmRn nhRo,oLoRpRqLRqtRtRt<RtRtRtRu$RyRyRyRzHRz`RzR}|R4WL\p\\nVrVvVzVVV8pDR,LRRRRxRLR0RVV|RV$TRpWW\\\`tRft \p|0lRHRpRR&V*pRV R V8VV~VV\RĄRRŌRV4VɊVɎɾV@W\\̀\̤\ZpԴpոR֠RdR(HِR4RیVVdܜR4RݎVݰ RtRRRPRhRRRRR@RTtRVVxRvVWW8RV*V.V T R   R  RW(<WLflRV$VRR^jXR$DRVVHRFVh&RRBRR`R * FV p     !.!4!!"8R##$#pR$ZV$V$%R%V&&$&8&&''t'R(((R)\)*V*:V*+8R+V+++,f,l,-(-pR.<.\.R///V/V0H0R1FV1h1123,3\4 44 4B4L4` 44/4R5F5h.5tL5G5G68G6p66[6ԙ7b7h777B7.78889F9H*9R9`ʙ9t9[99%9999[:::0>: ;9;;&;,%;V;X%;;.< G<<([Z>>?(?4[?Q@@,8@@)ALA\$ABCNDHRI4 KRMN$OWO\O\Q(RQRQRpRRRTRTdRTUPRURVRVRWRX RX:XRYXRZ RZ|R[DR[R\8R\R]0]n]_R_xR` W`D\`\\`\a$aWa\b0\bfb|bbc$c|cRddeRf(fpRg4gTgRi@Rii4j4jpjRk@Rk4kklRl@\lt\mRoRop qx\r(\sWtWxRyyzzPzzR{{|<R}P}R~\~|~R@RBN$<R(tR44,R*4LDRd,tR@`RR4RPRRDLR(RPRtR4 $PR4$R4$$dRHRtR>4B$xRRRz$R0RWW$$RR$W@TWdfR$24\l$ $R\RF4z4xR4$$`RtRH4&4$R~4 J6^&Nv  >f.V~ "&(*F,n.02z@n68u4@8ԙ,ҙ4œ¤`èf:Ď<Ķ>@B:DpŮŴkafDVJ\|ƈaƔfFHFLnNǖPǾRz4p@nTȖXȾZ\^6`^bɆdɮfhj&nNpvr       8 8 ` 8 ` 8 `  j ^ : ^  ^ (: ,^ 0^ <n @^ H: L^ P^ \l `^ h: l^ p^ |j ^ ^ ^ ^ ^ ^ v l ^ f $t Dt X` \` `p hn pl x` |` j d h ` ` f d b ` ` r d p v h z 4x Hv dd xb ^ | v v 8 8 V 8 V ^ T : T T : T T ` T : T T $^ (T 4T DT LT dx tT r v \ V V p n l V V j d h V V  f (d 0b Dt Xr tZ X     tz x |              6  R      X   <  :  $ ( 0L 4 < @ H L T. X `N d lB p xD | 0  F  H  $  J  8  P  R      @  P   V    $ ,B 0 8Z < D\ H P T \T ` p x     n f V j h l      d          P  |  ^    ` T |     $ ( , 0\ 4r 8 < @ DX H L  P TR XT \ `Z d h l p tx x |v V   4 6 p @ B z &  . $ ( * ,      0 2 < > " ~  ^   `  ~  b     t z   $ ) < R fcntl _ sleep j            . : J X {      , L __quous3.__quous3lverrnoclose link  open rename unlink socket   malloc free _Errno exit atexit strlen fopen strchr  fprintf atoi printf isdigit fclose fflush  snprintf fgets sscanf strdup fseek stat system isalpha memcmp strerror connect      __crt0vTOC hk6 kK k_$STATIC katexit kmalloc k k_Errno kfree kexit k_cdtors kc k kt k k kmemcmp k__crt0v k kR k_$STATIC k k_$STATIC k k kerrno k kprintf k k k kj k_$STATIC  k k k< k ksnprintf  ksystem $kstat (kstrerror ,kunlink 0kfopen 4kfseek 8kfclose <k) @kopen Dk Hkfcntl Lksleep Pkclose Tklink Xk \krename `kfgets dkisalpha hksscanf lk pkfprintf tkfflush xk |k_$STATIC k k k k kstrlen k, kL kt k k_$STATIC kX k k. k: kJ k_$STATIC k k k k{ k k k k kt k ksocket k kconnect k k kisdigit k k kstrdup  k k kstrchr katoi k  k_$STATIC $k yg g.__start(k.__start(z__start t  k p_xargc hp_xargv lp_xrcfg p_xrc .fileg'f k  _$STATIC pkZ    t |  .file gD^k .main k_$STATIC ks.file~ g^3k3 >3 Q4 c5< 6 7, 8 9  : ;  =d 7>, ^? @ @ A B k C< k OC  E  F$  DF  G`  6G  H\  J  J  K  L  L 4N gN ] ^4 ^t k ` ax `mx o o pH Tq q\ r  s t u sv wP bw kx ky (yx |,  7  0 O <  P ( kl   .H n k ` H T      & J4 k.@31x k.@7 k.@9 kk_$STATIC k@9 k  @7 k  @31 `k   $k  K 0k  '      1          x   l     c Hk  o k   Tk   <k  t 0k x4.file gk^km  .file g^k!8 ' ^/  kb0@ k v1< "^4 "y4X k#8 #9 (; #B %KF %G 'L 'VPL 'wRT 'S 'T 'V| (Z` (D\ (r^ , bx .eD 0gT id 7jd 2r< k3v 5w 7i}l 9 ;4 <  ? Axt Bml E FZ  G$ GL I L MrX N Ph Uq V P8  V+Ɣ WX Y-$ [\ ^ _?  a  kd  |x e?P gD j8 ls n   .l p1 pY( p ( p q(( q q r0X O  H 0 T r 0H t kt(H t   k v8 n k8     ! && w,H J1 k.@1462@ k.@5282` k.@312 k.@72 k.@92 k͘k_$STATIC k@9 Dk  @7 8k  @31 k  @528 k  t k   k  K k  w   v     k  c k  o ,k  2  k  _ Pk  t 4k @146 \k  .filegw7wvkXw _$STATIC kUw   w p.filegwwx x.file g../../cdtors.Cx!x;_cdtors .file gxdxtx;k x x kx kx( kx y< ky)t ky9 kyG  kyS  ky]  kʠk5_$STATIC kD__glab26 k  __glab13 k  t (kx |  K   c k  6 .file gygyyx;,ky, y .__glab7 k.__glab6 kk _$STATIC k<__glab6 k  __glab7 k  .file gyyykz, zG zR kz k_$STATIC knoname g.__Thrownoname gzstrcmp.s g.strcmp 0)z g.strncpy)moveeq.s g.bcopy @A).ovbcopy @._moveeq L.memcpy L.memmove Lmemset.s g.memset)ptrgl.s g._ptrgl k0._ptrgl  .$PTRGL  glink.s gzk(zglink.s g.exit k(.exit glink.s" g.printfxk(.printfxglink.s' gzk(z#glink.s, gzLk(zL(glink.s1 g{k({-glink.s6 g{hk({h2glink.s; g.fcntlk(.fcntl7glink.s@ g.sleepk(.sleep<glink.sE g{+2k({+2Aglink.sJ g{Cɬk({CɬFglink.sO g{Wk({WKglink.sT g{kk({kPglink.sY g{vk({vUglink.s^ g{k({Zglink.sc g{k({_glink.sh g{ k({ dglink.sm g{k({iglink.sr g{lk({lnglink.sw g{Čk({Čsglink.s| g{lk({lxglink.s g{Ĵk({Ĵ}glink.s g|k(|glink.s g|k(|glink.s g|(dk(|(dglink.s g|LDk(|LDglink.s g|blk(|blglink.s g|wk(|wglink.s g|Dk(|Dglink.s g|ǔk(|ǔglink.s g|Ǽk(|Ǽglink.s g|k(|glink.s g|k(|glink.s g.closek(.closeglink.s g.link<k(.link<glink.s g| @k(| @glink.s g.opentk(.opentglink.s g.renamek(.renameglink.s g.unlinkk(.unlinkglink.s g.socketȼk(.socketȼglink.s g}4k(}4glink.s g}k(}glink.s g.malloc k(.malloc glink.s g.free k(.free glink.s g._Errno hk(._Errno hglink.s g.atexit k(.atexit glink.s g.strlenlk(.strlenlglink.s g.fopenk(.fopenglink.s g.strchrLk(.strchrLglink.s g}k(} glink.s g.fprintfTk(.fprintfTglink.s g.atoitk(.atoitglink.s g.isdigitɄk(.isdigitɄglink.s! g.fclose$k(.fclose$glink.s& g.fflush|k(.fflush|"glink.s+ g}),k(}),'glink.s0 g}4 k(}4 ,glink.s5 g.fgetsk(.fgets1glink.s: g.sscanfk(.sscanf6glink.s? g.strdupk(.strdup;glink.sD g.fseekk(.fseek@glink.sI g.stat\k(.stat\Eglink.sN g.system4k(.system4Jglink.sS g.isalphak(.isalphaOglink.sX g.memcmp k(.memcmp Tglink.s] g}>k(}>Yglink.sb g.connect k(.connect ^glink.sg g}Hdk(}Hdcglink.sl g}SȔk(}SȔhglink.sq g}^\k(}^\mglink.s g}i$k(}i$r}u__pthread_tracepthread_mutex_unlockpthread_mutex_lockpthread_mutex_destroypthread_init__bsd_inittr_record_fmt_string_1cu_gethostbyaddr_1cu_gethostbyname_1__dl__FPv__nw__FUl__nw__FUlPvterminate__Fv__CleanupCatch__vec__delete2__BadRethrow__SaveNonVolatileRegisters__CurrentException__frame_ptr__my_pc_address__ExtractRegs__setUncaughtExceptionFlag__3stdFb__RestoreRegsAndJump__ResetStackPointer__vn__FUl__vd__FPv__vft24__DynaCastDesc_si_public14__DynaCastDesc__vft13eti_cplusplus9type_infoterminate__3stdFvunexpected__3stdFv_Xlen__Q2_3std12_String_baseCFv_Xran__Q2_3std12_String_baseCFv___memset.___memset___memmove.___memmoveloadqueryngetsocknamegethostname_system_configurationstrncasecmpvsnprintffdatasyncinet_atoninet_ntoastrcasecmp__mod_init__malloc_user_defined_name__C_runtime_pstartup__C_runtime_terminationPrioFcn__FPCvPCv_$STATIC_BSScrt0_dataTRACE_ENABLED__10CSM_COMMONTRACE_COMP_ID__10CSM_COMMON_file_mutex__7ACLFile__fsm_tab___Construct__3stdHQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___PQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__RCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___vcrt0main.s../../../../../../../src/bos/usr/ccs/lib/libc/__threads_init.cSun Sep 15 15:10:49 2002 C for AIX Compiler Version 5.0.1.0 --- .__threads_init_malloc_user_defined_name_xti_tli_init_routine_nsl_init_routine__dce_compat_init_routine../../../../src/csm/common/getSourceIP2Target.CThu Jul 8 15:48:24 2004 VisualAge C++ for AIX Compiler (DEVELOPMENT/BETA) Version 5.0.0.0.usage__FPc../../../../src/csm/common/ACLFile.CThu Jul 8 15:38:46 2004 .init__11StanzaEntryFPCcQ2_7ACLFile14PermissionTypeQ2_7ACLFile15PermissionLevelPCc.__ct__7ACLFileFPc.__dt__7ACLFileFv._copyDefaultFile__7ACLFileFv._fileExists__7ACLFileFv._openFiles__7ACLFileFv._closeFiles__7ACLFileFv._aquireFileLocks__7ACLFileFv._releaseFileLocks__7ACLFileFv._SwapFiles__7ACLFileFv._readLine__7ACLFileFv._copy_till_stanza_found__7ACLFileFPCc._lineIsStanzaHeader__7ACLFileFv._first_token__7ACLFileFPc._printToFile__7ACLFileCFP4FILEPCce._print_entry__7ACLFileCFPC11StanzaEntry.get_permission_type__FQ2_7ACLFile14PermissionType.get_permission_level__FQ2_7ACLFile15PermissionLevel._print_all_entries__7ACLFileFRQ2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__b.begin__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__Fv.end__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__Fv.__ne__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorCFRCQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iterator.__ml__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorCFv.__pp__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorFi._entry_exists__7ACLFileFRQ2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__Pcb.__as__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorFRCQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iterator.erase__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iterator._Next__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__4_AccFPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node._lineIsComment__7ACLFileFv._copy_stanza_to_outfile__7ACLFileFRQ2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__i.AddOrUpdateEntries__7ACLFileFPCcCPC11StanzaEntryi._processFile__7ACLFileFPCcCPC11StanzaEntryiT3.DeleteEntries__7ACLFileFPCcPPci.DeleteStanza__7ACLFileFPCc.__dftdt__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__Fv._Buynode__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_NodeT1._Insert__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorRCP11StanzaEntry.erase__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorT1._Freenode__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node.dump__11StanzaEntryCFv._Destroy__3stdHPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_PPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_v._Destroy__3stdHP11StanzaEntry_PP11StanzaEntry_v._Construct__3stdHP11StanzaEntryP11StanzaEntry_PP11StanzaEntryRCP11StanzaEntry_v._Construct__3stdHPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_NodePQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_PPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_NodeRCPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_v._Allocate__3stdHQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_UlPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_PQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node.allocate__Q2_3std9allocatorXTQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_Hv_UlPCv_PQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node.__ct__Q2_3std9allocatorXTQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_GP11StanzaEntry_RCQ2_3std9allocatorXTP11StanzaEntry_.__ct__Q2_3std9allocatorXTPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_GP11StanzaEntry_RCQ2_3std9allocatorXTP11StanzaEntry_.__pp__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorFv.__dftdt__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fv.__dftdt__Q2_3std12length_errorFv.max_size__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__CFv.__ct__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FPCc.__ct__Q2_3std12length_errorFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__._Tidy__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fb.assign__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FPCcUl.assign__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__UlT2.__dt__Q2_3std12length_errorFv.erase__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FUlT1._Nullstr__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fv._Grow__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FUlb._Inside__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FPCc.__dftbdt__Q2_3std11logic_errorFv.__dt__Q2_3std11logic_errorFv._Allocate__3stdHc_UlPc_Pc.allocate__Q2_3std9allocatorXTc_Hv_UlPCv_Pc.__eq__3stdHcc_RCQ2_3std9allocatorXTc_RCQ2_3std9allocatorXTc__b.__dftbdt__Q2_3std9exceptionFv.__dt__Q2_3std9exceptionFv._Freeze__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fv.max_size__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__CFv._Copy__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FUl.what__Q2_3std9exceptionCFv._Doraise__Q2_3std9exceptionCFv.what__Q2_3std11logic_errorCFv._Doraise__Q2_3std11logic_errorCFv._Doraise__Q2_3std12length_errorCFv.__dftdt__Q2_3std11logic_errorFv../../../../src/csm/common/security.CThu Jul 8 15:39:02 2004 ../../../../src/csm/common/HostNameUtils.CThu Jul 8 15:39:10 2004 .fetchConnectivityNames__10CSM_COMMONFCPcPP8ct_arrayUL.fetchConnectivityNames__10CSM_COMMONFPPcPP8ct_arrayUL.__dftdt__Q2_3std3setXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc____Fv.__ct__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FRCQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___RCQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___.__as__7in_addrFRC7in_addr.__dt__Q2_3std3setXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc____Fv.getsockname__FiP8sockaddrPUl.ip2hostname__10CSM_COMMONFPcT1Ui.count__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__CFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__.__dt__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fv.insert__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__.fetchLocalHostPrimaryHostnames__10CSM_COMMONFPP8ct_arrayUL.ip2hostname__10CSM_COMMONFPcPPc.hostname2ip__10CSM_COMMONFPcPPc.hostname2ip__10CSM_COMMONFPcT1Ui.areEqual__10CSM_COMMONFP8ct_arrayT1iUL.isElementOf__10CSM_COMMONF10ct_value_tP8ct_arrayiUL.isValidNonLocalMachineName__10CSM_COMMONFPc.isValidNonLoopbackIPAddress__10CSM_COMMONFPc._Allocate__3stdHQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node_UlPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node_PQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node.allocate__Q2_3std9allocatorXTQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node_Hv_UlPCv_PQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node.__ct__Q2_3std9allocatorXTQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node_GQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___RCQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___.__ct__Q2_3std9allocatorXTPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node_GQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___RCQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___.__dftbdt__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__Fv.begin__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__Fv.erase__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FQ3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__8iteratorT1._Freenode__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node._Init__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__Fv.equal_range__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__CFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__._Distance__3stdHQ3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__14const_iteratorUl_Q3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__14const_iteratorT1RUl_v._Key__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node.__cl__Q2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___CFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__RCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__._Insert__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FbPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_NodeRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__._Dec__Q3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__8iteratorFv._Construct__3stdHQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___PQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__RCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___v.__dl__FPvT1._Iter_cat__3stdHQ2_3std26bidirectional_iterator_tagQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__lPCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__RCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___RCQ2_3std8iteratorXTQ2_3std26bidirectional_iterator_tagTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TlTPCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc____Q2_3std26bidirectional_iterator_tag._Distance2__3stdHQ3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__14const_iteratorUl_Q3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__14const_iteratorT1RUlQ2_3std26bidirectional_iterator_tag_v.__lt__3stdHcQ2_3std11char_traitsXTc_Q2_3std9allocatorXTc__RCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__RCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___b.compare__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__CFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__._Destroy__3stdHPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node_PPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node_v._Construct__3stdHPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_NodePQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node_PPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_NodeRCPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node_v._Destroy__3stdHQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___PQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___v.swap__3stdHc_RcT1_v._Lbound__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__CFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__.upper_bound__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__CFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__._Buynode__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Nodec.__ne__Q3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__8iteratorCFRCQ3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__8iterator._Inc__Q3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__8iteratorFv.erase__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FQ3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__8iterator._Erase__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node.max_size__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__CFv._Lrotate__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node._Rrotate__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node._Max__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node.__ne__Q3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__14const_iteratorCFRCQ3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__14const_iterator._Inc__Q3_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__14const_iteratorFv.copy__Q2_3std11char_traitsXTc_FPcPCcUl.deallocate__Q2_3std9allocatorXTc_FPcUl.c_str__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__CFv.size__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__CFv.capacity__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__CFv.compare__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__CFUlT1PCcT1._Eos__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FUl._Refcnt__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FPCc._Ubound__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__CFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__.__dftdt__Q2_3std12out_of_rangeFv.__ct__Q2_3std12out_of_rangeFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__._Min__Q2_3std5_TreeXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__FPQ3_3std9_Tree_nodXTQ2_3std12_Tset_traitsXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__TQ2_3std4lessXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___TQ2_3std9allocatorXTQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc___SP0__5_Node.__dt__Q2_3std12out_of_rangeFv._Doraise__Q2_3std12out_of_rangeCFv../../../../../../../../src/bos/usr/ccs/lib/libpthreads/init.cSun Sep 15 16:25:03 2002 .call_pthread_init_pthread_init_routine../../../../../../../src/bos/usr/ccs/lib/libbsd/__threads.cSun Sep 15 18:32:13 2002 _bsd_init_routineWed Jul 19 12:25:37 2000 IBM C and C++ Compilers, Version 3.6.4.0../../startup.CWed Jul 19 12:25:36 2000 .__C_runtime_startup.__qsort__FPvUlT2PFPCvPCv_i.__NLibraries__FPc.__Extract_cdtors_Addresses__FPcP7LibDescRi.__C_runtime_termination.PrioFcn__FPCvPCv.qstexc__FPcN21.qsexc__FPcT1.qs1__FPcT1.__glab13.__glab26../../invokedtr.CWed Jul 19 12:25:38 2000 .__Invoke__Destructor.__Invoke__Delete../..//rs6000/except.CWed Jul 19 13:30:20 2000 IBM VisualAge C++ Professional for AIX Compiler Version 5.0.0.0.__set_PA_callback__FPFv_v.__DoThrow.GrabInformation__FRP12__sigcontextRPlT2P7tbtablelR9registers.nextFrame__FR9registersPlRP12__sigcontext.__ReThrowstrncpy.s.__mod_init.pthread_mutex_unlock.pthread_mutex_lock.pthread_mutex_destroy.pthread_init.tr_record_fmt_string_1.cu_gethostbyaddr_1.cu_gethostbyname_1.__dl__FPv.__nw__FUl.__nw__FUlPv.terminate__Fv.__CleanupCatch.__vec__delete2.__BadRethrow.__SaveNonVolatileRegisters.__CurrentException.__frame_ptr.__my_pc_address.__ExtractRegs.__setUncaughtExceptionFlag__3stdFb.__RestoreRegsAndJump.__ResetStackPointer.__vn__FUl.__vd__FPv.terminate__3stdFv.unexpected__3stdFv._Xlen__Q2_3std12_String_baseCFv._Xran__Q2_3std12_String_baseCFv.loadquery.ngetsockname.gethostname.strncasecmp.vsnprintf.snprintf.strerror.fdatasync.inet_aton.inet_ntoa.strcasecmp1ch k̃0PB7u^q@^q@^q@ ./opt/csm/csmbin/popk5login2Tar@q^H <`# /( /1L.text((<`(l60 .data #=t@.bss 1t 1t.loader at"(|nx|#x|+x|1B,9 e)-*@H`HDHA|nxAA| QN!AL9}sx}{x~xH` ,Ab$H;A| @__start!|bA,H ,A <cA|CN!Ab,Ac|CN!Ab,Ac|CN!Ab,Ac|CN!Ab,Ac|CN!AH8!@}N 8!@N A__threads_init@b0|!cHHEAH8!@}N A,call_pthread_init84A L| N HA L| N |!P!aD`;8`8H A88H A\b`|H ABhl"p8ecCH*`,c@$aDH |}yz@ H=`}z,@;HE`|888H0IA`dccH0YAzH.ŀA,8lb,LB1AH,`,|8088A(8hH8Ab8H,`H0H/A8`d8~ H/̀Ab8H,e`,8pA H7Acx8!p!}N Amain|!}&!Pa8;A48a48H-`8 8a4H-`8cH-``~"8c#H-``y848a4H-`8H8a4H.A,Aa8H`\8881}H.A`da884H.Abp,@4}8881H.EA`d8~ 84H.YAx!TAX8!p}8`N a8H1`,@Ѐ 8a@dH1]A|dyA48a8H`x!TAX8!p}8`N a@<8DeH1 A|dyA48Ȁa8HE`x!TAX8!p}8`N 8,8a4H)1A,@`a8H`b\8p88#cH-!A`da884H-5Ax!TAX8!p}8`N a8a88@HU`8a8@(/@dH y`8@8aHрA,8aA@HA`z88a8H `8a8HA,AH;|@88a8Ap8`8!!}H8!!}N aKAb\8 d88 cHIA`da8H]A8`K A checkpath|!0`;8`[H ՀAx8a8H`8aH 1`8L8aH !`8,8aH `88aHa`8aH `8T8aH `8(8aH `8@8aH)A\<8,| 8a8LDBAH =A,808a@pHA,@8`8!л}N Kb\8 8c8HŀA`dc8HـA8`H(8a84HyA,@;c8!л}N ASetupLogtA L| N |A L| N A L| N A L| N A L| N A L| N A L| N b8qA||+|"*AH|8@@@@|A LHp|+|*A$0|8@@@|+@P@D|*@|, TA|0|0|8@H|8@|0}0@@@ LAA 8`N 8`N 8`N 8c8,|0@A@,|0@KAA8`N 8`N 8`N @strcmpA L| N A L| N A L| N A L| N A L| N b8 qA(||"+|*M |+|*0 @N p=@!k9J}i|exA ,8M 8B0|P8})P},P@4} P8})P},P@,|P8})P},PA})8})PyAH})@})PyA}Cx8tT@>@N @strcpyA L| N A L| N A L| N ĐA L| N ȐA L| N ̐A L| N АA L| N ԐA L| N b8qA||+A|+0@|0|8|4@|"+|*80@N 4A$||"+|*M |8|)N |N T`,/|fxA80AA,A`,AT,AH0}@Py=`01k@&}*X8}JX}@XK}JH}JXyA}L4U|`/T,/|M 00AHAA,,M B@$, &M B@D, FM B@x$D,,/ /M B@LM B@@&M B@4FM B@($D,,/ /K8N @strncatؐA L| N  A| KkN @_ptrglA L| N A L| N A L| N A L| N A L| N b8 qAH||+A|+0 @|0|8 ||"+|*8 0 @N pk=@!k9J}i8A,AP8B8} P8})P},P@} P8})P},PA})@})PyA}+4Uk|Xp!k}iA ,8M 8B耤0|P8})P},P@4} P8})P},P@,|P8})P},PA})(})PyAH})@})PyA}Cx8tT@>@N @xstrcatb8q8A||04@T|+|*@0|||(8|894@|*0K0||*N 0||+|*AN /T,/|M 00AHAA,,N@ A,N@ A$, %N@ A$,,//N@ ALN@ ALN@ AL%N@ AL$,,//KBN BN BN %BN @strncpyA L| N A L| N A L| N A L| N ĐA L| N ȐA L| N @(#)23 1.4 src/bos/usr/ccs/lib/libpthreads/init.c, libpth, bos520 8/19/99 12:20:14@(#)61 1.14 src/bos/usr/ccs/lib/libc/__threads_init.c, libcthrd, bos520 7/11/00 12:04:14 / /r@@/w -h-v-h-vr+%s %s /.k5loginpopk5logincsmKRB5.catCSMKRB5Principalkrb5_init_contextkrb5_get_default_realmAdding:%1$s to file %2$s. Adding:%1$s to file %2$s. /opt/csm/install/configinfo/opt/csm/install/configinfoUsage: popk5login [-h| -v] 2657-014 Could not open file = %1$s. 2657-014 Could not open file = %1$s. 2657-014 Could not open file = %1$s. 2657-028 The %1$s file does not exist. 2657-028 The %1$s file does not exist. 2657-001 This command invoked as : %1$s %2$s 2657-001 This command invoked as : %1$s %2$s 2657-005 %1$s exiting with return code = %2$d. 2657-002 Not valid argument : %1$s was entered. 2657-002 Not valid argument : %1$s was entered. There is no CSMKRB5Principal attribute in %1$s. Did not add:%1$s to file %2$s. It already exists. Did not add:%1$s to file %2$s. It already exists. @(#)49 1.10 src/csm/krb5/api/popk5login.c, setup, csm_rveg, rveg0414a 1/12/04 10:10:332657-030 Could not create CSM KRB5 principal in .k5login file. The name was not available from the %1$s file. ####################################################################### # Licensed Materials - Property of IBM # # # # 5765-E61 # # # # (C) COPYRIGHT International Business Machines Corp. 1996,2001 # # All Rights Reserved # # # # US Government Users Restricted Rights - Use, duplication or # # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # # ####################################################################### aar#r+ 't.log.bak%1$d QUIET[libs]libkrb5%15.15s libkrb5*hdb_kt_opslibkadm5clnt/var/log/csm//var/log/csm/krb5_kt_closekrb5_kt_closekrb5_kt_closekrb5_cc_closekrb5_kt_resolvekrb5_kt_resolvekrb5_parse_namekrb5_parse_namekrb5_cc_resolvekrb5_cc_resolvekrb5_cc_destroykrb5_cc_defaultkrb5_cc_defaultkrb5_kt_defaultkrb5_kt_defaultlibkrb5admclnt*krb5_svc_get_msgkrb5_svc_get_msgkrb5_free_stringkrb5_free_stringkrb5_kt_registerkrb5_svc_get_msgkrb5_svc_get_msgkadm5_get_policykrb5_init_contextkrb5_init_contextkrb5_kt_get_entrykrb5_kt_get_entrykrb5_free_contextkrb5_free_contextkrb5_kt_add_entrykrb5_kt_add_entrykrb5_kt_next_entrykrb5_cc_store_credkrb5_cc_store_credkrb5_cc_initializekrb5_kt_free_entrykrb5_kt_free_entrykrb5_kt_end_seq_getkrb5_free_principalkrb5_free_principalkadm5_get_principalkadm5_get_principalkrb5_cc_default_namekrb5_cc_default_namekrb5_kt_default_namekrb5_kt_default_namekrb5_kt_default_namekrb5_kt_start_seq_getkrb5_ktf_writable_opskadm5_free_policy_entkrb5_get_default_realmkrb5_get_default_realmkadm5_create_principalkadm5_create_principalkadm5_modify_principalkadm5_modify_principal/usr/krb5/lib/libkrb5.a/usr/krb5/lib/libkrb5.akrb5_sname_to_principalkrb5_sname_to_principalkrb5_free_cred_contentskrb5_free_cred_contentskadm5_randkey_principalkadm5_randkey_principalkrb5_build_principal_extkrb5_build_principal_extkrb5_kt_read_service_keykrb5_kt_read_service_keykadm5_init_with_passwordkadm5_init_with_passwordkadm5_free_principal_entkadm5_free_principal_ent/etc/opt/csm/csmkrb5.conf/etc/opt/csm/csmkrb5.conf/etc/opt/csm/csmkrb5.confkrb5_get_init_creds_keytabkrb5_get_in_tkt_with_keytabkrb5_get_in_tkt_with_keytabkrb5_free_keyblock_contentskrb5_free_keyblock_contentskrb5_get_init_creds_opt_init/usr/krb5/lib/libkadm5clnt.a/usr/krb5/lib/libkadm5clnt.a/usr/lib/libkrb5.a(libkrb5.a.so)/etc/opt/csm/csmkrb5.conf.default/etc/opt/csm/csmkrb5.conf.default/etc/opt/csm/csmkrb5.conf.default2657-014 Could not open file = %1$s. 2657-026 Call to %1$s returned: %2$i. 2657-024 Call to %1$s returned: %2$s 2657-013 Call to %1$s had error: %2$s krb5_get_init_creds_opt_set_default_flags/usr/lib/libkadm5clnt.a(libkadm5clnt.a.so)2657-004 Could not create backup log: %1$s 2657-007 Call to %1$s had error return: %2$i. 2657-007 Call to %1$s had error return: %2$i. 2657-007 Call to %1$s had error return: %2$d. 2657-011 Could not create the directory: %1$s 2657-009 Error on dlopen of library: %1$s errno=%2$d 2657-009 Error on dlopen of library: %1$s errno=%2$d 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. 2657-010 Could not establish address for %1$s in %2$s. @(#)48 1.11 src/csm/krb5/api/k5utils.c, setup, csm_rveg, rveg0414a 3/25/04 13:01:162657-036 The file %1$s line $2$s has syntax error. Full path to library is not provided. 2657-032 The %1$s and the %2$s configuration files do not exist. Cannot determine the path to the KRB5 api libraries. 2657-031 Could not find the %1$s shared library.For Linux, check path to library named configured in /etc/opt/csm/csmkrb5.conf.default. For AIX, check /usr/krb5/lib directory. If missing, install the KRB5 api library. 2657-031 Could not find the %1$s shared library.For Linux, check path to library named configured in /etc/opt/csm/csmkrb5.conf.default. For AIX, check /usr/krb5/lib directory. If missing, install the KRB5 api library. 2657-031 Could not find the %1$s shared library. For Linux, check path to library named configured in /etc/opt/csm/csmkrb5.conf.default. For AIX, check /usr/krb5/lib directory. If missing, install the KRB5 api library. 2657-031 Could not find the %1$s shared library. For Linux, check path to library named configured in /etc/opt/csm/csmkrb5.conf.default. For AIX, check /usr/krb5/lib directory. If missing, install the KRB5 api library. ####################################################################### # Licensed Materials - Property of IBM # # # # 5765-E61 # # # # (C) COPYRIGHT International Business Machines Corp. 1996,2001 # # All Rights Reserved # # # # US Government Users Restricted Rights - Use, duplication or # # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # # ####################################################################### ( / / / / 1t < H 1x 1| 1 1 1 P 1 5 7 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 : : : : : : : : : :$ :( :, :0 :4 :8 :< :@ :D :H >H,tb errno@mkdir@ rename@ @ umask@ @_iob@_Errno@ exit@ strlen@ fopen@ fprintf@ catopen@ catgets@ (@ 6@ printf@ fclose@ strncmp@ strrchr@ fputc@ fgets@ isspace@ getpid@ getpwuid@ fgetc@ stat@ fputs@ ctime@ time@ B@ setbuf@ N@ Z@ dlopen@ dlsym@ ctermid@ feof@ f@ __crt0v@s@@@ __start /! < @   / / / / / / / / /* /, /- / /+ / / /) / / /! 0 0 0 0  0 0 0 0' 0  0$  0(" 0, 00 04 08# 0< 0@$ 0D 0H 0L 0P 0T 0X 0\ 0` 0d 0h 0l( 0p 0t  0x 0| 0 0 0  0 0% 0  0& 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1  1 1 1 1 1  1$ 1( 1, 10 14 18 1< 1@ 1D 1H 1L 1P 1T 1X 1\ 1`  1d 1h 1l 1p /usr/lib:/lib:/usr/ibmcxx/liblibc_r.ashr.olibpthread.ashr_comm.olibpthread.ashr_xpg5.o sigprocmask_system_configuration sigemptyset sigaddset setlocale tcgetattr tcsetattr __mod_init__malloc_user_defined_name__pthread_trace pthread_init*X>4B6JZ`DnfpjZ8:܏ Jb:L^NPRd \mZ`b^hl"rt'xz|(l,16 ;$ ,,16$<N$T;l$ @0:rL,`1j|z ,1ԏ .8 PEr,1JO4OPTdY^J 6  4 D T d |     r , 1 "| 4c D T l |  h Y Y @ E  r , ,1 \J xO T T J r E  r 0, D1 zr 1 1  , 1  , 1 $ D1 T1 ` x, 1  , 1 6    blr ,*t<1H`,t1~ ,1r , 1 2|<T,^tp1np vLǙV\E|(8BL|6.2HV`t@E@Er$,81lJOOY^(@^t^^@T(DT\TTJr,1D^rp,1r,1r,1 r,1, 1@,X1 r,1 ,81X,p11r,z 1r@r,1BrT,h1™r,1™&r8,P1p™zr,1™ďr ,81X™bƏjȏʏ™̏™Ώ™Џr,,1L™Vҏnr,1   ,@ > D X rr ,  1 r , 1! ™!*ԏ!Br!T,!l1!™!֏!r!,!1"™"؏" ™"*ڏ"8™"B܏"P™"Zޏ"h™"r"™"™"™"™""r",#1#0™#:#Rr#d,#|1#™##r#,#1$™$"$:r$L,$d1$™$$r$,$1%™% %™%"%0™%:%H™%\™%f%~r%,%1%™%%r&,&1&D™&N&\™&f&t™&~&™&&™&&r&,&1'™'"':r'L,'d1'™''r','1(™( ("r(4,(L1(t™(~(r(,(1(™() r),)41)\™)f )~r),)1)™) )r*,*1*D™*N*fr*x,*1*™**r*,+1+,™+6+Nr+`,+x1+™++r+,+1,™,,.ʏ,@™,J,br,t,,1,--$-0Y---@-Y..r.vr.,.1.h./// /0/@/P/`/p/@/w/E/r0 ,0 108E0~0011*1R1z11223"3J3r334445"5J5r556688D 8v88899@9B::<<<="=:&=b( <4 @H `  /, /V / /V /D /V / /< /R / / / /T /F /2 /P / /` /@ 0 0b 0d 0 2 0f 0h 0j 0L 0  0$ 0(B 0,  00" 04  08D 0< 0@F 0D: 0H 0L6 0P, 0T& 0Xz 0\x 0`8 0d 0h 0lN 0p. 0t 0x* 0|0 0( 0 0> 0< 0H 0 0J 0 0 0 0 0 0~ 0| 0 0 0 0 0p 0 0 0 0 0 0 0r 0 0 0 0 0 0 1 1 1 1  1 1 1 1 1  1$v 1( 1,t 10 14 18 1< 1@ 1D 1H 1L 1P 1T  1X 1\l 1` 1d$ 1hn 1l4 1p errnomkdir rename ! umask -_iob_Errno exit strlen fopen fprintf catopen catgets C O printf fclose strncmp strrchr fputc fgets isspace getpid getpwuid fgetc stat fputs ctime time Y setbuf c m dlopen dlsym ctermid feof w __crt0vTOC /k /k__crt0v /k /k /k_$STATIC /k /k_$STATIC /k /kw /kerrno /k_$STATIC /kY /kcatopen 0kcatfd 0kprogname 0kgetpid 0 k 0kpid 0kverbose 0kctermid 0k_$STATIC 0 kfopen 0$ksetbuf 0(kC 0,kO 00k! 04kc 08k- 0<km 0@kfputs 0Dk 0Hkfgetc 0Lkfputc 0Pkfclose 0Tk 0Xk 0\kstat 0`kcatgets 0dkfprintf 0hkfeof 0lkfgets 0pkstrlen 0tkstrrchr 0xkisspace 0|kstrncmp 0k 0ktime 0kctime 0kdlopen 0k_Errno 0kdlsym 0k 0k 0k4 0kJ 0ke 0kpolicy 0kr 0k~ 0k 0k 0k 0k 0k 0k 0k 0k1 0kE 0k[ 0kk 0k 0k 0k 0k 0k 0k 0k 1k 1k. 1kE 1 kZ 1kw 1k 1k 1k 1 k 1$k 1(k 1,k/ 10kJ 14k\ 18ks 1<k 1@k 1Dk 1Hk 1Lkmkdir 1Pkumask 1Tkrename 1Xk 1\k_iob 1`kprintf 1dk 1hkgetpwuid 1lkexit 1pk +g> g.__start(k.__start(,__start / <k p_xargc /p_xargv /p_xrcfg /p_xrc / 1t.fileTgMgk B_$STATIC kZ /   / / / / /.fileg :gk .main XT XcX X_$STATIC Hkcatfd 1xprogname 1| 1pid 1verbose 1 :H >H 9k 9 :$ : 7 5r 9policy 9 9 9~ 9J 9 94 9 9 9e 9 :D :@ :< :w : Z :E :. : :8/ :( 9 :  : : 9 9 9 9 9 9 9 9\ :0s :4J :,[ 91 9 9E 9 9 9.filegngkX _$STATIC kU /   /.filegg0kX40 >  R| ^ k x`  , . _$STATIC Pk7 1kstrcat.s g.strcat9@)strcpy.s g.strcpy3)strcmp.s g.strcmp10) g.strncat6) g.strncpy:)ptrgl.s g._ptrgl8Dk0._ptrgl8D .$PTRGL8D glink.s gk(glink.s g.exit=`k(.exit=`glink.s gk(glink.s$ g.catopenk(.catopen glink.s) g.getpidk(.getpid%glink.s. g.catgets4k(.catgets4*glink.s3 g.fprintf4k(.fprintf4/glink.s8 g.fclose3pk(.fclose3p4glink.s= g.printf=k(.printf=9glink.sB g.stat4k(.stat4>glink.sG g.fopen0k(.fopen0Cglink.sL g.feof5 k(.feof5 Hglink.sQ g.fgets5Hk(.fgets5HMglink.sV g.strncmp8k(.strncmp8Rglink.s[ g.strlen5pk(.strlen5pWglink.s` g.isspace5k(.isspace5\glink.se g=8k(=8aglink.sj g.umask<k(.umask<fglink.so g`k(`kglink.st g.mkdir<k(.mkdir<pglink.sy g.rename<k(.rename<uglink.s~ g1Pk(1Pzglink.s g._Errno8k(._Errno8glink.s g1k(1glink.s g1(k(1(glink.s g.strrchr5k(.strrchr5glink.s g.fputc3Hk(.fputc3Hglink.s g.fgetc3 k(.fgetc3 glink.s g.fputs2k(.fputs2glink.s g.ctime8k(.ctime8glink.s g.time8tk(.time8tglink.s g.setbuf0k(.setbuf0glink.s g1xk(1xglink.s g%2k(%2glink.s g.dlopen8k(.dlopen8glink.s g.dlsym9k(.dlsym9glink.s g.ctermid0k(.ctermid00__pthread_tracepthread_initsigprocmask_system_configurationsigemptysetsigaddsetsetlocaletcgetattrtcsetattr__mod_init__malloc_user_defined_name__C_runtime_pstartupcrt0_datalogfileptr_$STATIC_BSSkrb5libnamekrb5admlibnamekrb5_svc_get_msg_pkadm5_create_principal_pkadm5_modify_principal_pkadm5_get_principal_pkadm5_init_with_password_phdb_kt_ops_pwritableopskadm5_get_policy_pkadm5_free_policy_ent_pkadm5_free_principal_ent_pkadm5_randkey_principal_pkrb5_init_context_pkrb5_kt_resolve_pkrb5_kt_start_seq_get_pkrb5_kt_next_entry_pkrb5_kt_get_entry_pkrb5_kt_end_seq_get_pkrb5_kt_close_pkrb5_get_default_realm_pkrb5_parse_name_pkrb5_sname_to_principal_pkrb5_build_principal_ext_pkrb5_cc_resolve_pkrb5_cc_close_pkrb5_cc_destroy_pkrb5_cc_store_cred_pkrb5_free_cred_contents_pkrb5_cc_default_name_pkrb5_cc_initialize_pkrb5_get_init_creds_keytab_pkrb5_get_init_creds_opt_init_pkrb5_get_init_creds_opt_set_default_flags_pkrb5_get_in_tkt_with_keytab_pkrb5_free_principal_pkrb5_free_context_pkrb5_cc_default_pkrb5_free_string_pkrb5_kt_read_service_key_pkrb5_kt_default_pkrb5_kt_default_name_pkrb5_kt_register_pkrb5_kt_add_entry_pkrb5_kt_free_entry_pkrb5_free_keyblock_contents_pkrb5_ktf_writable_ops_pprincipalname1principalname2crt0main.s../../../../../../../src/bos/usr/ccs/lib/libc/__threads_init.cSun Sep 15 15:10:49 2002 C for AIX Compiler Version 5.0.1.0 --- .__threads_init_malloc_user_defined_name_bsd_init_routine_xti_tli_init_routine_nsl_init_routine__dce_compat_init_routine../../../../../src/csm/krb5/api/popk5login.cMon Apr 5 20:39:50 2004 .UpdateK5login.ParseArgs../../../../../../../../src/bos/usr/ccs/lib/libpthreads/init.cSun Sep 15 16:25:03 2002 .call_pthread_init_pthread_init_routine../../../../../src/csm/krb5/api/k5utils.cMon Apr 5 20:04:16 2004 .get_info.find_linux_libkrb5.LogInfoMsg.LogErrorMsg.LogDateTime.secLoadKRB5AdminLib.secLoadKRB5Lib.checkpath.SetupLogstrncat.sstrncpy.s.__mod_init.setlocale.getpwuid.pthread_init.sigprocmask.sigemptyset.sigaddset.tcgetattr.tcsetattr k:0PBm7u(Fq@Fq@Fq@ (./opt/csm/csmbin/rmnode_clientrm#!/usr/bin/perl # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # # # @(#)74 1.14 src/csm/install/rmnode_client.perl, setup, csm_rveg, rveg0414a 3/29/04 09:18:18 #-------------------------------------------------------------------------------- =head1 rmnode.client Description: This command runs of the node throucg dsh AIX: Remove the logs on the node. Linux: Removes the logs, csm, rsct file sets and /var/opt/csm/CFMlocal file from the node Return 0 or 1. Development notes: The html view of the pod headers in this file can be updated by running the command: tidypod The html veiw of the pod headers will be in the file ./.html and can be viewed with a browser. The tidy formatted file will be in .tdy Be sure to run tidypod and copy the tdy file to before checking in changes. =cut #-------------------------------------------------------------------------------- BEGIN # load first at runtime { use lib '/opt/csm/pm'; use strict; use locale; $::MSGCAT = 'csmInstall.cat'; $::MSGSET = 'csminstall'; $::MSGMAPPATH = '/opt/csm/msgmaps'; } use Getopt::Std; use NodeUtils; use CSMDefs; use InstallUtils; #-------------------------------------------------------------------------------- =head3 initialize Initialize the global data Notes: =cut #-------------------------------------------------------------------------------- sub initialize { # setup the global defs data InstallUtils->get_OSDefs(); $::ostype = InstallUtils->get_OSName; #AIX/Linux $::osdistr = InstallUtils->get_DistributionName; #RedHat $::osversion = InstallUtils->get_DistributionVersion; #5.1.0/7.1/7.2 $::arch = InstallUtils->get_PkgArchitecture; #i.86 if ($::arch =~ /i.86/) { $::arch = "i386"; } $::csmvers = InstallUtils->get_CSMVersion("csm.core"); @::csm_logfilelist; # csm file, log list thate need to removed @::csm_rpmlist; # Linux CSM RPM list to uninstall @::rsct_rpmlist; # Linux RSCT RPM list to uninstall $::GLOBAL_EXIT = 0; $::logging = 0; $::temp_remove_item; $::rsct_basic_Flg = 0; } #-------------------------------------------------------------------------------- =head3 getArgs Notes: =cut #-------------------------------------------------------------------------------- sub getArgs { if (!getopts('vVh')) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgrmnodeClientNodeUsage'); exit 1; } if ($::opt_h) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgrmnodeClientNodeUsage'); exit 0; } if ($::opt_v || $::opt_V) { if ($::opt_v) { $::VERBOSE = $::opt_v; } if ($::opt_V) { $::VERBOSE = $::opt_V; } } } #-------------------------------------------------------------------------------- =head3 get_install_lists Get the lists of files that we need to remove. Notes: =cut #-------------------------------------------------------------------------------- sub get_install_lists { if ($::PLTFRM eq "AIX") { # AIX lists of filesets to install # make sure we have the info we need if (($::ostype eq "") || ($::osversion eq "") || ($::csmvers eq "")) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgNoConfigInfo', $::CSM_NODENAME ); return $::NOK; } # get the appropriate lists of filesets/packages my %pkgdefs = InstallUtils->get_pkgdefs($::ostype, $::osdistr, $::osversion, $::arch, "MgdNode", $::csmvers); # log file list that need to uninstalled @::csm_logfilelist = @{$pkgdefs{logfiles}}; } else { # Linux lists of filesets to install # make sure we have the info we need if ( ($::ostype eq "") || ($::osdistr eq "") || ($::osversion eq "") || ($::csmvers eq "")) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgNoConfigInfo', $::CSM_NODENAME ); return $::NOK; } # get the appropriate lists of filesets/packages my %pkgdefs = InstallUtils->get_pkgdefs($::ostype, $::osdistr, $::osversion, $::arch, "MgdNode", $::csmvers); # CSM RPMs for Linux that need to Uninstalled @::csm_rpmlist = @{$pkgdefs{csm_unpackages}}; @::csm_rpmlist = reverse @::csm_rpmlist; # rsct rpms that need to uninstalled @::rsct_rpmlist = @{$pkgdefs{rsct_unpackages}}; @::rsct_rpmlist = reverse @::rsct_rpmlist; # check if the node is management server to it self. # if yes, than remove only client if (NodeUtils->isMgmtSvr()) { @::csm_rpmlist = ("csm.client"); @::rsct_rpmlist = (); } # if the rsct.basic is installed than don't remove rsct NodeUtils->runcmd("$::RPMCMD -q rsct.basic", -1); if ($::RUNCMD_RC == 0) { @::rsct_rpmlist = (); $::rsct_basic_Flg = 1; } # log file list that need to uninstalled @::csm_logfilelist = @{$pkgdefs{logfiles}}; } return $::OK; } #-------------------------------------------------------------------------------- =head3 remove_files_dir Remove the directries and files passes. Notes: =cut #-------------------------------------------------------------------------------- sub remove_files_dir { my ($file_name, undef) = @_; NodeUtils->runcmd("$::RM -rf $file_name", -1); if ($::RUNCMD_RC != 0) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'W', 'EMsgCannotDelete', $file_name); } return $::RUNCMD_RC; } #-------------------------------------------------------------------------------- =head3 remove_rpm Remove the rpm from the system Notes: =cut #-------------------------------------------------------------------------------- sub remove_rpm { my ($rpm_name, undef) = @_; NodeUtils->runcmd("$::RPMCMD -e $rpm_name", -1); if ($::RUNCMD_RC != 0) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'W', 'EMsgRemoveRpm', $rpm_name); } return $::RUNCMD_RC; } #-------------------------------------------------------------------------------- =head3 remove_installp Remove the installp immage from the system Notes: =cut #-------------------------------------------------------------------------------- sub remove_installp { my ($installp_img, undef) = @_; NodeUtils->runcmd("$::INSTALLP -u $installp_img", -1); if ($::RUNCMD_RC != 0) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'W', 'EMsgRemoveInstallpImg', $installp_img ); } return $::RUNCMD_RC; } #-------------------------------------------------------------------------------- =head3 Main Notes: =cut #-------------------------------------------------------------------------------- { # main my $ret_code = 0; # initialize the global data &initialize; # get/check command line args &getArgs; # Get the lists of filesets and file that must be uninstalled or removed if (&get_install_lists != 0) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgNO_LIST'); $::GLOBAL_EXIT = 1; exit; } # Uninstalling and removing the files from the node if ($::PLTFRM eq "AIX") { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgUninstallingCsm'); # Remove the log and otherfiles foreach $::temp_remove_item (@::csm_logfilelist) { $ret_code = &remove_files_dir($::temp_remove_item); } } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgUninstallingCsm'); # Remove the Linux Cluster Support extensions, if present # Do not remove if node is management server for itself unless ( (($::osdistr =~ /RedHatEL-AS/) && ($::arch =~ /ppc64/)) || NodeUtils->isMgmtSvr()) { NodeUtils->runcmd("$::RMLCSEXT -A", 0); } # Remove the csm rpms foreach $::temp_remove_item (@::csm_rpmlist) { $ret_code = &remove_rpm($::temp_remove_item); } # Remove the rsct rpms foreach $::temp_remove_item (@::rsct_rpmlist) { $ret_code = &remove_rpm($::temp_remove_item); } # Remove the log and otherfiles foreach $::temp_remove_item (@::csm_logfilelist) { $ret_code = &remove_files_dir($::temp_remove_item); } } if ($::rsct_basic_Flg == 1) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgDidnotUninstallRsct'); } exit $ret_code; } --- kq0PB7u&Oq@q@q@ &O./opt/csm/csmbin/rmstanzaientr@qH n ( * 1L.text(((x .data * *n*ܺ@.bss   .loader"(|nx|#x|+x|1Bh9 e)-*@H `HH!A|nxAA| QN!A9}sx}{x~xH` ,Ab$H A| @__start|b,0!;8 `?\XHՀA8`PHA8;@DH@D8`PHAH,@dH A, @4@H AD8D`PHA@HH H,@8`cHAH,A@D8`PKtL@H8LdTTd6@|!n8@P8TH TLP<8 T|).|*8 PHUTPX<@,@ЀP *}|(.Tg8|:}e8.| @AD, AH9A}8c}Tf8|2}e0.| @@̃<T;| <@,P *}|(.Tg8|:}e8.KH(H8`cHA8`HA0T8d XH̀AT|@P H`@H!A!}N (!X0 X|!֐|Hd 8,A4`f|c"8| .,A`f|c"8| .,K`N H|```}!b\;:b.,Ad,A8x c$HyA8aPc$H,`|{x|8Tc:>.,A,K,A,,AdA0bcd8cHH AC8aP8H `H\b8cHAC8aP8H`8`H0b8cHAC8aP8H`8`8!}N (A@main|!8HH]`H8!@}N A(__dftdt__7ACLFileFvA L| N A L| N |,!````A8H`H 8,A,8c8H`X8!P}H8X8!P}N AQinit__11StanzaEntryFPCcQ2_7ACLFile14PermissionTypeQ2_7ACLFile15PermissionLevelPCc|,`!8c A(8H`888Hu`H,88H`888HI`88`cH8!@}N A__ct__7ACLFileFPc|`!aDbHAsAaDHAaDX8!P}N AP__dt__7ACLFileFv|8; !8a,8P8dcHA8a,HɀA8@cHA8`8~dH̀A|`y@a\|A8`H8!@}N 8`H8!@}N A_copyDefaultFile__7ACLFileFv|`8c !@8@H-A,@,\,A8`8!}N ADKAA,A0K-AcHA8`8!}N cK,@(8 HA8`8!}N 8`8!}N A_fileExists__7ACLFileFv|!`~K,,A(@88~ 8hHuAH$8H8~ 8hHQA~,@8`H8!@}N 88HEA8~888 8H9A8~8lHA~|`y@0~H)A88`H8!@}N 8`H8!@}N H8!@}N A,_openFiles__7ACLFileFv`|c;!,;AHA`~,AHiA|~xcX8!P}N Al_closeFiles__7ACLFileFv|`}&;!;bH Ab888cHA`|,@DK=AcH AbHA8`tx8!p|} N 88`a@| DBHc88@HA`}KɀAcH~A,AXKA, AKA, @L8`HŀA;.@c88@KK @8`tx8!p|} N C`_aquireFileLocks__7ACLFileFv|8!`8a@8H|`8@8,BDHAX88@H~ŀA`~HA8bH~yA8|4T~h8!`}H8bH~MAh8!`8`}N h8!`}N A_releaseFileLocks__7ACLFileFv|`! ,@8a88 8H|!A88@\8 H|YA,A0KAcH|eA8`8!}N \,A(8aH|]A8 8H}݀A,@8cH}A,A0KAcH{A8`8!}N 88@\8H{A,@<\,@8`8!}N 8 8H}A,@|8`8!}N Ax_SwapFiles__7ACLFileFv|`!88c H}9A,A8`H8!@}N pA8`H8!@}N K݀AcHzA8`H8!@}N A_readLine__7ACLFileFv|!0`}`K!,@,A,AcHA,A0c8@H,@c8@KY`,AȀc88 H,@cK,A}p@|HL,Alc88 H,@XcKY,AЀ}p@0K뉀AcHyYA8`8!л}N 8`K8`K8`K A@%_copy_till_stanza_found__7ACLFileFPCc|!c HH{-A0|`H8!@}N A0_lineIsStanzaHeader__7ACLFileFv|!`H8c 8HzA80`|cH8!@}N A@_first_token__7ACLFileFPc|;!8axH!;A||L@8aA|8c B8a@8H8HzAA`~,@8`h8!`}N (@8`h8!`}N aL88@HzA`aLHz)A|@8`h8!`}N A"_printToFile__7ACLFileCFP4FILEPCce|`~d`!H݀`g`HQ`hc`8cKy,A8`X8!P}N 4Ac8KA,Hc8K-,@8`X8!P}N A'_print_entry__7ACLFileCFPC11StanzaEntry,,/AAA8ddN 8dXN 8d\N 8d`N @<1get_permission_type__FQ2_7ACLFile14PermissionType,,//bAAAA8cdN 8chN 8clN 8cpN @D3get_permission_level__FQ2_7ACLFile15PermissionLevel|a,!p`T>at;@;`@a@cd| D;DH@| D;DALatK|{x@LeD}@H| AatK,@,A8aP8888Ke8a`8888$KMatc88H,@at8PK`{atc88Hi,@at8`K|{xcc8!a}N A\__print_all_entries__7ACLFileFRQ2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__bc,@8N N @$Ibegin__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FvN @ Gend__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__Fvc||4T~hN @__ne__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorCFRCQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorc8cN @ R__ml__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorCFvN @ Q__pp__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorFi|,!pT>`A8@,@xD@;X|` XAHx,@HaHaxaPaTxHoA88`HD@;X|` XA\a8HryA,a@Ala\a`X@| Aa8K8`8!}N A8\_entry_exists__7ACLFileFRQ2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__PcbN @ __as__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorFRCQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iterator|!@p8p`~`a@aDHlـA~p8X8!P}N A|erase__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorN @_Next__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__4_AccFPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Nodec 8|4T~N @_lineIsComment__7ACLFileFv|}&! ``K],@.,A`cK,@PcKi,AHc88 K-,A|8`8!|} N 8`HhAPc8@K},@ c8@8K,@ c88 K,@cK,A88`8!|} N C$d_copy_stanza_to_outfile__7ACLFileFRQ2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__i8HL @1AddOrUpdateEntries__7ACLFileFPCcCPC11StanzaEntryi|`;}&b!84```ԓГܓcK,Ah8!`a}8`N cK,A$cK]h8!`a}8`N c4K`z;8` HlAAaD`d,A ;!H;!D8`Hl=A,A aD,8A ;!H;!D8`HlA,A D,8`aӐc@D;;ēH8a8HH-;9|@;ēH8a8HK,,AA$cKcK%Ӏ,@(P|c;;AH(P|c;;A;aXaa`adHfŀAa|\8A(aXaa`adKĐaT`HfiAh8!`}8`N ,@䃢c48K,A$cKcKݛӀ,@(h|c;;AH(h|c;;A;aXaa`adHe}Aa|\8A(aXaa`adKĐal`He!Ah8!`}8`N ;8a8888K;a 8a 8888$Kᓁp8p8aHEax8x8aH1c88Ku,A,cKcKEӀ,@(|c;;AH(|c;;A;aXaa`adHcAa|\8A(aXaa`adKĐa`HcAh8!`}8`N .A48 c8K,AcKcKӀ,@(|c;;AH(|c;;A;aXaa`adHbAa|\8A(aXaa`adKĐa`HbAA8`H,@,c88K,AcKcK͛Ӏ,@(|c;;AH(|c;;A;aXaa`adHamAa|\8A(aXaa`adKĐa`HaA8`H@c88K,Hc88K,@cKacK㉛Ӏ,@(|c;;AH(|c;;A;aXaa`adH`)Aa|\8A(aXaa`adKĐa`H_̀A8`Ht,@X8 c8K5,AcK)cKQӀ,@(|c;;AH(|c;;A;aXaa`adH^Aa|\8A(aXaa`adKĐa`H^A8`H,H,@DAȓxBx88|HS.aA@H||@@4T~|d|@@ d|@A |"Hb8apH>],AHatxCx88|HS.aH4xt/A@,A4,A,,@8e@K8apbH=,H,@$A8e,A,@K|(A |@@dAH8e,A ,@(HNAtx|8apbH=aH$8tx|8apbH==,A(atbbK`atxDx88|HS.aAat,@$8,@ cH`d,@L@(b8,@ cHa|8Hx8|@@8aHR-A,Ah,A\,AT@<8e@HMEAH8H8abH;,H@$A8e,A,@K(A |@@dAH8e,A ,@(HLA8abH;aH$88abH;=,ALt,@ b8,@ cabK`aI8h8 8a8HQ`St,AX8e,A ,@8HKՀAtx|~888`HOAH48tx|~888`HOA,A _z|8!C} N (C  <P_Insert__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorRCP11StanzaEntry|a!;`;|(A`{;X@a@aXaHaLHJAX{D8c{|(A0@a@aXaHaLKx8!pa}N Aerase__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorT1|!`HHHՀAH8!@}N A(_Freenode__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node|!8`dH8hlK­AH8!@}N A<dump__11StanzaEntryCFvN @_Destroy__3stdHPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_PPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_vN @/_Destroy__3stdHP11StanzaEntry_PP11StanzaEntry_v|``d!8`HJA,A H8!@}N AHO_Construct__3stdHP11StanzaEntryP11StanzaEntry_PP11StanzaEntryRCP11StanzaEntry_v|``d!8`HIՀA,A H8!@}N AHG_Construct__3stdHPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_NodePQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_PPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_NodeRCPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_v|!c HHHAH8!@}N A(_Allocate__3stdHQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_UlPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_PQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node|!d HHFـAH8!@}N A(allocate__Q2_3std9allocatorXTQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_Hv_UlPCv_PQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_NodeN @__ct__Q2_3std9allocatorXTQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_GP11StanzaEntry_RCQ2_3std9allocatorXTP11StanzaEntry_N @__ct__Q2_3std9allocatorXTPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_GP11StanzaEntry_RCQ2_3std9allocatorXTP11StanzaEntry_N @Q__pp__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorFv`|,!AP8e,A ,@0H?A8 H8!@}N 88 H8!@}N AS__dftdt__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fv88H 8 @ __dftdt__Q2_3std12length_errorFv<`@8cN @ Mmax_size__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__CFv;|`~ !``HBрA`{,A|@A|| @@48|@;@cHBA/AH;|@@cHBA|||@@cc||@;@c@cHBuA|{|@@`z,A/A@e,A$,A8`|@`@cHAA|@@>/A8e,Ap,Ah,@H@$H!A|@@/Al8e,A\,AT,@8@H9)A H8 HccH',Hp,@(Ax8!pc}N  |@@4T~|d|@@ d|@A |"HccH'Q,A8~x8!pc}N /A@8e,A0,A(,@ @KccdH&,H,@$A8e,A,@K (A |@@dAH8e,A ,@(H7A ccdH&aH$8 ccdH&=,A$~cceK`~~x8!pc}N ALR__ct__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FPCc!|;;`b}&| @8c8H !$`;@@;y; 8AcH;)A|{|@@`y,A /A(e,A ,A8`|@`@cH:A|@@_ /Ah8e,AX,AP,@@$H5A 8H8 8Hh,@ AlA /HD|@@8T~|d|@@ d|@A@"ccDH#逿 /A8 |{||e||K`8`Y|@@cH9uA|@@_ /Ap8e,A`,AX,;`@8@H4yA H8 HccDH#,H,@8At8hx8!pc|} !N |@@HT~||@@$ | @;`A|cH"H;`cDcH"H;`,A _t8hx8!pc|} !H.A{;@,@ b8,@ Cc,@\{,@(b8,@ C cH  8HL;@8|@@cH7qA ,A<8e,A,,A$@ @,Kcc$H!M,H@$A8e,A,@K؀(A |@@dAH8e,A ,@(H2A cc$H H$8 cc$H ,AH,@ b8,@ Cc c%KI` ?t8hx8!pc|} !N C\f__ct__Q2_3std12length_errorFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__|`p!A\,AP8e,A ,@0H0A8 H8!@}N 88 H8!@}N AQ_Tidy__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fb|`}&c,!L`A| @A|c|@@88|@;;@cH49A/AH;; |@@cH4)A|x|@@c~|@;`@cH3A|||@@`{,Ac/A(e,A ,A8`|@`@cH3qA|@@?/Ah8e,AX,AP,@@$H.yAO 8H8O 8Hh,@ Al@/HD |@@8T~|d|@@ d|@A "cCc$H/A8||||e||KU`8`|@@cH2=A|@@/Al8e,A\,AT,@8@H-EA H8 HccH,Hl,@$A|A|@@tHl |@@4T~|d|@@ d|@A |"HccHq,ABH|@@`,Axc/A(e,A ,A8`|@`@cH0݀A|@@/Ah8e,AX,AP,@@$H+AO 8H8O 8Hh,@ Al@/HD |@@8T~|d|@@ d|@A`"ccdH/A8|`|K`8`|@@cH/A|@@/Al8e,A\,AT,@8@H*A H8 HccHQ,Hx,@0A|tx8!pc|} N  |@@4T~|d|@@ d|@A |"HccH,Atx8!pc|} N /Al8e,A\,AT,@8@H)A H8 HccH5,H,@$A8e,A,@K (A |@@dAH8e,A ,@(H)A ccHH$8 ccH,A$LcKQ`x8!pc}N ClVassign__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FPCcUl|A}&!`|(@`~``@H,A|@@c|@@;|@@cH,yA||@@`},;`A/A(e,A ,A8`|@`@cH+A|@@/Ah8e,AX,AP,@@$H&A~~~ 8H8~~~ 8Hh,@ Al~a@e/HD |@@8T~|d|@@ d|@A"ccH5/A8|||*||K`8`|@@cH*A|@@/Ap8e,A`,AX,;@8@H%ŀA~~~ H8~~~ HccH],H,@$A~aAe|@@H |@@DT~c||@@ |(@;A|"HH;cHH;,A~aB}H|@@`,A/A@e,A$,A8`|@`@cH)MA|@@/A8e,Ap,Ah,@H@$H$UA~~~ 8H8~~~ 8HccH݀/Hh,@ Al~a@e/HD |@@8T~c||@@ | @A*cHu/A8|*`|K!`8`|@@cH( A|@@/Ap8e,A`,AX,;@8@H# A~~~ H88~~~ H ccH,H,@0A~edh8!`c|} AN  |@@HT~||@@$ | @;A|cH1H;ccHH;,A|~}dh8!`c|} AN .A|@@;;`,@ 8b,@ c,@,AH8e,A ,@(H!A~~~ ,@DH$8~~~ ,@ 8b,@ c ~ 8H\;;`8|@@cH%A~,A<8e,A,,A$@ @KccH,H@$A8e,A,@K (A |@@dAH8e,A ,@(H ]A~~~ ccHH$8~~~ ccH,AT,@(8b,@ c|H|~cK}`~}dh8!`c|} AN Cpassign__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__UlT2|`8`8h`8!8Da@HLC8c8HsAcHAch8!`}N (A@__dt__Q2_3std12length_errorFv|a!`| @``@H"݀A||@@`,A;`/A@,A(,A 8`||@@cH"UA|@@/A8e,Ap,Ah,@H@$H]A 8H8 8HccH 倿/Hh,@ Aha@e/HD |@@8T~c||@@ | @A*cH }/A 8||}|(|(|"K!`8|@@cH! A|@@/Ap8e,A`,AX,;@8@H A H8 HccH ,H,@(Aech8!`a}N  |@@HT~||@@$ | @;A|cH 9H;ccH %H;,A}ch8!`a}N ATerase__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FUlT18b,L 88N @(T_Nullstr__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fv|8|@!``}T>@ HA,A8}/AH |@@}/A,A,A|,@`,A@8e,A ,@ HuA8`}}} Hx88`}}} H\ccH8`HH,@|A`,A@8e,A ,@ HA8 H088 HA88`HȀ A(A |@@,AL8e,A ,@,HmA8c cHH`88c cHH8|@@0T~|d|@@ d|@A"ccH8`X8!P}N APS_Grow__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FUlb,A| @Ac||@@ 8`N 8`N @4U_Inside__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FPCc88H< @ __dftbdt__Q2_3std11logic_errorFv| `8;88~H,8!@`HDLCAP8e,A ,@0HAs8~( CA__eq__3stdHcc_RCQ2_3std9allocatorXTc_RCQ2_3std9allocatorXTc__b8(N @__dftbdt__Q2_3std9exceptionFv|`p!8(A H݀AcH8!@}N AH__dt__Q2_3std9exceptionFv`|c!,AT,A(,A 8|@@cHA|@@/A8e,Ap,Ah,@H@$HA8`| H88`| HccH,Hl,@$AX8,ATHH |@@0T~|d|@@ d|@A"ccH,A 8H8!@}N <8!@N A|S_Freeze__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fv8`N @Umax_size__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__CFvA|;`!8|@8`?`zaHLaPT@`88~KHAK`};,A\HD8`H-A_8~HA`}8`KA;,AcK``,A\8d,A ,@, @8pA08 T?@ TA8p Ad|`8|@@8T>| @88d,@8c@(@8c|T:HT:HW:||.}"| .,@d|A|d|@|@A@h@H@o|@< ,@|.s,`T>@HtpAHo ,A<:8aH8D8@bc9PHHp||.|*A|(.s,`T>@bcH`H ,A bcH`,@$H,A A@ TA] [-v] [-h] name of stanzas to remove -f ACL file location instead of default location %s -v verbose output -h display this message Return values: 0 - success (stanzas are now not present in file) 1 - no such ACL file 2 - unable to acquire lock on ACL file 3 - other error occured 666 - bad arguments /var/ct/cfg/ctrmc.aclsIhvf:IBMhvf:IBMremoving stanza "%s" from ACL file %s IUnexpected return value from ACLFile::DeleteStanza() of %d File "%s" not valid IBMsuccess! Original file has been backed up to %s.orig @(#)32 1.11.1.8 src/csm/common/ACLFile.C, dms, csm_rveg, rveg0414a 8/5/03 09:17:53CR*rwrwQ2_3std12length_error:0,Q2_3std11logic_error:0,Q2_3std9exception:0logic errorstd::exceptionQ2_3std9exceptionstd::length_errorQ2_3std12length_errorstd::logic_errorQ2_3std11logic_errorQ2_3std11logic_error:0,Q2_3std9exception:0I[%s][%d][%d][%s] IB/var/ct/lck/ctrmc.acls.lock%s.orig%sI %30s %s %-2sIB # %s I IBroot@LOCALHOSTIroot on this node always has accessLOCALHOSTIBevery one else on this node can read onlyIB/bin/cp %s %s 2>&1I/usr/sbin/rsct/cfg/ctrmc.aclsIB%s.%sIBnew_fileIBM%s /var/ct/cfg/ctrmc.acls Ծޭ ޭ @(#)23 1.4 src/bos/usr/ccs/lib/libpthreads/init.c, libpth, bos520 8/19/99 12:20:14@(#)61 1.14 src/bos/usr/ccs/lib/libc/__threads_init.c, libcthrd, bos520 7/11/00 12:04:14  ޭP (  0 4,<| @Pd 4|Z|ZPDޭ L hޭp Xޭ dޭ p   |            ޭ  Xޭ  ޭ ޭ  (     <    Y|  ?, X  0  T  $   y 8 \ P l     ,  0 x  X   4 @ D Hh h     H @__quous3@@@errno@close@ link@ @ open@ rename@ unlink@ '@malloc@ free@ _Errno@ exit@ atexit@ strlen@ fopen@ ?@ fprintf@ printf@ fclose@ fflush@ M@ snprintf@ fgets@ sscanf@ fseek@ stat@ system@ isalpha@ memcmp@ getopt@ strerror@ Y@ e@ __crt0v@optind@optarg@r@@ @ @ @ @ @ @ @ @ (@ 6@ H@ X@ }@ @ @@ @ @ @ fcntl@ @ sleep@ @ (@ 4@f@@ @ @ @ __start ! , < \ 4 8 D T D D  D    E   E     E     $ 4 < T d t                    4 H d x                    ( , 4 8 @ D L P X \ d h p t |                             (@ @ D H L P T  X \ ` d h l/ p t x  |" ' : >  *   &    #   )    = +     $      <   ; ? A    %    !    $ ( , 0 4, 8- <B @C D HH LI P T3 X \7 `2 d4 h5 l6 p t0 x. | 8 9 F G 1 (/usr/lib:/lib:/usr/ibmcxx/liblibc.ashr.olibC.ashr.olibpthread.ashr_comm.olibpthread.ashr_xpg5.olibbsd.ashr.olibC.ashr2.olibC.ashr3.olibC.aansi_32.o ___memset ___memmove loadquery_system_configuration strncasecmp vsnprintf fdatasync __mod_init__malloc_user_defined_name __dl__FPv __nw__FUl __nw__FUlPvterminate__Fv__CleanupCatch__vec__delete2 __BadRethrow__SaveNonVolatileRegisters__CurrentException __frame_ptr__my_pc_address__ExtractRegs#__setUncaughtExceptionFlag__3stdFb__RestoreRegsAndJump__ResetStackPointer__pthread_tracepthread_mutex_unlockpthread_mutex_lockpthread_mutex_destroy pthread_init __bsd_init __vn__FUl __vd__FPv0__vft24__DynaCastDesc_si_public14__DynaCastDesc__vft13eti_cplusplus9type_infoterminate__3stdFvunexpected__3stdFv _Xlen__Q2_3std12_String_baseCFv _Xran__Q2_3std12_String_baseCFv*>LBNJ`ZnprPR(Th&Rݙ$0*:LdљpFnǙǙr|ݙ*v & \@ ݙ ݙ   B j     @ LH   ^`Bdfbdf $bjȏ8BȏPbΏfЏjҏrԏЏ@ΏȏșRȏ\pȏȏ jʙʙʙؙ֏ʙؙ؏֏ ԙ,<P(<H|֏ >֏Dxԙřdř|ř؏ ֏,8B؏D ؙ ؏؏֏ԙ @P\<ٙ֏HǙ֏ p ֏ ޙ!B֏!ϙ""ʙ"֏#~֏$֏%>֏))+-֏/0L0x 0 12<2f֏3(3455F֏66d7878|88֏9::;4;&֏>f?@0@@ A AP BBBB B C֏C4CxuCzCzD4uD|EdՙEuEFuG(GՙH uHTIJPәJJK(uK`KLRLtәLLL M, NOP֏PR0 R T|UXZ\ZuZz[z[`u[\ՙ\u\^u^P_ՙ_4u_|`aPәa֏bbTzbubcՙcud,eVeeuffgәgiuiTziziuj,jՙkuk`lxulmՙmumoooәpzqzq`uqrtՙrurtutPu,ՙuLuuvvwwNwRwuxHxxxәyzzz{u{H|,ՙ|Lu|}}~u082P^`uR *<әpR$p<RDkPę\ęR<zuՙu2u0әRV\Rzu`,ՙLuRR8u6Xә|R``D~Fn6^&Nv> f .V~>. V"R9CHHMz"ݙMW\\dk љhM&$N&v(*,.0ݙn܏t/%*.4ݙ<ݙH%T*026.8V:~<>4.> , < \ 4L 8^ Dv Tz 2 2 * 2 * 2 ( 4 ( ( 4 ( ( 4 ( 4 ( ( 2 ( $( 4( <( TL d( tF J 0 * * D B @ * * > 8 < *  * : 8  6 4H HF d. x,   D  r  z      |  X  Z   (t , 4 8 @  D L P X \ d h p" t |                   $  &        \ (  @ D H Lb PZ TP X^ \\ `` dj h l p t xX |    Z  \ J  J v l  | ~  x ( P   t ~ |  V f z n  R     L N   T v  x  r $j (p ,h 0* 4 8 <. @0 Dd H: L< PN T  X \( ` d" h$ l& p t x | * , 6 8   ) < R fcntl _ sleep j t ~            > S g q {    __quous3.__quous3/9DOerrnoclose link [ open rename unlink emalloc free _Errno exit atexit strlen fopen { fprintf printf fclose fflush  snprintf fgets sscanf fseek stat system isalpha memcmp getopt strerror   __crt0voptindoptargTOC k @k Dk_$STATIC Hkatexit Lkmalloc Pk[ Tk_Errno Xkfree \kexit `k_cdtors dk hk lk pk tke xkmemcmp |k__crt0v k kR k_$STATIC k k_$STATIC k k kerrno k kprintf kgetopt kverbose kacl_file koptarg k_$STATIC k k k< kj ksnprintf ksystem kstat kstrerror kunlink kfopen kfseek kfclose k) kopen k kfcntl ksleep kclose klink k  krename kfgets kisalpha ksscanf k  kfprintf $kfflush (k{ ,k_$STATIC 0kt 4k~ 8kg <kq @kstrlen Dk Hk Lk Pk Tk_$STATIC Xk \k `k dk hk lk_$STATIC pk tk xk |k> kS k k k koptind k Cg,T g.__start(k.__start(D__start   4k p_xargc p_xargv p_xrcfg 8p_xrc <.filehg7v k  X_$STATIC kZ    $ , 0 4.file g$Jdk l  l.main` l klk_$STATIC Hk (k  verbose @acl_file D.fileR g dk% x |    <  #l Bx Z q  `   !8 "t !#p kT# k$ &X 5& ~'H  (  p(  )  !*  +  Q,  -X  -  n/<  /  =  >  ?, k Z@  B0 N0 /O P Q Q R R YTl RU V WT IX X kY| kY bZ0 a g qh p jy zx } 5~ @  k$ !D < h \ k  7 t T   = `8  k.@310 k.@7P k.@9l khk_$STATIC k@9 k  @7 k  @31 pk   4k   @k  a      k   >             |   Xk   k   dk   Lk   k h4.file`gkX V_$STATIC kU     .filefg'c} (.filel g../../cdtors.C_cdtors x.file gk  p kp- kp@( kpl p< kpt kp kp  kp  kp  kpXk5_$STATIC 0kD__glab26 k  __glab13 k   k       k   ,.file gk  .__glab7 k.__glab6 k k _$STATIC k<__glab6  k  __glab7 k  .file g)@ZTkT p  k k_$STATIC knoname g.__Thrownoname g )strcmp.s g.strcmp 0) 4 g.strncpy)moveeq.s g.bcopy @A).ovbcopy @._moveeq L.memcpy L.memmove Lmemset.s g.memset`)ptrgl.s g._ptrgl k0._ptrgl .$PTRGL glink.s g >k( >glink.s g.exit k(.exit glink.s g.printfhk(.printfhglink.s g.getoptk(.getoptglink.s g J\k( J\glink.s g ` k( ` glink.s g t|k( t|glink.s g hk( hglink.s g.fcntlk(.fcntl glink.s g.sleepk(.sleepglink.s g k( glink.s g k( glink.s" g k( glink.s' g k( #glink.s, g  k(  (glink.s1 g k( -glink.s6 g ,k( ,2glink.s; g Lk( L7glink.s@ g!,k(!,<glink.sE g!)tk(!)tAglink.sJ g!6k(!6Fglink.sO g!Gk(!GKglink.sT g!V$k(!V$Pglink.sY g!zk(!zUglink.s^ g!,k(!,Zglink.sc g!k(!_glink.sh g!k(!dglink.sm g!Tk(!Tiglink.sr g!|k(!|nglink.sw g!Tk(!Tsglink.s| g"|k("|xglink.s g.closek(.close}glink.s g.linkk(.linkglink.s g"$ @k("$ @glink.s g.open4k(.open4glink.s g.renameLk(.renameLglink.s g.unlinklk(.unlinklglink.s g.malloc k(.malloc glink.s g.free k(.free glink.s g._Errno hk(._Errno hglink.s g.atexit k(.atexit glink.s g.strlen,k(.strlen,glink.s g.fopenk(.fopenglink.s g"/dk("/dglink.s g.fprintfk(.fprintfglink.s g.fclosek(.fcloseglink.s g.fflush<k(.fflush<glink.s g"<k("<glink.s g"Gk("Gglink.s g.fgetstk(.fgetstglink.s g.sscanfk(.sscanfglink.s g.fseekk(.fseekglink.s g.statk(.statglink.s g.systemk(.systemglink.s g.isalphak(.isalphaglink.s g.memcmp k(.memcmp glink.s g"QDk("QDglink.s g"[$k("[$"f__pthread_tracepthread_mutex_unlockpthread_mutex_lockpthread_mutex_destroypthread_init__bsd_init__dl__FPv__nw__FUl__nw__FUlPvterminate__Fv__CleanupCatch__vec__delete2__BadRethrow__SaveNonVolatileRegisters__CurrentException__frame_ptr__my_pc_address__ExtractRegs__setUncaughtExceptionFlag__3stdFb__RestoreRegsAndJump__ResetStackPointer__vn__FUl__vd__FPv__vft24__DynaCastDesc_si_public14__DynaCastDesc__vft13eti_cplusplus9type_infoterminate__3stdFvunexpected__3stdFv_Xlen__Q2_3std12_String_baseCFv_Xran__Q2_3std12_String_baseCFv___memset.___memset___memmove.___memmoveloadquery_system_configurationstrncasecmpvsnprintffdatasync__mod_init__malloc_user_defined_name__C_runtime_pstartup__C_runtime_terminationPrioFcn__FPCvPCv_$STATIC_BSScrt0_data_file_mutex__7ACLFilecrt0main.s../../../../../../../src/bos/usr/ccs/lib/libc/__threads_init.cSun Sep 15 15:10:49 2002 C for AIX Compiler Version 5.0.1.0 --- .__threads_init_malloc_user_defined_name_xti_tli_init_routine_nsl_init_routine__dce_compat_init_routine../../../../src/csm/common/rmstanza.CMon Apr 5 20:11:33 2004 VisualAge C++ for AIX Compiler (DEVELOPMENT/BETA) Version 5.0.0.0.usage__FPc.processCommandLineArgs__FiPPc.__dftdt__7ACLFileFv../../../../src/csm/common/ACLFile.CMon Apr 5 20:02:03 2004 .init__11StanzaEntryFPCcQ2_7ACLFile14PermissionTypeQ2_7ACLFile15PermissionLevelPCc.__ct__7ACLFileFPc.__dt__7ACLFileFv._copyDefaultFile__7ACLFileFv._fileExists__7ACLFileFv._openFiles__7ACLFileFv._closeFiles__7ACLFileFv._aquireFileLocks__7ACLFileFv._releaseFileLocks__7ACLFileFv._SwapFiles__7ACLFileFv._readLine__7ACLFileFv._copy_till_stanza_found__7ACLFileFPCc._lineIsStanzaHeader__7ACLFileFv._first_token__7ACLFileFPc._printToFile__7ACLFileCFP4FILEPCce._print_entry__7ACLFileCFPC11StanzaEntry.get_permission_type__FQ2_7ACLFile14PermissionType.get_permission_level__FQ2_7ACLFile15PermissionLevel._print_all_entries__7ACLFileFRQ2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__b.begin__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__Fv.end__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__Fv.__ne__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorCFRCQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iterator.__ml__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorCFv.__pp__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorFi._entry_exists__7ACLFileFRQ2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__Pcb.__as__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorFRCQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iterator.erase__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iterator._Next__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__4_AccFPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node._lineIsComment__7ACLFileFv._copy_stanza_to_outfile__7ACLFileFRQ2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__i.AddOrUpdateEntries__7ACLFileFPCcCPC11StanzaEntryi._processFile__7ACLFileFPCcCPC11StanzaEntryiT3.DeleteEntries__7ACLFileFPCcPPci.DeleteStanza__7ACLFileFPCc.__dftdt__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__Fv._Buynode__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_NodeT1._Insert__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorRCP11StanzaEntry.erase__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FQ3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorT1._Freenode__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__FPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node.dump__11StanzaEntryCFv._Destroy__3stdHPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_PPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_v._Destroy__3stdHP11StanzaEntry_PP11StanzaEntry_v._Construct__3stdHP11StanzaEntryP11StanzaEntry_PP11StanzaEntryRCP11StanzaEntry_v._Construct__3stdHPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_NodePQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_PPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_NodeRCPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_v._Allocate__3stdHQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_UlPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_PQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node.allocate__Q2_3std9allocatorXTQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_Hv_UlPCv_PQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node.__ct__Q2_3std9allocatorXTQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_GP11StanzaEntry_RCQ2_3std9allocatorXTP11StanzaEntry_.__ct__Q2_3std9allocatorXTPQ3_3std9_List_nodXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__5_Node_GP11StanzaEntry_RCQ2_3std9allocatorXTP11StanzaEntry_.__pp__Q3_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__8iteratorFv.__dftdt__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fv.__dftdt__Q2_3std12length_errorFv.max_size__Q2_3std4listXTP11StanzaEntryTQ2_3std9allocatorXTP11StanzaEntry__CFv.__ct__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FPCc.__ct__Q2_3std12length_errorFRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__._Tidy__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fb.assign__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FPCcUl.assign__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FRCQ2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__UlT2.__dt__Q2_3std12length_errorFv.erase__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FUlT1._Nullstr__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fv._Grow__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FUlb._Inside__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FPCc.__dftbdt__Q2_3std11logic_errorFv.__dt__Q2_3std11logic_errorFv._Allocate__3stdHc_UlPc_Pc.allocate__Q2_3std9allocatorXTc_Hv_UlPCv_Pc.__eq__3stdHcc_RCQ2_3std9allocatorXTc_RCQ2_3std9allocatorXTc__b.__dftbdt__Q2_3std9exceptionFv.__dt__Q2_3std9exceptionFv._Freeze__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__Fv.max_size__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__CFv._Copy__Q2_3std12basic_stringXTcTQ2_3std11char_traitsXTc_TQ2_3std9allocatorXTc__FUl.what__Q2_3std9exceptionCFv._Doraise__Q2_3std9exceptionCFv.what__Q2_3std11logic_errorCFv._Doraise__Q2_3std11logic_errorCFv._Doraise__Q2_3std12length_errorCFv.__dftdt__Q2_3std11logic_errorFv../../../../../../../../src/bos/usr/ccs/lib/libpthreads/init.cSun Sep 15 16:25:03 2002 .call_pthread_init_pthread_init_routine../../../../../../../src/bos/usr/ccs/lib/libbsd/__threads.cSun Sep 15 18:32:13 2002 _bsd_init_routineWed Jul 19 12:25:37 2000 IBM C and C++ Compilers, Version 3.6.4.0../../startup.CWed Jul 19 12:25:36 2000 .__C_runtime_startup.__qsort__FPvUlT2PFPCvPCv_i.__NLibraries__FPc.__Extract_cdtors_Addresses__FPcP7LibDescRi.__C_runtime_termination.PrioFcn__FPCvPCv.qstexc__FPcN21.qsexc__FPcT1.qs1__FPcT1.__glab13.__glab26../../invokedtr.CWed Jul 19 12:25:38 2000 .__Invoke__Destructor.__Invoke__Delete../..//rs6000/except.CWed Jul 19 13:30:20 2000 IBM VisualAge C++ Professional for AIX Compiler Version 5.0.0.0.__set_PA_callback__FPFv_v.__DoThrow.GrabInformation__FRP12__sigcontextRPlT2P7tbtablelR9registers.nextFrame__FR9registersPlRP12__sigcontext.__ReThrowstrncpy.s.__mod_init.pthread_mutex_unlock.pthread_mutex_lock.pthread_mutex_destroy.pthread_init.__dl__FPv.__nw__FUl.__nw__FUlPv.terminate__Fv.__CleanupCatch.__vec__delete2.__BadRethrow.__SaveNonVolatileRegisters.__CurrentException.__frame_ptr.__my_pc_address.__ExtractRegs.__setUncaughtExceptionFlag__3stdFb.__RestoreRegsAndJump.__ResetStackPointer.__vn__FUl.__vd__FPv.terminate__3stdFv.unexpected__3stdFv._Xlen__Q2_3std12_String_baseCFv._Xran__Q2_3std12_String_baseCFv.loadquery.strncasecmp.vsnprintf.snprintf.strerror.fdatasyncst kA0PB7uDq@q@q@ D./opt/csm/install/CSM_CLIENT.bndetnd_R#CSM_CLIENT.bnd I:csm.core I:csm.dsh I:csm.client I:csm.diagnostics 11St kv0PB7uq@q@q@ ./opt/csm/install/CSM_SERVER.bndetnd_R#CSM_SERVER.bnd #MEDIA="AIX Base Install Media Volume 2" I:csm.server I:csm.diagnostics I:csm.gui.dcem I:csm.gui.websm I:csm.dsh I:csm.client R:conserver R:expect R:tcl R:tk d9 k70PB$7u*q@q@q@ *./opt/csm/install/csmfilelist_aixV51d_R$I:csm.client I:csm.core I:csm.diagnostics edia V k0PB$7uq@q@q@ ./opt/csm/install/csmfilelist_aixV52d_R$I:csm.client I:csm.core I:csm.dsh I:csm.msg.en_US I:csm.msg.EN_US I:csm.server I:csm.diagnostics I:csm.gui.dcem I:csm.gui.websm k0PB$7u\q@q@q@ \./opt/csm/install/csmrpms_aixV52V52d_R$R:conserver.aix5.1.ppc.rpm R:expect.aix4.3.ppc.rpm R:tcl.aix4.3.ppc.rpm R:tk.aix4.3.ppc.rpm tics kS0PB7u :q@:q@:q@  ./opt/csm/install/defs/AIX.pm52# @(#)47 1.2 src/csm/install/defs/AIX.pm.perl, setup, csm_rveg, rveg0414a 7/29/03 17:15:16 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Definition File: Base AIX definition file # #($::VERBOSE) && print "Loading /opt/csm/install/defs/AIX.pm\n"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/defs/AIX.pm"); %::OSDefs = ( # Command pathnames # while CSM no longer works with atftp, we still have the variable # to support older kickstart files. ATFTP => "/usr/bin/tftp", TFTP => "/usr/bin/tftp", CAT => "/bin/cat", CHMOD => "/bin/chmod", COPY => "/bin/cp", CP => "/bin/cp", ESPTTY => "/usr/bin/esptty", EXPORTFS => "/usr/sbin/exportfs", GREP => "/bin/grep", GUNZIP => "/bin/gunzip", GZIP => "/bin/gzip", IFCONFIG => "/sbin/ifconfig", LN => "/bin/ln", LS => "/bin/ls", LSOF => "/usr/sbin/lsof", MKDIR => "/bin/mkdir", MOVE => "/bin/mv", MV => "/bin/mv", NETSTAT => "/bin/netstat", RM => "/bin/rm", RPMCMD => "/bin/rpm", SLEEP => "/bin/sleep", TOUCH => "/bin/touch", TAIL => "/usr/bin/tail", TAR => "/bin/tar", UNAME => "/bin/uname", # Commands with pathnames specific to AIX AIX_MNT_DEV => "/dev/cd0", CPIO => "/bin/cpio", CUT => "/usr/bin/cut", HEAD => "/bin/head", INSTALLPCMD => "/usr/sbin/installp", LSITAB => "/usr/sbin/lsitab", LSLPP => "/bin/lslpp", LSNIM => "/usr/sbin/lsnim", LSRSRC => "/bin/lsrsrc", LSRSRC_API => "/bin/lsrsrc-api", MKITAB => "/usr/sbin/mkitab", MKNFS => "/usr/sbin/mknfs", MKNFSEXP => "/usr/sbin/mknfsexp", MNTCDROM => "/tmp/tmpcdmount.csm", MOUNT => "/usr/sbin/mount", NIM => "/usr/sbin/nim", NIMINFO => "/etc/niminfo", OSLEVEL => "/bin/oslevel", PING => "/etc/ping", RESTORE => "/usr/sbin/restore", RMITAB => "/usr/sbin/rmitab", RPM2CPIO => "/bin/rpm2cpio", UMOUNT => "/usr/sbin/umount", UNMOUNT => "/usr/sbin/umount", ); 1; 4. k$0PB7u:q@:q@:q@ ./opt/csm/install/defs/Linux-SLES.pmd_R# @(#)50 1.5 src/csm/install/defs/Linux-SLES.pm.perl, setup, csm_rveg, rveg0414a 11/21/03 03:36:20 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Definition File: Linux-SLES # # Load base Linux definitions: if(-e "/opt/csm/install/defs/Linux.pm"){ do "/opt/csm/install/defs/Linux.pm"; }elsif(-e "$::CSMCLIENTMNTDIR/csm/defs/Linux.pm"){ do "$::CSMCLIENTMNTDIR/csm/defs/Linux.pm"; }else{ do "/csminstall/csm/defs/Linux.pm"; } NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/defs/Linux-SLES.pm"); $::OSDefs{LSOF} = "/usr/bin/lsof"; $::OSDefs{MNTCDROM} = "/media/cdrom"; 1; = kR50PB7u9:q@:q@:q@ 9./opt/csm/install/defs/Linux-SLES8.1.pm# @(#)49 1.4 src/csm/install/defs/Linux-SLES8.1.pm.perl, setup, csm_rveg, rveg0414a 6/12/03 22:04:37 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Definition File: Linux-SLES8.1 # # Load base Linux definitions: if(-e "/opt/csm/install/defs/Linux.pm"){ do "/opt/csm/install/defs/Linux.pm"; do "/opt/csm/install/defs/Linux-SLES.pm"; } elsif(-e "$::CSMCLIENTMNTDIR/csm/defs/Linux.pm"){ do "$::CSMCLIENTMNTDIR/csm/defs/Linux.pm"; do "$::CSMCLIENTMNTDIR/csm/defs/Linux-SLES.pm"; } else{ do "/csminstall/csm/defs/Linux.pm"; do "/csminstall/csm/defs/Linux-SLES.pm"; } NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/defs/Linux-SLES8.1.pm"); $::OSDefs{MNTCDROM} = "/media/cdrom"; 1; bin/esp kꬪ0PB7u:q@:q@:q@ ./opt/csm/install/defs/Linux-SuSE.pmpm# @(#)52 1.4 src/csm/install/defs/Linux-SuSE.pm.perl, setup, csm_rveg, rveg0414a 6/12/03 22:04:39 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Definition File: Linux-SuSE # # Load base Linux definitions: if(-e "/opt/csm/install/defs/Linux.pm"){ do "/opt/csm/install/defs/Linux.pm"; } elsif(-e "$::CSMCLIENTMNTDIR/csm/defs/Linux.pm"){ do "$::CSMCLIENTMNTDIR/csm/defs/Linux.pm"; } else{ do "/csminstall/csm/defs/Linux.pm"; } NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/defs/Linux-SuSE.pm"); $::OSDefs{LSOF} = "/usr/bin/lsof"; $::OSDefs{MNTCDROM} = "/cdrom"; 1; ns kF0PB7u7:q@:q@:q@ 7./opt/csm/install/defs/Linux-SuSE8.1.pm# @(#)51 1.4 src/csm/install/defs/Linux-SuSE8.1.pm.perl, setup, csm_rveg, rveg0414a 6/12/03 22:04:38 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Definition File: Linux-SuSE8.1 # # Load base Linux definitions: if(-e "/opt/csm/install/defs/Linux.pm"){ do "/opt/csm/install/defs/Linux.pm"; do "/opt/csm/install/defs/Linux-SuSE.pm"; } elsif(-e "$::CSMCLIENTMNTDIR/csm/defs/Linux.pm"){ do "$::CSMCLIENTMNTDIR/csm/defs/Linux.pm"; do "$::CSMCLIENTMNTDIR/csm/defs/Linux-SuSE.pm"; } else{ do "/csminstall/csm/defs/Linux.pm"; do "/csminstall/csm/defs/Linux-SuSE.pm"; } NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/defs/Linux-SuSE8.1.pm"); $::OSDefs{MNTCDROM} = "/media/cdrom"; 1; k 0PB7u:q@:q@:q@ ./opt/csm/install/defs/Linux-SuSE8.2.pm# IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Definition File: Linux-SuSE8.2 # # Load base Linux definitions: if(-e "/opt/csm/install/defs/Linux.pm"){ do "/opt/csm/install/defs/Linux.pm"; do "/opt/csm/install/defs/Linux-SuSE.pm"; } elsif(-e "$::CSMCLIENTMNTDIR/csm/defs/Linux.pm"){ do "$::CSMCLIENTMNTDIR/csm/defs/Linux.pm"; do "$::CSMCLIENTMNTDIR/csm/defs/Linux-SuSE.pm"; } else{ do "/csminstall/csm/defs/Linux.pm"; do "/csminstall/csm/defs/Linux-SuSE.pm"; } NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/defs/Linux-SuSE8.2.pm"); $::OSDefs{MNTCDROM} = "/media/cdrom"; 1; , k4<0PB7u:q@:q@:q@ ./opt/csm/install/defs/Linux.pm# IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Definition File: Base Linux definition file # # @(#)48 1.3 src/csm/install/defs/Linux.pm.perl, setup, csm_rveg, rveg0414a 9/5/03 18:37:30 #($::VERBOSE) && print "Loading /opt/csm/install/defs/Linux.pm\n"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/defs/Linux.pm"); %::OSDefs = ( # Command pathnames # while CSM no longer uses atftp, the variable will stay for # older kickstart files. ATFTP => "/usr/bin/tftp", TFTP => "/usr/bin/tftp", CAT => "/bin/cat", CHMOD => "/bin/chmod", COPY => "/bin/cp", CP => "/bin/cp", ESPTTY => "/usr/bin/esptty", EXPORTFS => "/usr/sbin/exportfs", GREP => "/bin/grep", GUNZIP => "/bin/gunzip", GZIP => "/bin/gzip", IFCONFIG => "/sbin/ifconfig", LN => "/bin/ln", LS => "/bin/ls", LSOF => "/usr/sbin/lsof", MKDIR => "/bin/mkdir", MOVE => "/bin/mv", MV => "/bin/mv", NETSTAT => "/bin/netstat", RM => "/bin/rm", RPMCMD => "/bin/rpm", RPM_BLD_CMD => "/usr/bin/rpmbuild", SLEEP => "/bin/sleep", TAIL => "/usr/bin/tail", TAR => "/bin/tar", TOUCH => "/bin/touch", UNAME => "/bin/uname", # Commands with pathnames specific to Linux CPIO => "/bin/cpio", HEAD => "/usr/bin/head", LSRSRC => "/usr/bin/lsrsrc", LSRSRC_API => "/usr/bin/lsrsrc-api", MNTCDROM => "/mnt/cdrom", MOUNT => "/bin/mount", PING => "/bin/ping", RPM2CPIO => "/usr/bin/rpm2cpio", SERVICE => "/sbin/service", UMOUNT => "/bin/umount", UNMOUNT => "/bin/umount", ); 1;  k@o0PB7umessageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/AIX-5.1.0.pm"); # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgdNode'}{'1.1.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.1.1'} = []; $opensrc_prereqs{'MgdNode'}{'1.1.2'} = []; $opensrc_prereqs{'MgdNode'}{'1.1.3'} = []; $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgdNode'}{'1.1.0'} = []; $rsct_packages{'MgdNode'}{'1.1.1'} = []; $rsct_packages{'MgdNode'}{'1.1.2'} = []; $rsct_packages{'MgdNode'}{'1.1.3'} = []; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install # This is used by copycsmpkgs. Since gencopy places extra characters # after the fileset name, we put the * to handle this case. This # potentially could cause problems elsewhere. my $csm_packages; $csm_packages{'MgdNode'}{'1.1.0'} =['csm.core*','csm.client*','csm.diagnostics*']; $csm_packages{'MgdNode'}{'1.1.1'} =['csm.core*','csm.client*','csm.diagnostics*']; $csm_packages{'MgdNode'}{'1.1.2'} =['csm.core*','csm.client*','csm.diagnostics*']; $csm_packages{'MgdNode'}{'1.1.3'} =['csm.core*','csm.client*','csm.diagnostics*']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgdNode'}{'1.1.0'}=[]; $rsct_unpackages{'MgdNode'}{'1.1.1'}=[]; $rsct_unpackages{'MgdNode'}{'1.1.2'}=[]; $rsct_unpackages{'MgdNode'}{'1.1.3'}=[]; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgdNode'}{'1.1.0'}=[]; $csm_unpackages{'MgdNode'}{'1.1.1'}=[]; $csm_unpackages{'MgdNode'}{'1.1.2'}=[]; $csm_unpackages{'MgdNode'}{'1.1.3'}=[]; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgdNode'}{'1.1.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.1.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.1.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.1.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgdNode'}{'1.1.0'}=['csm.core','csm.client']; $csm_nouninstall_pkgs{'MgdNode'}{'1.1.1'}=['csm.core','csm.client']; $csm_nouninstall_pkgs{'MgdNode'}{'1.1.2'}=['csm.core','csm.client']; $csm_nouninstall_pkgs{'MgdNode'}{'1.1.3'}=['csm.core','csm.client']; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=[]; $os_prereqs{'MgdNode'}=[]; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; 1; # end 2_3s k{0PB7umessageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/AIX-5.2.0.pm"); # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tcl*','tk*','expect*','conserver*']; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = []; $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} = []; $rsct_packages{'MgdNode'}{'1.3.0'} = []; $rsct_packages{'MgdNode'}{'1.3.1'} = []; $rsct_packages{'MgdNode'}{'1.3.2'} = []; $rsct_packages{'MgdNode'}{'1.3.3'} = []; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install # This is used by copycsmpkgs. Since gencopy places extra characters (VRMF) # after the fileset name, we put the * to handle this case. This # potentially could cause problems elsewhere. my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core*','csm.client*','csm.dsh*','csm.server*', 'csm.diagnostics*','csm.gui.dcem*','csm.gui.websm*', 'csm.msg.*_*']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core*','csm.client*','csm.diagnostics*', 'csm.dsh*','csm.msg.*_*']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core*','csm.client*','csm.diagnostics*', 'csm.dsh*','csm.msg.*_*']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core*','csm.client*','csm.diagnostics*', 'csm.dsh*','csm.msg.*_*']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core*','csm.client*','csm.diagnostics*', 'csm.dsh*','csm.msg.*_*']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=[]; $rsct_unpackages{'MgdNode'}{'1.3.0'}=[]; $rsct_unpackages{'MgdNode'}{'1.3.1'}=[]; $rsct_unpackages{'MgdNode'}{'1.3.2'}=[]; $rsct_unpackages{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.server','csm.diagnostics','csm.gui*']; $csm_unpackages{'MgdNode'}{'1.3.0'}=[]; $csm_unpackages{'MgdNode'}{'1.3.1'}=[]; $csm_unpackages{'MgdNode'}{'1.3.2'}=[]; $csm_unpackages{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'} = ['csm.core','csm.client','csm.dsh']; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.dsh']; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.dsh']; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.dsh']; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.dsh']; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=[]; $os_prereqs{'MgdNode'}=[]; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; 1; # end AIX.p kE0PB7u messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgLoading', "/opt/csm/install/pkgdefs/AIX.pm"); %::pkgdefs = (); # CSM binaries copied to /csminstall/csm directory my $csm_bin_copy_csm; $csm_bin_copy_csm = [ '/opt/csm/csmbin/updatenode.client', '/opt/csm/csmbin/write_status', '/opt/csm/msgmaps/csmInstall.csminstall.map', '/opt/csm/pm/MessageUtils.pm', '/opt/csm/pm/NodeUtils.pm', '/opt/csm/pm/ArchiveUtils.pm', '/opt/csm/pm/InstallUtils.pm', '/opt/csm/pm/InstallKRB5Utils.pm', '/opt/csm/msgmaps/csmKRB5p.csmKRB5p_msg.map', '/opt/csm/pm/NetworkUtils.pm', '/opt/csm/pm/ServerUtils.pm', '/opt/csm/pm/CSMDefs.pm', '/opt/csm/msgmaps/nodecmds.NodeUtils.map', '/opt/csm/csmbin/rmnode_client', '/opt/csm/csmbin/makenode', '/opt/csm/csmbin/csmprereboot', '/opt/csm/csmbin/csmfirstboot', '/opt/csm/install/defs', '/opt/csm/install/pkgdefs' ]; $::pkgdefs{csm_bin_copy_csm} = $csm_bin_copy_csm; # CSM binaries copied to /tftpboot directory my $csm_bin_copy_tftpboot; $csm_bin_copy_tftpboot = []; $::pkgdefs{csm_bin_copy_tftpboot} = $csm_bin_copy_tftpboot; # Default TFTP Server RPM Name my $default_tftp_server_pkg_name; $default_tftp_server_pkg_name = ['tftp-hpa-0.34-1']; $::pkgdefs{default_tftp_server_pkg_name} = $default_tftp_server_pkg_name; # CSM Log files ( used while uninstalling) my $logfiles; $logfiles{'MgmtServer'} = ['/var/log/csm/updatenode.log*', '/var/log/csm/installms.log*']; $logfiles{'MgdNode'} = ['/var/log/csm/install.log*', '/var/opt/csm/cfmlocal*']; $::pkgdefs{logfiles} = $logfiles{$::mgmt_type}; 1;  k0PB7uh"=q@=q@=q@ h"./opt/csm/install/pkgdefs/Linux-RedHat7.2.pmCo# @(#)71 1.20 src/csm/install/pkgdefs/Linux-RedHat7.2.pm.perl, setup, csm_rveg, rveg0407a 2/10/04 00:01:47 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: RedHat 7.2 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, 1.3.1, 1.3.2, 1.3.3 etc. package RedHat72; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-RedHat7.2.pm"); $::pkgdefs{DISTRO_NAME} = "Red Hat Linux 7.2"; $::pkgdefs{DISTRO_DISKLIST} = "1 2"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "RedHat/RPMS"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.disc1-i386', #diskid_searchstring => '', diskid_searchargs => { file => '.disc1-i386', key => '', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHat7.2-i386', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.disc2-i386', #diskid_searchstring => '', diskid_searchargs => { file => '.disc2-i386', key => '', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHat7.2-i386', } ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa','syslinux','IBMJava2-JRE-1.4.1','conserver','fping']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; if ($::ITDAGENT eq "true") { #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.2'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.3'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} =['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.2.0'} =['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} =['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} =['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} =['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} =['src','rsct.core.utils','rsct.core','rsct.basic']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} =['csm.core','csm.dsh','csm.server','csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} =['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} =['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} =['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} =['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} =['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.dsh','csm.server','csm.diagnostics','csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'}=['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=['perl-5*','nfs-utils-*','pdksh-*','dhcp-*','rdist-6*','tcl-8.3*','tk-8.3*','expect-5.32*','XFree86-libs-4.1*','freetype-2.0*']; $os_prereqs{'MgdNode'}=['perl-5*','nfs-utils-*','pdksh-*','rdist-6*','perl-libnet-1.07*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; ############ Added for noneth0 support #################################### @::getmacs_Exec=('usr/bin/grep','usr/sbin/ifconfig','usr/bin/sed','usr/bin/sleep','usr/bin/bash'); $::pkgdefs{getmacs_Exec}=[ @::getmacs_Exec ]; $::getmacs_Lib="/lib"; $::pkgdefs{getmacs_Lib}=$::getmacs_Lib; @::getmacs_ReqLibs=('/lib/ld-linux.so.2','/lib/libc.so.6','/lib/libdl.so.2','/lib/libtermcap.so.2'); $::pkgdefs{getmacs_ReqLibs}=[ @::getmacs_ReqLibs ]; @::getmacs_DirStructure=("bin","etc","linuxrc","modules","proc",".profile","sbin","tmp","var"); $::pkgdefs{getmacs_DirStructure}=[ @::getmacs_DirStructure ]; ############ Added end #################################################### 1; # end  knY0PB7u$=q@=q@=q@ $./opt/csm/install/pkgdefs/Linux-RedHat7.3.pmCo# @(#)72 1.20 src/csm/install/pkgdefs/Linux-RedHat7.3.pm.perl, setup, csm_rveg, rveg0407a 2/10/04 00:02:37 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: RedHat 7.3 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, 1.3.1, 1.3.2, 1.3.3, etc. package RedHat73; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-RedHat7.3.pm"); $::pkgdefs{DISTRO_NAME} = "Red Hat Linux 7.3"; $::pkgdefs{DISTRO_DISKLIST} = "1 2 3"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "RedHat/RPMS"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.disc1-i386', #diskid_searchstring => 'Valhalla 7.3 disc1', diskid_searchargs => { file => '.disc1-i386', key => 'Valhalla 7.3 disc1', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHat7.3-i386', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.disc2-i386', #diskid_searchstring => 'Valhalla 7.3 disc2', diskid_searchargs => { file => '.disc2-i386', key => 'Valhalla 7.3 disc2', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHat7.3-i386', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.disc3-i386', #diskid_searchstring => 'Valhalla 7.3 disc3', diskid_searchargs => { file => '.disc3-i386', key => 'Valhalla 7.3 disc3', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHat7.3-i386', } ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa','syslinux','IBMJava2-JRE-1.4.1','conserver','fping']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; if ($::ITDAGENT eq "true") { @{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}=(@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}},'ITDAgent','DirAgent','RAIDLxAg','MPAAgent'); #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.2'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.3'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} =['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.2.0'} =['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} =['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} =['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} =['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} =['src','rsct.core.utils','rsct.core','rsct.basic']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core','csm.dsh','csm.server','csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'}=['csm.dsh','csm.server','csm.diagnostics','csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'}=['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'}=['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'}=['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'}=['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'}=['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'}=['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=['perl-5*','nfs-utils-*','pdksh-*','dhcp-*','rdist-6*','tcl-8.3*','tk-8.3*','expect-5.32*','XFree86-libs-4.2*','freetype-2.0*']; $os_prereqs{'MgdNode'}=['perl-5*','nfs-utils-*','pdksh-*','rdist-6*','perl-libnet-1.09*','perl-DB_File-*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; ############ Added for noneth0 support #################################### @::getmacs_Exec=('usr/bin/grep','usr/sbin/ifconfig','usr/bin/sed','usr/bin/sleep','usr/bin/bash'); $::pkgdefs{getmacs_Exec}=[ @::getmacs_Exec ]; $::getmacs_Lib="/lib"; $::pkgdefs{getmacs_Lib}=$::getmacs_Lib; @::getmacs_ReqLibs=('/lib/ld-linux.so.2','/lib/libc.so.6','/lib/libdl.so.2','/lib/libtermcap.so.2'); $::pkgdefs{getmacs_ReqLibs}=[ @::getmacs_ReqLibs ]; @::getmacs_DirStructure=("bin","etc","linuxrc","modules","proc",".profile","sbin","tmp","var"); $::pkgdefs{getmacs_DirStructure}=[ @::getmacs_DirStructure ]; ############ Added end #################################################### 1; # end ac k"0PB7uV$c@c@c@ V$./opt/csm/install/pkgdefs/Linux-RedHat8.0.pmCo# @(#)73 1.27.1.1 src/csm/install/pkgdefs/Linux-RedHat8.0.pm.perl, setup, csm_rveg, rvegs001a 4/27/04 03:43:05 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: RedHat 8.0 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, 1.3.1, 1.3.2, 1.3.3, etc. package RedHat80; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-RedHat8.0.pm"); $::pkgdefs{DISTRO_NAME} = "Red Hat Linux 8.0"; $::pkgdefs{DISTRO_DISKLIST} = "1 2 3"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "RedHat/RPMS"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.discinfo', #diskid_searchstring => '^1$', diskid_searchargs => { file => '.disc1-i386', key => '^1$', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHat8.0-i386', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.discinfo', #diskid_searchstring => '^2$', diskid_searchargs => { file => '.disc2-i386', key => '^2$', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHat8.0-i386', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.discinfo', #diskid_searchstring => '^3$', diskid_searchargs => { file => '.disc3-i386', key => '^3$', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHat8.0-i386', } ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa','IBMJava2-JRE-1.4.1','conserver','fping']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; if ($::ITDAGENT eq "true") { #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.2'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.3'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core','csm.dsh','csm.server','csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.dsh','csm.server','csm.diagnostics','csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'}=['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=['syslinux-*','perl-5*','nfs-utils-*','pdksh-*','dhcp-3*','rdist-6*','tcl-8.3*','tk-8.3*','expect-5.38*','XFree86-libs-4.2*','freetype-2.1*']; $os_prereqs{'MgdNode'}=['perl-5*','nfs-utils-*','pdksh-*','rdist-6*','perl-DB_File-*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; ############ Added for noneth0 support #################################### @::getmacs_Exec=('usr/bin/grep','usr/sbin/ifconfig','usr/bin/sed','usr/bin/sleep','usr/bin/bash'); $::pkgdefs{getmacs_Exec}=[ @::getmacs_Exec ]; $::getmacs_Lib="/lib"; $::pkgdefs{getmacs_Lib}=$::getmacs_Lib; @::getmacs_ReqLibs=('/lib/ld-linux.so.2','/lib/libc.so.6','/lib/libdl.so.2','/lib/libtermcap.so.2'); $::pkgdefs{getmacs_ReqLibs}=[ @::getmacs_ReqLibs ]; @::getmacs_DirStructure=("bin","etc","linuxrc","modules","proc",".profile","sbin","tmp","var"); $::pkgdefs{getmacs_DirStructure}=[ @::getmacs_DirStructure ]; ############ Added end #################################################### 1; # end er k0PB7ul$c@c@c@ l$./opt/csm/install/pkgdefs/Linux-RedHat9.pmmCo# @(#)24 1.15.1.1 src/csm/install/pkgdefs/Linux-RedHat9.pm.perl, setup, csm_rveg, rvegs001a 4/27/04 03:44:16 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: RedHat 9 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, 1.3.1, 1.3.2, 1.3.3, etc. package RedHat9; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-RedHat9.pm"); $::pkgdefs{DISTRO_NAME} = "Red Hat Linux 9"; $::pkgdefs{DISTRO_DISKLIST} = "1 2 3"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "RedHat/RPMS"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.discinfo', #diskid_searchstring => '^1$', diskid_searchargs => { file => '.discinfo', key => '^1$', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHat9-i386', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.discinfo', #diskid_searchstring => '^2$', diskid_searchargs => { file => '.discinfo', key => '^2$', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHat9-i386', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.discinfo', #diskid_searchstring => '^3$', diskid_searchargs => { file => '.discinfo', key => '^3$', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHat9-i386', } ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa','IBMJava2-JRE-1.4.1','conserver','fping']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; if ($::ITDAGENT eq "true") { #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.2'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.3'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core','csm.dsh','csm.server','csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.dsh','csm.server','csm.diagnostics','csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'}=['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=['syslinux-*','perl-5*','nfs-utils-*','pdksh-*','dhcp-3*','rdist-6*','tcl-8.3*','tk-8.3*','expect-5.38*','XFree86-libs-4.3*','freetype-2.1*','compat-libstdc++-*']; $os_prereqs{'MgdNode'}=['perl-5*','nfs-utils-*','pdksh-*','rdist-6*','compat-libstdc++-*','perl-DB_File-*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; ############ Added for noneth0 support #################################### @::getmacs_Exec=('usr/bin/grep','usr/sbin/ifconfig','usr/bin/sed','usr/bin/sleep','usr/bin/bash'); $::pkgdefs{getmacs_Exec}=[ @::getmacs_Exec ]; $::getmacs_Lib="/lib"; $::pkgdefs{getmacs_Lib}=$::getmacs_Lib; @::getmacs_ReqLibs=('/lib/ld-linux.so.2','/lib/libc.so.6','/lib/libdl.so.2','/lib/libtermcap.so.2'); $::pkgdefs{getmacs_ReqLibs}=[ @::getmacs_ReqLibs ]; @::getmacs_DirStructure=("bin","etc","linuxrc","modules","proc",".profile","sbin","tmp","var"); $::pkgdefs{getmacs_DirStructure}=[ @::getmacs_DirStructure ]; ############ Added end #################################################### 1; # end 'csm k0PB7uy. b@ b@ b@ y../opt/csm/install/pkgdefs/Linux-RedHatAS2.1.pmo# @(#)70 1.26.1.3 src/csm/install/pkgdefs/Linux-RedHatAS2.1.pm.perl, setup, csm_rveg 5/18/04 03:26:18 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: RedHatAS 2.1 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, 1.3.1, 1.3.2, 1.3.3, etc. package RedHatAS21; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-RedHatAS2.1.pm"); $::pkgdefs{DISTRO_NAME} = "Red Hat Linux Advanced Server 2.1"; $::pkgdefs{DISTRO_DISKLIST} = "1 2"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "RedHat/RPMS"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.disc1-i386', #diskid_searchstring => '', diskid_searchargs => { file => '.disc1-i386', key => '1020464629.319525', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatAS2.1-i386', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.disc2-i386', #diskid_searchstring => '', diskid_searchargs => { file => '.disc2-i386', key => '1020464629.319525', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatAS2.1-i386', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.disc2-i386', #diskid_searchstring => '', diskid_searchargs => { file => '.disc3-i386', key => '1020464629.319525', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatAS2.1-i386', }, ); # Service Pack disks defination @::qu2_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}.' QU2', diskid_searchargs => { file => '.disc1-i386', key => '1054091198.158084', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatAS2.1-QU2', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}.' QU2', diskid_searchargs => { file => '.disc2-i386', key => '1054091198.158084', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatAS2.1-QU2', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}.' QU2', diskid_searchargs => { file => '.disc3-i386', key => '1054091198.158084', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatAS2.1-QU2', }, ); @::qu4_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}.' QU4', diskid_searchargs => { file => '.disc1-i386', key => '1083183287.924640', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatAS2.1-QU4', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}.' QU4', diskid_searchargs => { file => '.disc2-i386', key => '1083183287.924640', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatAS2.1-QU4', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}.' QU4', diskid_searchargs => { file => '.disc3-i386', key => '1083183287.924640', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatAS2.1-QU4', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}.' QU4', diskid_searchargs => { file => '.disc4-i386', key => '1083183287.924640', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatAS2.1-QU4', }, ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; $::pkgdefs{sp_disks}{QU2} = [ @::qu2_disks ]; $::pkgdefs{sp_disks}{QU4} = [ @::qu4_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa','syslinux','IBMJava2-JRE-1.4.1','conserver','fping']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; if ($::ITDAGENT eq "true") { @{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}=(@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}},'ITDAgent','DirAgent','RAIDLxAg','MPAAgent'); #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.2'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.3'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core','csm.dsh','csm.server','csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.dsh','csm.server','csm.diagnostics','csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'}=['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=['perl-5*','nfs-utils-*','pdksh-*','dhcp-*','rdist-6*','tcl-8.3*','tk-8.3*','expect-5.32*','XFree86-libs-4.1*','freetype-2.0*']; $os_prereqs{'MgdNode'}=['perl-5*','nfs-utils-*','pdksh-*','rdist-6*','perl-libnet-1.07*','perl-DB_File-*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; ############ Added for noneth0 support #################################### @::getmacs_Exec=('usr/bin/grep','usr/sbin/ifconfig','usr/bin/sed','usr/bin/sleep','usr/bin/bash'); $::pkgdefs{getmacs_Exec}=[ @::getmacs_Exec ]; $::getmacs_Lib="/lib"; $::pkgdefs{getmacs_Lib}=$::getmacs_Lib; @::getmacs_ReqLibs=('/lib/ld-linux.so.2','/lib/libc.so.6','/lib/libdl.so.2','/lib/libtermcap.so.2'); $::pkgdefs{getmacs_ReqLibs}=[ @::getmacs_ReqLibs ]; @::getmacs_DirStructure=("bin","etc","linuxrc","modules","proc",".profile","sbin","tmp","var"); $::pkgdefs{getmacs_DirStructure}=[ @::getmacs_DirStructure ]; ############ Added end #################################################### 1; # end .3.3'}  k0PB7urEd@d@d@ rE./opt/csm/install/pkgdefs/Linux-RedHatEL-AS3-ppc64.pmcs# @(#)33 1.16.1.4 src/csm/install/pkgdefs/Linux-RedHatEL-AS3-ppc64.pm.perl, setup, csm_rveg 5/13/04 10:13:20 #.2003 IBM_PROLOG_BEGIN_TAG #.2003 This is an automatically generated prolog. #.2003 #.2003 #.2003 #.2003 Licensed Materials - Property of IBM #.2003 #.2003 (C) COPYRIGHT International Business Machines Corp. 2003,2004 #.2003 All Rights Reserved #.2003 #.2003 US Government Users Restricted Rights - Use, duplication or #.2003 disclosure restricted by GSA ADP Schedule Contract with IBM Corp. #.2003 #.2003 IBM_PROLOG_END_TAG # Package Definition File: RedHatEL-AS 3 ppc # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, etc. package RedHatELAS3ppc64; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-RedHatEL-AS3-ppc64.pm"); $::pkgdefs{DISTRO_NAME} = "Red Hat Enterprise Linux AS 3 PPC"; $::pkgdefs{DISTRO_DISKLIST} = "1 2 3"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "RedHat/RPMS"; $::pkgdefs{DISTRO_UPDATESDIR} = "RedHat/Updates"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME} . " (Update 1)", diskid_searchargs => { file => '.discinfo', num => '1', arch => 'ppc', key => '1065571970.028067', rpm => 'RedHat/Updates/redhat-release-3AS*', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-ppc64', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '2', arch => 'ppc', key => '1065571970.028067', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-ppc64', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '3', arch => 'ppc', key => '1065571970.028067', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-ppc64', }, { num => '1', name => $::pkgdefs{DISTRO_NAME} . "(Update 1) Extras CD", diskid_searchargs => { file => '.discinfo', num => '1', arch => 'ppc', key => '', rpm => 'images/iprdd.img', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-extra', }, { num => '4', name => $::pkgdefs{DISTRO_NAME} . "(Update 2)", not_for_full_install => 'TRUE', diskid_searchargs => { file => '.discinfo', num => '4', arch => 'ppc', rpm => 'RedHat/RPMS/sg3_utils-1.06-2.ppc.rpm', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU2-extra', } ); @::qu2_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME} . " (Update 2)", diskid_searchargs => { file => '.discinfo', num => '1', arch => 'ppc', key =>'1083779332.636875', rpm => 'SRPMS/comps-3AS-0.20040505.src.rpm', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU2', }, { num => '2', name => $::pkgdefs{DISTRO_NAME} . " (Update 2)", diskid_searchargs => { file => '.discinfo', num => '2', arch => 'ppc', key =>'1083779332.636875', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU2', }, { num => '3', name => $::pkgdefs{DISTRO_NAME} . " (Update 2)", diskid_searchargs => { file => '.discinfo', num => '3', arch => 'ppc', key =>'1083779332.636875', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU2', }, { num => '4', name => $::pkgdefs{DISTRO_NAME} . " (Update 2)", diskid_searchargs => { file => '.discinfo', num => '4', arch => 'ppc', key =>'1083779332.636875', rpm => 'RedHat/RPMS/sg3_utils-1.06-2.ppc.rpm', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU2', }, ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; $::pkgdefs{sp_disks}{QU1} = [ @::distro_disks ]; $::pkgdefs{sp_disks}{QU2} = [ @::qu2_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa', 'IBMJava2-JRE-ppc-1.4.1', 'conserver', 'fping', 'openCIMOM-0.7*']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; if ($::ITDAGENT eq "true") { #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.2'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core','csm.dsh','csm.server','csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = []; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'} = []; $director_packages{'MgdNode'}{'1.3.1'} = []; $director_packages{'MgdNode'}{'1.3.2'} = []; $director_packages{'MgdNode'}{'1.3.3'} = []; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.dsh','csm.server','csm.diagnostics','csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'}=['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # CSM binaries copied to /csminstall/csm directory my $csm_bin_copy_csm; $csm_bin_copy_csm{'1.2.0'} = [ '/opt/csm/csmbin/updatenode.client', '/opt/csm/csmbin/write_status', '/opt/csm/msgmaps/csmInstall.csminstall.map', '/opt/csm/pm/MessageUtils.pm', '/opt/csm/pm/NodeUtils.pm', '/opt/csm/pm/ArchiveUtils.pm', '/opt/csm/pm/InstallUtils.pm', '/opt/csm/pm/NetworkUtils.pm', '/opt/csm/pm/ServerUtils.pm', '/opt/csm/pm/CSMDefs.pm', '/opt/csm/msgmaps/nodecmds.NodeUtils.map', '/opt/csm/csmbin/rmnode_client', '/opt/csm/bin/setupconsole', '/opt/csm/csmbin/makenode', '/opt/csm/csmbin/csmprereboot', '/opt/csm/csmbin/csmfirstboot', '/usr/bin/tftp', '/opt/csm/install/defs', '/opt/csm/install/pkgdefs' ]; $csm_bin_copy_csm{'1.3.0'} = [ '/opt/csm/csmbin/updatenode.client', '/opt/csm/csmbin/write_status', '/opt/csm/msgmaps/csmInstall.csminstall.map', '/opt/csm/pm/MessageUtils.pm', '/opt/csm/pm/NodeUtils.pm', '/opt/csm/pm/ArchiveUtils.pm', '/opt/csm/pm/InstallUtils.pm', '/opt/csm/pm/NetworkUtils.pm', '/opt/csm/pm/ServerUtils.pm', '/opt/csm/pm/CSMDefs.pm', '/opt/csm/msgmaps/nodecmds.NodeUtils.map', '/opt/csm/csmbin/rmnode_client', '/opt/csm/bin/setupconsole', '/opt/csm/csmbin/makenode', '/opt/csm/csmbin/csmprereboot', '/opt/csm/csmbin/csmfirstboot', '/usr/bin/tftp', '/opt/csm/install/defs', '/opt/csm/install/pkgdefs' ]; $csm_bin_copy_csm{'1.3.1'} = [ '/opt/csm/csmbin/updatenode.client', '/opt/csm/csmbin/write_status', '/opt/csm/msgmaps/csmInstall.csminstall.map', '/opt/csm/pm/MessageUtils.pm', '/opt/csm/pm/NodeUtils.pm', '/opt/csm/pm/ArchiveUtils.pm', '/opt/csm/pm/InstallUtils.pm', '/opt/csm/pm/NetworkUtils.pm', '/opt/csm/pm/ServerUtils.pm', '/opt/csm/pm/CSMDefs.pm', '/opt/csm/msgmaps/nodecmds.NodeUtils.map', '/opt/csm/csmbin/rmnode_client', '/opt/csm/bin/setupconsole', '/opt/csm/csmbin/makenode', '/opt/csm/csmbin/setbootdisk', '/opt/csm/csmbin/csmprereboot', '/opt/csm/csmbin/csmfirstboot', '/usr/bin/tftp', '/opt/csm/install/defs', '/opt/csm/install/pkgdefs' ]; $csm_bin_copy_csm{'1.3.2'} = [ '/opt/csm/csmbin/updatenode.client', '/opt/csm/csmbin/write_status', '/opt/csm/msgmaps/csmInstall.csminstall.map', '/opt/csm/pm/MessageUtils.pm', '/opt/csm/pm/NodeUtils.pm', '/opt/csm/pm/ArchiveUtils.pm', '/opt/csm/pm/InstallUtils.pm', '/opt/csm/pm/NetworkUtils.pm', '/opt/csm/pm/ServerUtils.pm', '/opt/csm/pm/CSMDefs.pm', '/opt/csm/msgmaps/nodecmds.NodeUtils.map', '/opt/csm/csmbin/rmnode_client', '/opt/csm/bin/setupconsole', '/opt/csm/csmbin/makenode', '/opt/csm/csmbin/setbootdisk', '/opt/csm/csmbin/csmprereboot', '/opt/csm/csmbin/csmfirstboot', '/opt/csm/install/defs', '/opt/csm/install/pkgdefs', '/usr/sbin/rsct/cfg/ctsec.cfg', '/usr/sbin/rsct/bin/runact-api', '/opt/csm/csmbin/nodestatus.client' ]; $csm_bin_copy_csm{'1.3.3'} = [ '/opt/csm/csmbin/updatenode.client', '/opt/csm/csmbin/write_status', '/opt/csm/msgmaps/csmInstall.csminstall.map', '/opt/csm/pm/MessageUtils.pm', '/opt/csm/pm/NodeUtils.pm', '/opt/csm/pm/ArchiveUtils.pm', '/opt/csm/pm/InstallUtils.pm', '/opt/csm/pm/InstallKRB5Utils.pm', '/opt/csm/msgmaps/csmKRB5p.csmKRB5p_msg.map', '/opt/csm/pm/NetworkUtils.pm', '/opt/csm/pm/ServerUtils.pm', '/opt/csm/pm/CSMDefs.pm', '/opt/csm/msgmaps/nodecmds.NodeUtils.map', '/opt/csm/csmbin/rmnode_client', '/opt/csm/bin/setupconsole', '/opt/csm/csmbin/makenode', '/opt/csm/csmbin/setbootdisk', '/opt/csm/csmbin/csmprereboot', '/opt/csm/csmbin/csmfirstboot', '/opt/csm/install/defs', '/opt/csm/install/pkgdefs', '/usr/sbin/rsct/cfg/ctsec.cfg', '/usr/sbin/rsct/bin/runact-api', '/opt/csm/csmbin/nodestatus.client' ]; $::pkgdefs{csm_bin_copy_csm} = $csm_bin_copy_csm{$::csm_version}; # CSM binaries copied to /tftpboot directory my $csm_bin_copy_tftpboot; $csm_bin_copy_tftpboot{'1.2.0'}=[]; $csm_bin_copy_tftpboot{'1.3.0'}=[]; $csm_bin_copy_tftpboot{'1.3.1'}=[]; $csm_bin_copy_tftpboot{'1.3.2'}=[]; $csm_bin_copy_tftpboot{'1.3.3'}=[]; $::pkgdefs{csm_bin_copy_tftpboot} = $csm_bin_copy_tftpboot{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=['perl-5*','nfs-utils-*','pdksh-*','dhcp-3*','rdist-6*','tcl-8.3*','tk-8.3*','expect-5.38*','XFree86-libs-4.3*','freetype-2.1*','compat-libstdc++-*']; $os_prereqs{'MgdNode'}=['perl-5*','nfs-utils-*','pdksh-*','rdist-6*','compat-libstdc++-*','perl-DB_File-*','sg3_utils-*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; 1; # end 1.3.2' krG0PB7u4d@d@d@ 4./opt/csm/install/pkgdefs/Linux-RedHatEL-AS3-x86_64.pms# @(#)56 1.11.1.4 src/csm/install/pkgdefs/Linux-RedHatEL-AS3-x86_64.pm.perl, setup, csm_rveg, rvegs001a 5/10/04 05:23:49 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: RedHatEL 2.9.5 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, etc. package RedHatELAS3; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-RedHatEL-AS3-x86_64.pm"); $::pkgdefs{DISTRO_NAME} = "Red Hat Enterprise Linux AS 3 x86_64"; $::pkgdefs{DISTRO_DISKLIST} = "1 2 3 4"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "RedHat/RPMS"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '1', arch => 'x86_64', key => '1065571611.853962', rpm => 'SRPMS/comps-3as-0.20031007.src.rpm', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-x86_64', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '2', arch => 'x86_64', key => '1065571611.853962', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-x86_64', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '3', arch => 'x86_64', key => '1065571611.853962', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-x86_64', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '4', arch => 'x86_64', key => '1065571611.853962', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-x86_64', } ); @::qu1_disks= ( { num => '1', name => $::pkgdefs{DISTRO_NAME}." QU1", diskid_searchargs => { file => '.discinfo', num => '1', arch => 'x86_64', key => '1065571611.853962', rpm => 'RedHat/Updates/redhat-release-3AS*', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU1', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '2', arch => 'x86_64', key => '1065571611.853962', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU1', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '3', arch => 'x86_64', key => '1065571611.853962', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU1', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '4', arch => 'x86_64', key => '1065571611.853962', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU1', } ); @::qu2_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}." QU2", diskid_searchargs => { file => '.discinfo', num => '1', arch => 'x86_64', key => '1083796124.084188', rpm => 'SRPMS/comps-3AS-0.20040505.src.rpm', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU2', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}." QU2", diskid_searchargs => { file => '.discinfo', num => '2', key => '1083796124.084188', arch => 'x86_64', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU2', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}. " QU2", diskid_searchargs => { file => '.discinfo', num => '3', key => '1083796124.084188', arch => 'x86_64', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU2', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}. "QU2", diskid_searchargs => { file => '.discinfo', num => '4', key => '1083796124.084188', arch => 'x86_64', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU2', } ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; $::pkgdefs{sp_disks}{QU1} = [ @::qu1_disks ]; $::pkgdefs{sp_disks}{QU2} = [ @::qu2_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa','IBMJava2-JRE-1.4.1','conserver','fping']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; if ($::ITDAGENT eq "true") { # @{$opensrc_prereqs{'MgmtServer'}{'1.3.2'}}=(@{$opensrc_prereqs{'MgmtServer'}{'1.3.2'}},'ITDAgent','DirAgent','RAIDLxAg','MPAAgent'); #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.2'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.2'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core','csm.dsh','csm.server','csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.dsh','csm.server','csm.diagnostics','csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'}=['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=['syslinux-*','perl-5*','nfs-utils-*',,'dhcp-3*','pdksh-*','rdist-6*','tcl-8.3*','tk-8.3*','expect-5.38*','XFree86-libs-4.3*','freetype-2.1*','compat-libstdc++-7*']; $os_prereqs{'MgdNode'}=['perl-5*','nfs-utils-*','pdksh-*','rdist-6*','compat-libstdc++-7*','perl-DB_File-*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; # This variable is used to define valid distribution supported by csm on this OS platform my $valid_distros; $valid_distros{'MgmtServer'}{'1.3.3'}=['RedHatEL-AS 3','RedHatEL-ES 3']; $valid_distros{'MgdNode'}{'1.2.0'}=[]; $valid_distros{'MgdNode'}{'1.3.0'}=[]; $valid_distros{'MgdNode'}{'1.3.1'}=[]; $valid_distros{'MgdNode'}{'1.3.2'}=['RedHatEL-AS 3','RedHatEL-ES 3','RedHatEL-WS 3']; $valid_distros{'MgdNode'}{'1.3.3'}=['RedHatEL-AS 3','RedHatEL-ES 3','RedHatEL-WS 3']; $::pkgdefs{valid_distros} = $valid_distros{$::mgmt_type}{$::csm_version}; ############ Added for noneth0 support #################################### @::getmacs_Exec=('usr/bin/grep','usr/sbin/ifconfig','usr/bin/sed','usr/bin/sleep','usr/bin/bash'); $::pkgdefs{getmacs_Exec}=[ @::getmacs_Exec ]; $::getmacs_Lib="/lib64"; $::pkgdefs{getmacs_Lib}=$::getmacs_Lib; @::getmacs_ReqLibs=('/lib64/ld-linux-x86-64.so.2','/lib64/libc.so.6','/lib64/libdl.so.2','/lib64/libtermcap.so.2'); $::pkgdefs{getmacs_ReqLibs}=[ @::getmacs_ReqLibs ]; @::getmacs_DirStructure=("bin","etc","linuxrc","modules","proc",".profile","sbin","tmp","var"); $::pkgdefs{getmacs_DirStructure}=[ @::getmacs_DirStructure ]; ############ Added end #################################################### 1; # end ct.c k:0PB7u3d@d@d@ 3./opt/csm/install/pkgdefs/Linux-RedHatEL-AS3.pm# @(#)58 1.11.1.3 src/csm/install/pkgdefs/Linux-RedHatEL-AS3.pm.perl, setup, csm_rveg, rvegs001a 5/10/04 05:25:56 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: RedHatEL 3 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, etc. package RedHatELAS3; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-RedHatEL-AS3.pm"); $::pkgdefs{DISTRO_NAME} = "Red Hat Enterprise Linux AS 3"; $::pkgdefs{DISTRO_DISKLIST} = "1 2 3 4"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "RedHat/RPMS"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '1', arch => 'i386', key => '1065565780.808209', rpm => 'SRPMS/comps-3as-0.20031007.src.rpm', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-i386', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '2', arch => 'i386', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-i386', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '3', arch => 'i386', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-i386', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '4', arch => 'i386', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-i386', } ); @::qu1_disks= ( { num => '1', name => $::pkgdefs{DISTRO_NAME}." QU1", diskid_searchargs => { file => '.discinfo', num => '1', arch => 'i386', key => '1065565780.808209', rpm => 'RedHat/Updates/redhat-release-3AS*', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU1', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '2', arch => 'i386', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU1', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '3', arch => 'i386', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU1', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '4', arch => 'i386', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU1', } ); @::qu2_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}." QU2", diskid_searchargs => { file => '.discinfo', num => '1', arch => 'i386', key => '1083794425.140447', rpm => 'SRPMS/comps-3AS-0.20040505.src.rpm', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU2', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}. " QU2", diskid_searchargs => { file => '.discinfo', num => '2', key => '1083794425.140447', arch => 'i386', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU2', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}. " QU2", diskid_searchargs => { file => '.discinfo', num => '3', key => '1083794425.140447', arch => 'i386', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU2', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}. " QU2", diskid_searchargs => { file => '.discinfo', num => '4', key => '1083794425.140447', arch => 'i386', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-AS3-QU2', } ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; $::pkgdefs{sp_disks}{QU1} = [ @::qu1_disks ]; $::pkgdefs{sp_disks}{QU2} = [ @::qu2_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa','IBMJava2-JRE-1.4.1','conserver','fping']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; if ($::ITDAGENT eq "true") { # @{$opensrc_prereqs{'MgmtServer'}{'1.3.2'}}=(@{$opensrc_prereqs{'MgmtServer'}{'1.3.2'}},'ITDAgent','DirAgent','RAIDLxAg','MPAAgent'); #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.2'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.2'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core','csm.dsh','csm.server','csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.dsh','csm.server','csm.diagnostics','csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'}=['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=['syslinux-*','perl-5*','nfs-utils-*',,'dhcp-3*','pdksh-*','rdist-6*','tcl-8.3*','XFree86-libs-4.3*','tk-8.3*','expect-5.38*','freetype-2.1*','compat-libstdc++-7*']; $os_prereqs{'MgdNode'}=['perl-5*','nfs-utils-*','pdksh-*','rdist-6*','compat-libstdc++-7*','syslinux-*','perl-DB_File-*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; # This variable is used to define valid distribution supported by csm on this OS platform my $valid_distros; $valid_distros{'MgmtServer'}{'1.3.3'}=['RedHatEL-ES 3','RedHatEL-AS 3']; $valid_distros{'MgdNode'}{'1.2.0'}=[]; $valid_distros{'MgdNode'}{'1.3.0'}=[]; $valid_distros{'MgdNode'}{'1.3.1'}=[]; $valid_distros{'MgdNode'}{'1.3.2'}=['RedHatEL-AS 3','RedHatEL-ES 3','RedHatEL-WS 3']; $valid_distros{'MgdNode'}{'1.3.3'}=['RedHatEL-AS 3','RedHatEL-ES 3','RedHatEL-WS 3']; $::pkgdefs{valid_distros} = $valid_distros{$::mgmt_type}{$::csm_version}; ############ Added for noneth0 support #################################### @::getmacs_Exec=('usr/bin/grep','usr/sbin/ifconfig','usr/bin/sed','usr/bin/sleep','usr/bin/bash'); $::pkgdefs{getmacs_Exec}=[ @::getmacs_Exec ]; $::getmacs_Lib="/lib"; $::pkgdefs{getmacs_Lib}=$::getmacs_Lib; @::getmacs_ReqLibs=('/lib/ld-linux.so.2','/lib/libc.so.6','/lib/libdl.so.2','/lib/libtermcap.so.2'); $::pkgdefs{getmacs_ReqLibs}=[ @::getmacs_ReqLibs ]; @::getmacs_DirStructure=("bin","etc","linuxrc","modules","proc",".profile","sbin","tmp","var"); $::pkgdefs{getmacs_DirStructure}=[ @::getmacs_DirStructure ]; ############ Added end #################################################### 1; # end rs k0PB7u+b@b@b@ +./opt/csm/install/pkgdefs/Linux-RedHatEL-ES2.1.pm4.pms# @(#)70 1.16 src/csm/install/pkgdefs/Linux-RedHatES2.1.pm.perl, setup, csm_rsir, rsir0339a 9/10/03 17:37:00 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: RedHatES 2.1 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, etc. package RedHatES21; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-RedHatES2.1.pm"); $::pkgdefs{DISTRO_NAME} = "Red Hat Enterprise Linux ES release 2.1"; $::pkgdefs{DISTRO_DISKLIST} = "1 2"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "RedHat/RPMS"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.disc1-i386', #diskid_searchstring => '', diskid_searchargs => { file => '.disc1-i386', key => '1046404993.105599', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatEL-ES2.1-i386', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.disc2-i386', #diskid_searchstring => '', diskid_searchargs => { file => '.disc2-i386', key => '1046404993.105599', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatEL-ES2.1-i386', } ); # Service Pack disks defination @::qu2_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME},' QU2', diskid_searchargs => { file => '.disc1-i386', key => '1054133220.861846', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatEL-ES2.1-QU2', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}.' QU2', diskid_searchargs => { file => '.disc2-i386', key => '1054133220.861846', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatEL-ES2.1-QU2', } ); @::qu4_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME},' QU4', diskid_searchargs => { file => '.disc1-i386', key => '1082164164.965491', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatEL-ES2.1-QU4', }, { num => '2', name => $::pkgdefs{DISTRO_NAME},' QU4', diskid_searchargs => { file => '.disc2-i386', key => '1082164164.965491', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatEL-ES2.1-QU4', }, { num => '3', name => $::pkgdefs{DISTRO_NAME},' QU4', diskid_searchargs => { file => '.disc3-i386', key => '1082164164.965491', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatEL-ES2.1-QU4', }, { num => '4', name => $::pkgdefs{DISTRO_NAME},' QU4', diskid_searchargs => { file => '.disc4-i386', key => '1082164164.965491', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatEL-ES2.1-QU4', }, ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; $::pkgdefs{sp_disks}{QU2} = [ @::qu2_disks ]; $::pkgdefs{sp_disks}{QU4} = [ @::qu4_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa','syslinux','IBMJava2-JRE-1.4.1','conserver','fping']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; if ($::ITDAGENT eq "true") { @{$opensrc_prereqs{'MgmtServer'}{'1.3.2'}}=(@{$opensrc_prereqs{'MgmtServer'}{'1.3.2'}},'ITDAgent','DirAgent','RAIDLxAg','MPAAgent'); #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.2'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.2'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core','csm.dsh','csm.server','csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.dsh','csm.server','csm.diagnostics','csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'}=['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=['perl-5*','nfs-utils-*','pdksh-*','dhcp-*','rdist-6*','tcl-8.3*','tk-8.3*','expect-5.32*','XFree86-libs-4.1*','freetype-2.0*','lsof-4.51*']; $os_prereqs{'MgdNode'}=['perl-5*','nfs-utils-*','pdksh-*','rdist-6*','perl-libnet-1.07*','perl-DB_File-*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; ############ Added for noneth0 support #################################### @::getmacs_Exec=('usr/bin/grep','usr/sbin/ifconfig','usr/bin/sed','usr/bin/sleep','usr/bin/bash'); $::pkgdefs{getmacs_Exec}=[ @::getmacs_Exec ]; $::getmacs_Lib="/lib"; $::pkgdefs{getmacs_Lib}=$::getmacs_Lib; @::getmacs_ReqLibs=('/lib/ld-linux.so.2','/lib/libc.so.6','/lib/libdl.so.2','/lib/libtermcap.so.2'); $::pkgdefs{getmacs_ReqLibs}=[ @::getmacs_ReqLibs ]; @::getmacs_DirStructure=("bin","etc","linuxrc","modules","proc",".profile","sbin","tmp","var"); $::pkgdefs{getmacs_DirStructure}=[ @::getmacs_DirStructure ]; ############ Added end #################################################### 1; # end ['cs kL0PB7u5d@d@d@ 5./opt/csm/install/pkgdefs/Linux-RedHatEL-ES3.pm# @(#)59 1.10.1.4 src/csm/install/pkgdefs/Linux-RedHatEL-ES3.pm.perl, setup, csm_rveg, rvegs001a 5/10/04 05:27:09 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: RedHatEL 3 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, etc. package RedHatELES3; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-RedHatEL-ES3.pm"); $::pkgdefs{DISTRO_NAME} = "Red Hat Enterprise Linux ES 3"; $::pkgdefs{DISTRO_DISKLIST} = "1 2 3 4"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "RedHat/RPMS"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '1', arch => 'i386', key => '1065565780.808209', rpm => 'SRPMS/comps-3es-0.20031007.src.rpm', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-ES3-i386', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '2', arch => 'i386', key => '1065565780.808209', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-ES3-i386', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.discinfo', #diskid_searchstring => '^3$', diskid_searchargs => { file => '.discinfo', num => '3', arch => 'i386', key => '1065565780.808209', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-ES3-i386', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '4', arch => 'i386', key => '1065565780.808209', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-ES3-i386', } ); @::qu1_disks= ( { num => '1', name => $::pkgdefs{DISTRO_NAME}." QU1", diskid_searchargs => { file => '.discinfo', num => '1', arch => 'i386', key => '1065565780.808209', rpm => 'RedHat/Updates/redhat-release-3ES*', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-ES3-QU1', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '2', arch => 'i386', key => '1065565780.808209', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-ES3-QU1', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.discinfo', #diskid_searchstring => '^3$', diskid_searchargs => { file => '.discinfo', num => '3', arch => 'i386', key => '1065565780.808209', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-ES3-QU1', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '4', arch => 'i386', key => '1065565780.808209', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-ES3-QU1', } ); @::qu2_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}." QU2", diskid_searchargs => { file => '.discinfo', num => '1', arch => 'i386', key => '1083794425.140447', rpm => 'SRPMS/comps-3ES-0.20040505.src.rpm', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-ES3-QU2', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}." QU2", diskid_searchargs => { file => '.discinfo', num => '2', key => '1083794425.140447', arch => 'i386', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-ES3-QU2', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}." QU2", diskid_searchargs => { file => '.discinfo', num => '3', key => '1083794425.140447', arch => 'i386', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-ES3-QU2', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}." QU2", diskid_searchargs => { file => '.discinfo', num => '4', key => '1083794425.140447', arch => 'i386', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-ES3-QU2', } ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; $::pkgdefs{sp_disks}{QU1} = [ @::qu1_disks ]; $::pkgdefs{sp_disks}{QU2} = [ @::qu2_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa','IBMJava2-JRE-1.4.1','conserver','fping']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; if ($::ITDAGENT eq "true") { # @{$opensrc_prereqs{'MgmtServer'}{'1.3.2'}}=(@{$opensrc_prereqs{'MgmtServer'}{'1.3.2'}},'ITDAgent','DirAgent','RAIDLxAg','MPAAgent'); #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.2'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.2'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core','csm.dsh','csm.server','csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.dsh','csm.server','csm.diagnostics','csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'}=['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=['syslinux-*','perl-5*','nfs-utils-*',,'dhcp-3*','pdksh-*','rdist-6*','tcl-8.3*','expect-5.38*','XFree86-libs-data-4.3*','expat-*','XFree86-libs-4.3*','tk-8.3*','freetype-2.1*','compat-libstdc++-7*']; $os_prereqs{'MgdNode'}=['perl-5*','nfs-utils-*','pdksh-*','rdist-6*','compat-libstdc++-7*','perl-DB_File-*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; # This variable is used to define valid distribution supported by csm on this OS platform my $valid_distros; $valid_distros{'MgmtServer'}{'1.3.3'}=['RedHatEL-ES 3','RedHatEL-AS 3']; $valid_distros{'MgdNode'}{'1.2.0'}=[]; $valid_distros{'MgdNode'}{'1.3.0'}=[]; $valid_distros{'MgdNode'}{'1.3.1'}=[]; $valid_distros{'MgdNode'}{'1.3.2'}=['RedHatEL-AS 3','RedHatEL-ES 3','RedHatEL-WS 3']; $valid_distros{'MgdNode'}{'1.3.3'}=['RedHatEL-AS 3','RedHatEL-ES 3','RedHatEL-WS 3']; $::pkgdefs{valid_distros} = $valid_distros{$::mgmt_type}{$::csm_version}; ############ Added for noneth0 support #################################### @::getmacs_Exec=('usr/bin/grep','usr/sbin/ifconfig','usr/bin/sed','usr/bin/sleep','usr/bin/bash'); $::pkgdefs{getmacs_Exec}=[ @::getmacs_Exec ]; $::getmacs_Lib="/lib"; $::pkgdefs{getmacs_Lib}=$::getmacs_Lib; @::getmacs_ReqLibs=('/lib/ld-linux.so.2','/lib/libc.so.6','/lib/libdl.so.2','/lib/libtermcap.so.2'); $::pkgdefs{getmacs_ReqLibs}=[ @::getmacs_ReqLibs ]; @::getmacs_DirStructure=("bin","etc","linuxrc","modules","proc",".profile","sbin","tmp","var"); $::pkgdefs{getmacs_DirStructure}=[ @::getmacs_DirStructure ]; ############ Added end #################################################### 1; # end t.core' k'0PB7u+b@b@b@ +./opt/csm/install/pkgdefs/Linux-RedHatEL-WS2.1.pm4.pms# @(#)62 1.11.1.4 src/csm/install/pkgdefs/Linux-RedHatEL-WS2.1.pm.perl, setup, csm_rveg 5/18/04 03:26:26 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: RedHatWS 2.1 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, etc. package RedHatWS21; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-RedHatWS2.1.pm"); $::pkgdefs{DISTRO_NAME} = "Red Hat Enterprise Linux WS release 2.1"; $::pkgdefs{DISTRO_DISKLIST} = "1 2"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "RedHat/RPMS"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.disc1-i386', #diskid_searchstring => '', diskid_searchargs => { file => '.disc1-i386', key => '1046391612.976893', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatEL-WS2.1-i386', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.disc2-i386', #diskid_searchstring => '', diskid_searchargs => { file => '.disc2-i386', key => '1046391612.976893', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatEL-WS2.1-i386', } ); # Service Pack disks defination @::qu2_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}. 'QU2', diskid_searchargs => { file => '.disc1-i386', key => '1054153058.519025', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatEL-WS2.1-QU2', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}.' QU2', diskid_searchargs => { file => '.disc2-i386', key => '1054153058.519025', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => '/RedHatEL-WS2.1-QU2', } ); @::qu4_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}. 'QU4', diskid_searchargs => { file => '.disc1-i386', key => '1082166166.676267', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'RedHatEL-WS2.1-QU4', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}.' QU4', diskid_searchargs => { file => '.disc2-i386', key => '1082166166.676267', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => '/RedHatEL-WS2.1-QU4', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}.' QU4', diskid_searchargs => { file => '.disc3-i386', key => '1082166166.676267', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => '/RedHatEL-WS2.1-QU4', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}.' QU4', diskid_searchargs => { file => '.disc4-i386', key => '1082166166.676267', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => '/RedHatEL-WS2.1-QU4', } ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; $::pkgdefs{sp_disks}{QU2} = [ @::qu2_disks ]; $::pkgdefs{sp_disks}{QU4} = [ @::qu4_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa','syslinux','IBMJava2-JRE-1.4.1','conserver','fping']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; if ($::ITDAGENT eq "true") { @{$opensrc_prereqs{'MgmtServer'}{'1.3.2'}}=(@{$opensrc_prereqs{'MgmtServer'}{'1.3.2'}},'ITDAgent','DirAgent','RAIDLxAg','MPAAgent'); #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.2'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.2'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core','csm.dsh','csm.server','csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.dsh','csm.server','csm.diagnostics','csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'}=['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=['perl-5*','nfs-utils-*','pdksh-*','dhcp-*','rdist-6*','tcl-8.3*','tk-8.3*','expect-5.32*','XFree86-libs-4.1*','freetype-2.0*']; $os_prereqs{'MgdNode'}=['perl-5*','nfs-utils-*','pdksh-*','rdist-6*','perl-libnet-1.07*','perl-DB_File-*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; ############ Added for noneth0 support #################################### @::getmacs_Exec=('usr/bin/grep','usr/sbin/ifconfig','usr/bin/sed','usr/bin/sleep','usr/bin/bash'); $::pkgdefs{getmacs_Exec}=[ @::getmacs_Exec ]; $::getmacs_Lib="/lib"; $::pkgdefs{getmacs_Lib}=$::getmacs_Lib; @::getmacs_ReqLibs=('/lib/ld-linux.so.2','/lib/libc.so.6','/lib/libdl.so.2','/lib/libtermcap.so.2'); $::pkgdefs{getmacs_ReqLibs}=[ @::getmacs_ReqLibs ]; @::getmacs_DirStructure=("bin","etc","linuxrc","modules","proc",".profile","sbin","tmp","var"); $::pkgdefs{getmacs_DirStructure}=[ @::getmacs_DirStructure ]; ############ Added end #################################################### 1; # end .3.3' kF0PB7u.d@d@d@ ../opt/csm/install/pkgdefs/Linux-RedHatEL-WS3-x86_64.pms# @(#)57 1.13.1.4 src/csm/install/pkgdefs/Linux-RedHatEL-WS3-x86_64.pm.perl, setup, csm_rveg, rvegs001a 5/10/04 05:24:47 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: RedHatEL 3 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, etc. package RedHatELWS3; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-RedHatEL-WS3-x86_64.pm"); $::pkgdefs{DISTRO_NAME} = "Red Hat Enterprise Linux WS 3 x86_64"; $::pkgdefs{DISTRO_DISKLIST} = "1 2 3 4"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "RedHat/RPMS"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '1', arch => 'x86_64', key => '1065571611.853962', rpm => 'SRPMS/comps-3ws-0.20031007.src.rpm', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-x86_64', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '2', arch => 'x86_64', key => '1065571611.853962', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-x86_64', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '3', arch => 'x86_64', key => '1065571611.853962', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-x86_64', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '4', arch => 'x86_64', key => '1065571611.853962', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-x86_64', } ); @::qu1_disks= ( { num => '1', name => $::pkgdefs{DISTRO_NAME}." QU1", diskid_searchargs => { file => '.discinfo', num => '1', arch => 'x86_64', key => '1065571611.853962', rpm => 'RedHat/Updates/redhat-release-3WS*', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-QU1', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '2', arch => 'x86_64', key => '1065571611.853962', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-QU1', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '3', arch => 'x86_64', key => '1065571611.853962', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-QU1', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '4', arch => 'x86_64', key => '1065571611.853962', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-QU1', } ); @::qu2_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}." QU2", diskid_searchargs => { file => '.discinfo', num => '1', arch => 'x86_64', key => '1083796124.084188', rpm => 'SRPMS/comps-3WS-0.20040505.src.rpm', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-QU2', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}." QU2", diskid_searchargs => { file => '.discinfo', num => '2', key => '1083796124.084188', arch => 'x86_64', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-QU2', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}. " QU2", diskid_searchargs => { file => '.discinfo', num => '3', key => '1083796124.084188', arch => 'x86_64', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-QU2', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}. "QU2", diskid_searchargs => { file => '.discinfo', num => '4', key => '1083796124.084188', arch => 'x86_64', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-QU2', } ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; $::pkgdefs{sp_disks}{QU1} = [ @::qu1_disks ]; $::pkgdefs{sp_disks}{QU2} = [ @::qu2_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgdNode'}=['perl-5*','nfs-utils-*','pdksh-*','rdist-6*','compat-libstdc++-7*','perl-DB_File-*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; # This variable is used to define valid distribution supported by csm on this OS platform my $valid_distros; $valid_distros{'MgmtServer'}{'1.3.3'}=['RedHatEL-AS 3','RedHatEL-ES 3']; $valid_distros{'MgdNode'}{'1.2.0'}=[]; $valid_distros{'MgdNode'}{'1.3.0'}=[]; $valid_distros{'MgdNode'}{'1.3.1'}=[]; $valid_distros{'MgdNode'}{'1.3.2'}=[]; $valid_distros{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{valid_distros} = $valid_distros{$::mgmt_type}{$::csm_version}; ############ Added for noneth0 support #################################### @::getmacs_Exec=('usr/bin/grep','usr/sbin/ifconfig','usr/bin/sed','usr/bin/sleep','usr/bin/bash'); $::pkgdefs{getmacs_Exec}=[ @::getmacs_Exec ]; $::getmacs_Lib="/lib64"; $::pkgdefs{getmacs_Lib}=$::getmacs_Lib; @::getmacs_ReqLibs=('/lib64/ld-linux-x86-64.so.2','/lib64/libc.so.6','/lib64/libdl.so.2','/lib64/libtermcap.so.2'); $::pkgdefs{getmacs_ReqLibs}=[ @::getmacs_ReqLibs ]; @::getmacs_DirStructure=("bin","etc","linuxrc","modules","proc",".profile","sbin","tmp","var"); $::pkgdefs{getmacs_DirStructure}=[ @::getmacs_DirStructure ]; ############ Added end #################################################### 1; # end csm_ve k0PB7u.d@d@d@ ../opt/csm/install/pkgdefs/Linux-RedHatEL-WS3.pm# @(#)60 1.9.1.3 src/csm/install/pkgdefs/Linux-RedHatEL-WS3.pm.perl, setup, csm_rveg, rvegs001a 5/10/04 05:27:55 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: RedHatEL 3 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, etc. package RedHatELWS3; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-RedHatEL-WS3.pm"); $::pkgdefs{DISTRO_NAME} = "Red Hat Enterprise Linux WS 3"; $::pkgdefs{DISTRO_DISKLIST} = "1 2 3 4"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "RedHat/RPMS"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '1', arch => 'i386', key => '1065565780.808209', rpm => 'SRPMS/comps-3ws-0.20031007.src.rpm', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-i386', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '2', arch => 'i386', key => '1065565780.808209', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-i386', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '3', arch => 'i386', key => '1065565780.808209', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-i386', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '4', arch => 'i386', key => '1065565780.808209', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-i386', } ); @::qu1_disks= ( { num => '1', name => $::pkgdefs{DISTRO_NAME}." QU1", diskid_searchargs => { file => '.discinfo', num => '1', arch => 'i386', key => '1065565780.808209', rpm => 'RedHat/Updates/redhat-release-3WS*', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-QU1', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '2', arch => 'i386', key => '1065565780.808209', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-QU1', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '3', arch => 'i386', key => '1065565780.808209', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-QU1', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}, diskid_searchargs => { file => '.discinfo', num => '4', arch => 'i386', key => '1065565780.808209', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-QU1', } ); @::qu2_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}." QU2", diskid_searchargs => { file => '.discinfo', num => '1', arch => 'i386', key => '1083794425.140447', rpm => 'SRPMS/comps-3WS-0.20040505.src.rpm', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-QU2', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}." QU2", diskid_searchargs => { file => '.discinfo', num => '2', key => '1083794425.140447', arch => 'i386', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-QU2', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}. "QU2", diskid_searchargs => { file => '.discinfo', num => '3', key => '1083794425.140447', arch => 'i386', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-QU2', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}. "QU2", diskid_searchargs => { file => '.discinfo', num => '4', key => '1083794425.140447', arch => 'i386', rpm => '', }, diskid_searchprog => \&Linux::rhel3_diskid_match_prog, diskid_target => 'RedHatEL-WS3-QU2', } ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; $::pkgdefs{sp_disks}{QU1} = [ @::qu1_disks ]; $::pkgdefs{sp_disks}{QU2} = [ @::qu2_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgdNode'}=['perl-5*','nfs-utils-*','pdksh-*','rdist-6*','compat-libstdc++-7*','perl-DB_File-*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; # This variable is used to define valid distribution supported by csm on this OS platform my $valid_distros; $valid_distros{'MgmtServer'}{'1.3.3'}=['RedHatEL-AS 3','RedHatEL-ES 3']; $valid_distros{'MgdNode'}{'1.2.0'}=[]; $valid_distros{'MgdNode'}{'1.3.0'}=[]; $valid_distros{'MgdNode'}{'1.3.1'}=[]; $valid_distros{'MgdNode'}{'1.3.2'}=[]; $valid_distros{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{valid_distros} = $valid_distros{$::mgmt_type}{$::csm_version}; ############ Added for noneth0 support #################################### @::getmacs_Exec=('usr/bin/grep','usr/sbin/ifconfig','usr/bin/sed','usr/bin/sleep','usr/bin/bash'); $::pkgdefs{getmacs_Exec}=[ @::getmacs_Exec ]; $::getmacs_Lib="/lib"; $::pkgdefs{getmacs_Lib}=$::getmacs_Lib; @::getmacs_ReqLibs=('/lib/ld-linux.so.2','/lib/libc.so.6','/lib/libdl.so.2','/lib/libtermcap.so.2'); $::pkgdefs{getmacs_ReqLibs}=[ @::getmacs_ReqLibs ]; @::getmacs_DirStructure=("bin","etc","linuxrc","modules","proc",".profile","sbin","tmp","var"); $::pkgdefs{getmacs_DirStructure}=[ @::getmacs_DirStructure ]; ############ Added end #################################################### 1; # end $::mgmt kL0PB7uN=q@=q@=q@ N./opt/csm/install/pkgdefs/Linux-SLES7.2.pm3.pm# @(#)82 1.28 src/csm/install/pkgdefs/Linux-SLES7.2.pm.perl, setup, csm_rveg, rveg0414a 3/1/04 04:01:28 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: SLES 7.2 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, 1.3.1, 1.3.2, 1.3.3, etc. package SLES72; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-SLES7.2.pm"); $::pkgdefs{DISTRO_NAME} = "SuSE SLES 7.2"; $::pkgdefs{DISTRO_DISKLIST} = "1"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "full-names"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.S.u.S.E-disk-001.*', #diskid_searchstring => 'SuSE-Linux-SLES-i386 Version 7', diskid_searchargs => { file => '.S.u.S.E-disk-001.*', key => 'SuSE-Linux-SLES-i386 Version 7', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'SLES7.2-i386', } ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa','syslinux','IBMJava2-JRE-1.4.1','conserver', 'rdist','expect','fping']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = ['rdist']; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['rdist','perl-libnet-1.07','autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['rdist','perl-libnet-1.07','autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['rdist','perl-libnet-1.07','autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['rdist','perl-libnet-1.07','autoupdate']; if ($::ITDAGENT eq "true") { #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.2'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.3'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core','csm.dsh','csm.server','csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.dsh','csm.server','csm.diagnostics','csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'}=['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=['gppshare-*','perl-5*','nfs-utils-*','pdksh-*','dhcp-*','tcl-8*','tk-8*','xf86-*','freetype2-*','termcap-*','dosfstools-*']; $os_prereqs{'MgdNode'}=['gppshare-*','perl-5*','nfs-utils-*','pdksh-*','dhcp-*','tcl-8*','tk-8*','xf86-*','freetype2-*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; 1; # end cs k0PB7uJc@c@c@ J./opt/csm/install/pkgdefs/Linux-SLES8.1-ppc64.pm64.pms# @(#)50 1.34.1.2 src/csm/install/pkgdefs/Linux-SLES8.1-ppc64.pm.perl, setup, csm_rveg, rvegs001a 4/30/04 10:58:17 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: SLES 8.1 ppc64 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, 1.3.1, 1.3.2, 1.3.3, etc. package SLES81; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-SLES8.1.pm" ); #%::pkgdefs = (); $::pkgdefs{DISTRO_NAME} = "SuSE SLES 8.1 PPC"; $::pkgdefs{DISTRO_DISKLIST} = "1 2 4"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "suse"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => 'media.1/products', #diskid_searchstring => '/ SuSE-Linux-SLES-PPC 8', diskid_searchargs => { file=> 'media.1/products', key => '/ SuSE-Linux-SLES-PPC 8', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => "sles8-ppc64", }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => 'media.2/products', #diskid_searchstring => '/ SuSE-Linux-SLES-PPC 8', not_for_full_install => 'TRUE', diskid_searchargs => { file=> 'media.2/products', key => '/ SuSE-Linux-SLES-PPC 8', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => "sles8-ppc64", }, { num => '1', name => $::pkgdfs{$DISTRO_NAME} . ' Supplementary', #diskid_filename => 'media.1/products', #diskid_searchstring => '/ SuSE-Linux-SLES-PPC-SUPP 1', not_for_full_install => 'TRUE', diskid_searchargs => { file=> 'media.1/products', key => '/ SuSE-Linux-SLES-PPC-SUPP 1', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => "sles8-ppc64", }, ); $::pkgdefs{distro_disks} = [@::distro_disks]; @::sp3_disks = ( { num => '1', name => "SuSE SLES 8.1 SP3 PPC", # diskid_filename => '', # diskid_searchstring => '', diskid_searchargs => { file=> 'media.1/products', key => '/ SuSE-Linux-SLES-PPC 3', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => "sles8-sp3", }, ); @::sp3a_disks = ( { num => '1', name => "SuSE SLES 8.1 SP3A PPC", # diskid_filename => '', # diskid_searchstring => '', diskid_searchargs => { file=> 'media.1/products', key => '/ SuSE-Linux-SLES-PPC 3a', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => "sles8-sp3a", }, ); $::pkgdefs{sp_disks}{SP3} = [ @::sp3_disks ]; $::pkgdefs{sp_disks}{SP3A} = [ @::sp3a_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa', 'IBMJava2-JRE-ppc-1.4.1', 'conserver', 'openCIMOM-0.7*']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; if ($::ITDAGENT eq "true") { @{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}=(@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}},'ITDAgent'); #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.2'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.3'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} = ['src', 'rsct.core.utils', 'rsct.core', 'rsct.basic', 'rsct.core.cimrm']; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src', 'rsct.core.utils', 'rsct.core', 'rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src', 'rsct.core.utils', 'rsct.core', 'rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src', 'rsct.core.utils', 'rsct.core', 'rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src', 'rsct.core.utils', 'rsct.core', 'rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src', 'rsct.core.utils', 'rsct.core', 'rsct.basic', 'rsct.core.cimrm']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core', 'csm.dsh', 'csm.server', 'csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core', 'csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core', 'csm.client', 'csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core', 'csm.client', 'csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core', 'csm.client', 'csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core', 'csm.client', 'csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = ['csm.director.agent']; $director_packages{'MgdNode'}{'1.2.0'} = []; $director_packages{'MgdNode'}{'1.3.0'} = []; $director_packages{'MgdNode'}{'1.3.1'} = []; $director_packages{'MgdNode'}{'1.3.2'} = []; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'} = ['src', 'rsct.core.utils', 'rsct.core','rsct.core.cimrm']; $rsct_unpackages{'MgdNode'}{'1.2.0'} = ['src', 'rsct.core.utils', 'rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'} = ['src', 'rsct.core.utils', 'rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'} = ['src', 'rsct.core.utils', 'rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'} = ['src', 'rsct.core.utils', 'rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'} = ['src', 'rsct.core.utils', 'rsct.core','rsct.core.cimrm']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.dsh', 'csm.server', 'csm.diagnostics', 'csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core', 'csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core', 'csm.diagnostics', 'csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core', 'csm.diagnostics', 'csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core', 'csm.diagnostics', 'csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core', 'csm.diagnostics', 'csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'} = ['/csminstall', '/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'} = []; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'} = []; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'} = []; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'} = []; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'} = []; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'} = ['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'} = []; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'} = []; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'} = []; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'} = []; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'} = []; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # CSM binaries copied to /csminstall/csm directory my $csm_bin_copy_csm; $csm_bin_copy_csm{'1.2.0'} = [ '/opt/csm/csmbin/updatenode.client', '/opt/csm/csmbin/write_status', '/opt/csm/msgmaps/csmInstall.csminstall.map', '/opt/csm/pm/MessageUtils.pm', '/opt/csm/pm/NodeUtils.pm', '/opt/csm/pm/ArchiveUtils.pm', '/opt/csm/pm/InstallUtils.pm', '/opt/csm/pm/NetworkUtils.pm', '/opt/csm/pm/ServerUtils.pm', '/opt/csm/pm/CSMDefs.pm', '/opt/csm/msgmaps/nodecmds.NodeUtils.map', '/opt/csm/csmbin/rmnode_client', '/opt/csm/bin/setupconsole', '/opt/csm/csmbin/makenode', '/opt/csm/csmbin/csmprereboot', '/opt/csm/csmbin/csmfirstboot', '/usr/bin/tftp', '/opt/csm/install/defs', '/opt/csm/install/pkgdefs' ]; $csm_bin_copy_csm{'1.3.0'} = [ '/opt/csm/csmbin/updatenode.client', '/opt/csm/csmbin/write_status', '/opt/csm/msgmaps/csmInstall.csminstall.map', '/opt/csm/pm/MessageUtils.pm', '/opt/csm/pm/NodeUtils.pm', '/opt/csm/pm/ArchiveUtils.pm', '/opt/csm/pm/InstallUtils.pm', '/opt/csm/pm/NetworkUtils.pm', '/opt/csm/pm/ServerUtils.pm', '/opt/csm/pm/CSMDefs.pm', '/opt/csm/msgmaps/nodecmds.NodeUtils.map', '/opt/csm/csmbin/rmnode_client', '/opt/csm/bin/setupconsole', '/opt/csm/csmbin/makenode', '/opt/csm/csmbin/csmprereboot', '/opt/csm/csmbin/csmfirstboot', '/usr/bin/tftp', '/opt/csm/install/defs', '/opt/csm/install/pkgdefs' ]; $csm_bin_copy_csm{'1.3.1'} = [ '/opt/csm/csmbin/updatenode.client', '/opt/csm/csmbin/write_status', '/opt/csm/msgmaps/csmInstall.csminstall.map', '/opt/csm/pm/MessageUtils.pm', '/opt/csm/pm/NodeUtils.pm', '/opt/csm/pm/ArchiveUtils.pm', '/opt/csm/pm/InstallUtils.pm', '/opt/csm/pm/NetworkUtils.pm', '/opt/csm/pm/ServerUtils.pm', '/opt/csm/pm/CSMDefs.pm', '/opt/csm/msgmaps/nodecmds.NodeUtils.map', '/opt/csm/csmbin/rmnode_client', '/opt/csm/bin/setupconsole', '/opt/csm/csmbin/makenode', '/opt/csm/csmbin/setbootdisk', '/opt/csm/csmbin/csmprereboot', '/opt/csm/csmbin/csmfirstboot', '/usr/bin/tftp', '/opt/csm/install/defs', '/opt/csm/install/pkgdefs' ]; $csm_bin_copy_csm{'1.3.2'} = [ '/opt/csm/csmbin/updatenode.client', '/opt/csm/csmbin/write_status', '/opt/csm/msgmaps/csmInstall.csminstall.map', '/opt/csm/pm/MessageUtils.pm', '/opt/csm/pm/NodeUtils.pm', '/opt/csm/pm/ArchiveUtils.pm', '/opt/csm/pm/InstallUtils.pm', '/opt/csm/pm/NetworkUtils.pm', '/opt/csm/pm/ServerUtils.pm', '/opt/csm/pm/CSMDefs.pm', '/opt/csm/msgmaps/nodecmds.NodeUtils.map', '/opt/csm/csmbin/rmnode_client', '/opt/csm/bin/setupconsole', '/opt/csm/csmbin/makenode', '/opt/csm/csmbin/setbootdisk', '/opt/csm/csmbin/csmprereboot', '/opt/csm/csmbin/csmfirstboot', '/opt/csm/install/defs', '/opt/csm/install/pkgdefs', '/opt/csm/csmbin/nodestatus.client' ]; $csm_bin_copy_csm{'1.3.3'} = [ '/opt/csm/csmbin/updatenode.client', '/opt/csm/csmbin/write_status', '/opt/csm/msgmaps/csmInstall.csminstall.map', '/opt/csm/pm/MessageUtils.pm', '/opt/csm/pm/NodeUtils.pm', '/opt/csm/pm/ArchiveUtils.pm', '/opt/csm/pm/InstallUtils.pm', '/opt/csm/pm/InstallKRB5Utils.pm', '/opt/csm/msgmaps/csmKRB5p.csmKRB5p_msg.map', '/opt/csm/pm/NetworkUtils.pm', '/opt/csm/pm/ServerUtils.pm', '/opt/csm/pm/CSMDefs.pm', '/opt/csm/msgmaps/nodecmds.NodeUtils.map', '/opt/csm/csmbin/rmnode_client', '/opt/csm/bin/setupconsole', '/opt/csm/csmbin/makenode', '/opt/csm/csmbin/setbootdisk', '/opt/csm/csmbin/csmprereboot', '/opt/csm/csmbin/csmfirstboot', '/opt/csm/install/defs', '/opt/csm/install/pkgdefs', '/opt/csm/csmbin/nodestatus.client' ]; $::pkgdefs{csm_bin_copy_csm} = $csm_bin_copy_csm{$::csm_version}; # CSM binaries copied to /tftpboot directory my $csm_bin_copy_tftpboot; $csm_bin_copy_tftpboot{'1.2.0'} = []; $csm_bin_copy_tftpboot{'1.3.0'} = []; $csm_bin_copy_tftpboot{'1.3.1'} = []; $csm_bin_copy_tftpboot{'1.3.2'} = []; $csm_bin_copy_tftpboot{'1.3.3'} = []; $::pkgdefs{csm_bin_copy_tftpboot} = $csm_bin_copy_tftpboot{$::csm_version}; # REMOVE THE USE OF THIS VARIABLE FROM installms and installnode # Csm binaries copied to /csminstall/csm/ directory # There are no longer any version specific tools to copy. Everything # is in /csminstall/csm. The kickstart files are still in # /csminstall/csm//, so don't remove the # directory. #my $csm_bin_copy_csmver; #$csm_bin_copy_csmver{'1.2.0'}=[]; #$csm_bin_copy_csmver{'1.3.0'}=[]; #$csm_bin_copy_csmver{'1.3.1'}=[]; #$csm_bin_copy_csmver{'1.3.2'}=[]; #$csm_bin_copy_csmver{'1.3.3'}=[]; #$::pkgdefs{csm_bin_copy_csmver} = $csm_bin_copy_csmver{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'} = [ 'perl-5*', 'nfs-utils-*', 'pdksh-*', 'dhcp-base*', 'dhcp-server*', 'rdist-6*', 'tcl-8*', 'tk-8*', 'expect-5*', 'xf86-*', 'freetype2-*', 'rsync-*', 'rsh-server-*', 'termcap-*', 'perl-XML-RegExp-*' ]; $os_prereqs{'MgdNode'} = [ 'perl-5*', 'nfs-utils-*', 'pdksh-*', 'dhcp-base*', 'dhcp-server*', 'rdist-6*', 'tcl-8*', 'tk-8*', 'expect-5*', 'xf86-*', 'freetype2-*', 'rsync-*', 'rsh-server-*' ]; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; # CSM Log files ( used while uninstalling) my $logfiles; $logfiles{'MgmtServer'} = [ '/var/log/csm/csmsetupsis.log*', '/var/log/csm/installnode.log*', '/var/log/csm/updatenode.log*', '/var/log/csm/installms.log*' ]; $logfiles{'MgdNode'} = ['/var/log/csm/install.log*', '/var/opt/csm/cfmlocal*']; $::pkgdefs{logfiles} = $logfiles{$::mgmt_type}; %::rpm_pkg_flag = (); $::rpm_pkg_flag{openCIMOM} = " --ignoreos"; #default kernel path name based on SUSE_TOP $::kernel_path_name = "sles8-ppc64/suse/ppc/kernel-ppc64-2.4.19-108.ppc.rpm"; 1; # end ',  k30PB7u'd@d@d@ './opt/csm/install/pkgdefs/Linux-SLES8.1-x86_64.pm4.pms# @(#)23 1.14.1.1 src/csm/install/pkgdefs/Linux-SLES8.1-x86_64.pm.perl, setup, csm_rveg, rvegs001a 4/27/04 03:45:47 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: SLES 8.1 x86_64 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, 1.3.1, 1.3.2, 1.3.3, etc. package SLES81; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-SLES8.1-x86_64.pm"); $::pkgdefs{DISTRO_NAME} = "SuSE SLES 8.1 x86_64"; $::pkgdefs{DISTRO_DISKLIST} = "1 4"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "suse"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => 'media.1/products', #diskid_searchstring => '/ SuSE-Linux-SLES-x86_64 8', diskid_searchargs => { file => 'media.1/products', key => '/ SuSE-Linux-SLES-x86_64 8', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'sles8-x86_64', }, { num => '1', name => "UnitedLinux 1.0 x86_64", #diskid_filename => 'media.1/products', #diskid_searchstring => '/ UnitedLinux-x86-64 1.0', diskid_searchargs => { file => 'media.1/products', key => '/ UnitedLinux-x86-64 1.0', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'unitedlinux-x86_64', }, { num => '2', name => "UnitedLinux 1.0 x86_64", #diskid_filename => 'media.2/products', #diskid_searchstring => '/ UnitedLinux-x86-64 1.0', diskid_searchargs => { file => 'media.2/products', key => '/ UnitedLinux-x86-64 1.0', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'unitedlinux-x86_64', } ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; @::sp3_disks = ( { num => '1', name => "UnitedLinux 1.0 x86_64 SP3", #diskid_filename => 'media.1/products', #diskid_searchstring => '/ UnitedLinux-x86-64 3', diskid_searchargs => { file => 'media.1/products', key => '/ UnitedLinux-x86-64 3', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => 'unitedlinux-sp3', }, ); $::pkgdefs{sp_disks}{SP3} = [ @::sp3_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa','syslinux','IBMJava2-JRE-1.4.1','conserver','perl-XML-RegExp','fping']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; if ($::ITDAGENT eq "true") { @{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}=(@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}},'ITDAgent','DirAgent','RAIDLxAg','MPAAgent'); #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.2'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.3'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core','csm.dsh','csm.server','csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.dsh','csm.server','csm.diagnostics','csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'}=['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=['perl-5*','nfs-utils-*','pdksh-*','dhcp-base-*','dhcp-server-*','rdist-6.1.5-141*','tcl-8*','tk-8*','expect-5.34-223*','xf86-*','freetype2-*','termcap-*','expat-*','perl-XML-Parser-*','perl-XML-DOM-*','perl-HTML-Tagset-*','perl-HTML-Parser-*','perl-URI-*','perl-libwww-perl-*']; $os_prereqs{'MgdNode'}=['perl-5*','nfs-utils-*','pdksh-*','dhcp-base-*','dhcp-server-*','rdist-6.1.5-141*','tcl-8*','tk-8*','expect-5.34-223*','xf86-*','freetype2-*','rsh-server-*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; ############ Added for noneth0 support #################################### @::getmacs_Exec=('bin/grep','sbin/ifconfig','bin/sed','bin/sleep','bin/bash'); $::pkgdefs{getmacs_Exec}=[ @::getmacs_Exec ]; $::getmacs_Lib="/lib64"; $::pkgdefs{getmacs_Lib}=$::getmacs_Lib; @::getmacs_ReqLibs=('/lib64/ld-linux-x86-64.so.2','/lib64/libc.so.6','/lib64/libdl.so.2','/lib64/libreadline.so.4','/lib64/libhistory.so.4','/lib64/libncurses.so.5'); $::pkgdefs{getmacs_ReqLibs}=[ @::getmacs_ReqLibs ]; @::getmacs_DirStructure=("bin","etc","linuxrc","modules","proc","linuxrc.config","kbd","tmp","var","root","mounts","mnt","info"); $::pkgdefs{getmacs_DirStructure}=[ @::getmacs_DirStructure ]; ############ Added end #################################################### 1; # end m.dire k0PB7u.'c@c@c@ .'./opt/csm/install/pkgdefs/Linux-SLES8.1.pm_64.p# @(#)83 1.40.1.1 src/csm/install/pkgdefs/Linux-SLES8.1.pm.perl, setup, csm_rveg, rvegs001a 4/27/04 03:44:40 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: SLES 8.1 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, 1.3.1, 1.3.2, 1.3.3, etc. package SLES81; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-SLES8.1.pm"); $::pkgdefs{DISTRO_NAME} = "SuSE SLES 8.1"; $::pkgdefs{DISTRO_DISKLIST} = "1 4"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "suse"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, # diskid_filename => 'media.1/products', # diskid_searchstring => '/ SuSE-Linux-SLES-i386 8', diskid_searchargs => { file=> 'media.1/products', key => '/ SuSE-Linux-SLES-i386 8', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => "sles8-i386", }, { num => '1', name => "UnitedLinux 1.0", # diskid_filename => 'media.1/products', # diskid_searchstring => '/ UnitedLinux-i386 1.0', diskid_searchargs => { file=> 'media.1/products', key => '/ UnitedLinux-i386 1.0', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => "unitedlinux-i386", }, { num => '2', name => "UnitedLinux 1.0", # diskid_filename => 'media.2/products', # diskid_searchstring => '/ UnitedLinux-i386 1.0', diskid_searchargs => { file=> 'media.2/products', key => '/ UnitedLinux-i386 1.0', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => "unitedlinux-i386", } ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; # Service Pack Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM @::sp3_disks = ( { num => '1', name => "SuSE SLES 8.1 SP3", # diskid_filename => '', # diskid_searchstring => '', diskid_searchargs => { file=> 'media.1/products', key => '/ UnitedLinux-i386 3', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => "unitedlinux-sp3", }, ); $::pkgdefs{sp_disks}{SP3} = [ @::sp3_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa','syslinux','IBMJava2-JRE-1.4.1','conserver','perl-XML-RegExp','fping']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate','syslinux']; if ($::ITDAGENT eq "true") { @{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}=(@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}},'ITDAgent','DirAgent','RAIDLxAg','MPAAgent'); #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.2'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.3'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core','csm.dsh','csm.server','csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.dsh','csm.server','csm.diagnostics','csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'}=['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=['perl-5*','nfs-utils-*','pdksh-*','dhcp-base-*','dhcp-server-*','rdist-6.1.5-543*','tcl-8*','tk-8*','expect-5.34-192*','xf86-*','freetype2-*','termcap-*','expat-*','perl-XML-Parser-*','perl-XML-DOM-*','perl-HTML-Tagset-*','perl-HTML-Parser-*','perl-URI-*','perl-libwww-perl-*']; $os_prereqs{'MgdNode'}=['perl-5*','nfs-utils-*','pdksh-*','dhcp-base-*','dhcp-server-*','rdist-6.1.5-543*','tcl-8*','tk-8*','expect-5.34-192*','xf86-*','freetype2-*','rsh-server-*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; ############ Added for noneth0 support #################################### @::getmacs_Exec=('bin/grep','sbin/ifconfig','bin/sed','bin/sleep','bin/bash'); $::pkgdefs{getmacs_Exec}=[ @::getmacs_Exec ]; $::getmacs_Lib="/lib"; $::pkgdefs{getmacs_Lib}=$::getmacs_Lib; @::getmacs_ReqLibs=('/lib/ld-linux.so.2','/lib/libc.so.6','/lib/libdl.so.2','/lib/libreadline.so.4','/lib/libhistory.so.4','/lib/libncurses.so.5'); $::pkgdefs{getmacs_ReqLibs}=[ @::getmacs_ReqLibs ]; @::getmacs_DirStructure=("bin","etc","linuxrc","modules","proc","linuxrc.config","kbd","tmp","var","root","mounts","mnt","info"); $::pkgdefs{getmacs_DirStructure}=[ @::getmacs_DirStructure ]; ############ Added end #################################################### 1; # end .d k0PB7u&d@d@d@ &./opt/csm/install/pkgdefs/Linux-SuSE8.0.pm_64.p# @(#)85 1.32.1.1 src/csm/install/pkgdefs/Linux-SuSE8.0.pm.perl, setup, csm_rveg, rvegs001a 4/27/04 03:44:04 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: SuSE 8.0 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, etc. package SuSE80; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-SuSE8.0.pm"); $::pkgdefs{DISTRO_NAME} = "SuSE Linux 8.0"; $::pkgdefs{DISTRO_DISKLIST} = "1 2 3 4"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "suse"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.S.u.S.E-disk-001.*', #diskid_searchstring => 'SuSE-Linux-.*-i386 Version 8.0', diskid_searchargs => { file => '.S.u.S.E-disk-001.*', key => 'SuSE-Linux-.*-i386 Version 8.0', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => '/', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.S.u.S.E-disk-002.*', #diskid_searchstring => 'SuSE-Linux-.*-i386 Version 8.0', diskid_searchargs => { file => '.S.u.S.E-disk-002.*', key => 'SuSE-Linux-.*-i386 Version 8.0', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => '/', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.S.u.S.E-disk-003.*', #diskid_searchstring => 'SuSE-Linux-.*-i386 Version 8.0', diskid_searchargs => { file => '.S.u.S.E-disk-003.*', key => 'SuSE-Linux-.*-i386 Version 8.0', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => '/', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => '.S.u.S.E-disk-004.*', #diskid_searchstring => 'SuSE-Linux-.*-i386 Version 8.0', diskid_searchargs => { file => '.S.u.S.E-disk-004.*', key => 'SuSE-Linux-.*-i386 Version 8.0', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => '/', } ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa','syslinux','IBMJava2-JRE-1.4.1','conserver','fping']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; if ($::ITDAGENT eq "true") { @{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}=(@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}},'ITDAgent','DirAgent','RAIDLxAg','MPAAgent'); #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.2'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.3'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core','csm.dsh','csm.server','csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.dsh','csm.server','csm.diagnostics','csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'}=['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=['gppshare-*','perl-5*','nfs-utils-*','pdksh-*','dhcp-base-*','dhcp-server-*','rdist-6.1.5-429*','tcl-8*','tk-8*','expect-5.34-63*','xf86-*','freetype2-*']; $os_prereqs{'MgdNode'}=['gppshare-*','perl-5*','nfs-utils-*','pdksh-*','dhcp-base-*','dhcp-server-*','rdist-6.1.5-429*','tcl-8*','tk-8*','expect-5.34-63*','xf86-*','freetype2-*','rsh-server-*','perl-libnet-1.09*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; 1; # end  k0$0PB7ud(d@d@d@ d(./opt/csm/install/pkgdefs/Linux-SuSE8.1.pm_64.p# @(#)86 1.35.1.1 src/csm/install/pkgdefs/Linux-SuSE8.1.pm.perl, setup, csm_rveg, rvegs001a 4/27/04 03:44:28 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: SuSE 8.1 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, etc. package SuSE81; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-SuSE8.1.pm"); $::pkgdefs{DISTRO_NAME} = "SuSE Linux 8.1"; $::pkgdefs{DISTRO_DISKLIST} = "1 2 3 4"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "suse"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => 'media.1/products', #diskid_searchstring => '/ SuSE-Linux-.*-i386 8.1', diskid_searchargs => { file => 'media.1/products', key => '/ SuSE-Linux-.*-i386 8.1', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => '/', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => 'media.2/products', #diskid_searchstring => '/ SuSE-Linux-.*-i386 8.1', diskid_searchargs => { file => 'media.2/products', key => '/ SuSE-Linux-.*-i386 8.1', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => '/', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => 'media.3/products', #diskid_searchstring => '/ SuSE-Linux-.*-i386 8.1', diskid_searchargs => { file => 'media.3/products', key => '/ SuSE-Linux-.*-i386 8.1', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => '/', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => 'media.4/products', #diskid_searchstring => '/ SuSE-Linux-.*-i386 8.1', diskid_searchargs => { file => 'media.4/products', key => '/ SuSE-Linux-.*-i386 8.1', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => '/', }, ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa','syslinux','IBMJava2-JRE-1.4.1','conserver','fping']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; if ($::ITDAGENT eq "true") { #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.3'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core','csm.dsh','csm.server','csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.dsh','csm.server','csm.diagnostics','csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'}=['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=['perl-5*','nfs-utils-*','pdksh-*','dhcp-base-*','dhcp-server-*','rdist-6.1.5-524*','tcl-8*','tk-8*','expect-5.34-178*','xf86-*','freetype2-*','termcap-*','expat-*','perl-XML-Parser-*','perl-XML-DOM-*','perl-XML-RegExp-*','perl-HTML-Tagset-*','perl-HTML-Parser-*','perl-URI-*','perl-libwww-perl-*']; $os_prereqs{'MgdNode'}=['perl-5*','nfs-utils-*','pdksh-*','dhcp-base-*','dhcp-server-*','rdist-6.1.5-524*','tcl-8*','tk-8*','expect-5.34-178*','xf86-*','freetype2-*','rsh-server-*','telnet-server-*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; ############ Added for noneth0 support #################################### @::getmacs_Exec=('bin/grep','sbin/ifconfig','bin/sed','bin/sleep','bin/bash'); $::pkgdefs{getmacs_Exec}=[ @::getmacs_Exec ]; $::getmacs_Lib="/lib"; $::pkgdefs{getmacs_Lib}=$::getmacs_Lib; @::getmacs_ReqLibs=('/lib/ld-linux.so.2','/lib/libc.so.6','/lib/libdl.so.2','/lib/libreadline.so.4','/lib/libhistory.so.4','/lib/libncurses.so.5'); $::pkgdefs{getmacs_ReqLibs}=[ @::getmacs_ReqLibs ]; @::getmacs_DirStructure=("bin","etc","linuxrc","modules","proc","linuxrc.config","kbd","tmp","var","root","mounts","mnt","info"); $::pkgdefs{getmacs_DirStructure}=[ @::getmacs_DirStructure ]; ############ Added end #################################################### 1; # end '];  k~0PB7u%e@e@e@ %./opt/csm/install/pkgdefs/Linux-SuSE8.2.pm_64.p# @(#)25 1.13.1.1 src/csm/install/pkgdefs/Linux-SuSE8.2.pm.perl, setup, csm_rveg, rvegs001a 4/27/04 03:44:52 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # Package Definition File: SuSE 8.2 # # The following variables must be set before including this file: # $::mgmt_type = MgmtServer | MgdNode # $::csm_version = 1.2.0, 1.3.0, etc. package SuSE82; do "/opt/csm/install/pkgdefs/Linux.pm"; # Load base Linux definitions: #require "/opt/csm/install/pkgdefs/linux"; NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux-SuSE8.2.pm"); $::pkgdefs{DISTRO_NAME} = "SuSE Linux 8.2"; $::pkgdefs{DISTRO_DISKLIST} = "1 2 3 4"; # TO BE REMOVED $::pkgdefs{DISTRO_RPMDIR} = "suse"; # Distribution Disk descriptions used when prompting for the CD-ROMs # On stanza per CDROM: # num = the number on the CD-ROM's label # name = the text string describing the CD-ROM # diskid_filename = the filename to search for to identify the disk # (use shell wildcards if needed) # diskid_searchstring = the string to search for in diskid_filename # (use perl regular expressions if needed) @::distro_disks = ( { num => '1', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => 'media.1/products', #diskid_searchstring => '/ SuSE-Linux-.*-i386 8.2', diskid_searchargs => { file => 'media.1/products', key => '/ SuSE-Linux-.*-i386 8.2', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => '/', }, { num => '2', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => 'media.2/products', #diskid_searchstring => '/ SuSE-Linux-.*-i386 8.2', diskid_searchargs => { file => 'media.2/products', key => '/ SuSE-Linux-.*-i386 8.2', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => '/', }, { num => '3', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => 'media.3/products', #diskid_searchstring => '/ SuSE-Linux-.*-i386 8.2', diskid_searchargs => { file => 'media.3/products', key => '/ SuSE-Linux-.*-i386 8.2', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => '/', }, { num => '4', name => $::pkgdefs{DISTRO_NAME}, #diskid_filename => 'media.4/products', #diskid_searchstring => '/ SuSE-Linux-.*-i386 8.2', diskid_searchargs => { file => 'media.4/products', key => '/ SuSE-Linux-.*-i386 8.2', }, diskid_searchprog => \&Linux::linux_diskid_match_prog, diskid_target => '/', }, ); $::pkgdefs{distro_disks} = [ @::distro_disks ]; # Open Source Prereqs to Install my $opensrc_prereqs; $opensrc_prereqs{'MgmtServer'}{'1.3.3'} = ['tftp-hpa','syslinux','IBMJava2-JRE-1.4.1','conserver','fping']; $opensrc_prereqs{'MgdNode'}{'1.2.0'} = []; $opensrc_prereqs{'MgdNode'}{'1.3.0'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.1'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.2'} = ['autoupdate']; $opensrc_prereqs{'MgdNode'}{'1.3.3'} = ['autoupdate']; if ($::ITDAGENT eq "true") { #push (@{$opensrc_prereqs{'MgmtServer'}{'1.3.3'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.0'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.1'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.2'}}, 'ITDAgent'); #push (@{$opensrc_prereqs{'MgdNode'}{'1.3.3'}}, 'ITDAgent'); } $::pkgdefs{opensrc_prereqs} = $opensrc_prereqs{$::mgmt_type}{$::csm_version}; # RSCT Packages to Install my $rsct_packages; $rsct_packages{'MgmtServer'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $rsct_packages{'MgdNode'}{'1.2.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.0'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.1'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.2'} = ['src','rsct.core.utils','rsct.core','rsct.basic']; $rsct_packages{'MgdNode'}{'1.3.3'} = ['src','rsct.core.utils','rsct.core','rsct.basic','rsct.core.cimrm']; $::pkgdefs{rsct_packages} = $rsct_packages{$::mgmt_type}{$::csm_version}; # CSM Packages to Install my $csm_packages; $csm_packages{'MgmtServer'}{'1.3.3'} = ['csm.core','csm.dsh','csm.server','csm.diagnostics', 'csm.gui.dcem']; $csm_packages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_packages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.client','csm.diagnostics']; $csm_packages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.client','csm.diagnostics']; $::pkgdefs{csm_packages} = $csm_packages{$::mgmt_type}{$::csm_version}; # Director Packages to Install my $director_packages; $director_packages{'MgmtServer'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.2.0'}=[]; $director_packages{'MgdNode'}{'1.3.0'}=[]; $director_packages{'MgdNode'}{'1.3.1'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.2'} = ['csm.director.agent','csm.director.server']; $director_packages{'MgdNode'}{'1.3.3'} = ['csm.director.agent','csm.director.server']; $::pkgdefs{director_packages} = $director_packages{$::mgmt_type}{$::csm_version}; # Packages to uninstall my $rsct_unpackages; $rsct_unpackages{'MgmtServer'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $rsct_unpackages{'MgdNode'}{'1.2.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.0'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.1'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.2'}=['src','rsct.core.utils','rsct.core']; $rsct_unpackages{'MgdNode'}{'1.3.3'}=['src','rsct.core.utils','rsct.core','rsct.core.cimrm']; $::pkgdefs{rsct_unpackages} = $rsct_unpackages{$::mgmt_type}{$::csm_version}; my $csm_unpackages; $csm_unpackages{'MgmtServer'}{'1.3.3'} = ['csm.dsh','csm.server','csm.diagnostics','csm.gui.dcem']; $csm_unpackages{'MgdNode'}{'1.2.0'} = ['csm.core','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.0'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.1'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.2'} = ['csm.core','csm.diagnostics','csm.client']; $csm_unpackages{'MgdNode'}{'1.3.3'} = ['csm.core','csm.diagnostics','csm.client']; $::pkgdefs{csm_unpackages} = $csm_unpackages{$::mgmt_type}{$::csm_version}; # Directories to uninstall from the management server # This variable used to be named csmUnistallList_dir my $csm_uninstall_dirs; $csm_uninstall_dirs{'MgmtServer'}{'1.3.3'}=['/csminstall','/cfmroot']; $csm_uninstall_dirs{'MgdNode'}{'1.2.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.0'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.1'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.2'}=[]; $csm_uninstall_dirs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_uninstall_dirs} = $csm_uninstall_dirs{$::mgmt_type}{$::csm_version}; # Packages to NOT uninstall # This variable used to be named csmUnistallList_pack my $csm_nouninstall_pkgs; $csm_nouninstall_pkgs{'MgmtServer'}{'1.3.3'}=['csm.core']; $csm_nouninstall_pkgs{'MgdNode'}{'1.2.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.0'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.1'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.2'}=[]; $csm_nouninstall_pkgs{'MgdNode'}{'1.3.3'}=[]; $::pkgdefs{csm_nouninstall_pkgs} = $csm_nouninstall_pkgs{$::mgmt_type}{$::csm_version}; # Operating System pre-requisites # This variable used to be named Linux_os_prereqs # NOTE: These variable names have changed slightly. Now, both are merged # into os_prereqs, and there is a $::mgmt_type argument. The # Linux_client_os_prereqs array is gone. # Changes required in installms, copycsmpkgs and makenode my $os_prereqs; $os_prereqs{'MgmtServer'}=['perl-5*','nfs-utils-*','pdksh-*','dhcp-base-*','dhcp-server-*','rdist-6.1.5-591*','tcl-8*','tk-8*','expect-5.38-28*','xf86-*','freetype2-*','termcap-*','expat-*','perl-XML-Parser-*','perl-XML-DOM-*','perl-XML-RegExp-*','perl-HTML-Tagset-*','perl-HTML-Parser-*','perl-URI-*','perl-libwww-perl-*']; $os_prereqs{'MgdNode'}=['perl-5*','nfs-utils-*','pdksh-*','dhcp-base-*','dhcp-server-*','rdist-6.1.5-591*','tcl-8*','tk-8*','expect-5.38-28*','xf86-*','freetype2-*','rsh-server-*','telnet-server-*']; $::pkgdefs{os_prereqs} = $os_prereqs{$::mgmt_type}; 1; # end e kv0PB7u%c@c@c@ %./opt/csm/install/pkgdefs/Linux.pmE8.2.# @(#)60 1.14 src/csm/install/pkgdefs/Linux.pm.perl, setup, csm_rveg, rvegs001a 4/19/04 05:00:36 # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG package Linux; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgLoading', "/opt/csm/install/pkgdefs/Linux.pm"); %::pkgdefs = (); # CSM binaries copied to /csminstall/csm directory my $csm_bin_copy_csm; $csm_bin_copy_csm = [ '/opt/csm/csmbin/updatenode.client', '/opt/csm/csmbin/nodestatus.client', '/opt/csm/csmbin/write_status', '/opt/csm/msgmaps/csmInstall.csminstall.map', '/opt/csm/pm/MessageUtils.pm', '/opt/csm/pm/NodeUtils.pm', '/opt/csm/pm/ArchiveUtils.pm', '/opt/csm/pm/InstallUtils.pm', '/opt/csm/pm/InstallKRB5Utils.pm', '/opt/csm/msgmaps/csmKRB5p.csmKRB5p_msg.map', '/opt/csm/pm/NetworkUtils.pm', '/opt/csm/pm/ServerUtils.pm', '/opt/csm/pm/CSMDefs.pm', '/opt/csm/msgmaps/nodecmds.NodeUtils.map', '/opt/csm/csmbin/rmnode_client', '/opt/csm/bin/setupconsole', '/opt/csm/csmbin/makenode', '/opt/csm/csmbin/csmprereboot', '/opt/csm/csmbin/csmfirstboot', '/opt/csm/install/defs', '/opt/csm/install/pkgdefs' ]; $::pkgdefs{csm_bin_copy_csm} = $csm_bin_copy_csm; # CSM binaries copied to /tftpboot directory my $csm_bin_copy_tftpboot; $csm_bin_copy_tftpboot = ['/usr/lib/syslinux/pxelinux.0']; $::pkgdefs{csm_bin_copy_tftpboot} = $csm_bin_copy_tftpboot; # Default TFTP Server RPM Name my $default_tftp_server_pkg_name; $default_tftp_server_pkg_name = ['tftp-hpa-0.34-1']; $::pkgdefs{default_tftp_server_pkg_name} = $default_tftp_server_pkg_name; # CSM Log files ( used while uninstalling) my $logfiles; $logfiles{'MgmtServer'} = [ '/var/log/csm/csmsetupks.log*', '/var/log/csm/installnode.log*', '/var/log/csm/updatenode.log*', '/var/log/csm/installms.log*' ]; $logfiles{'MgdNode'} = ['/var/log/csm/install.log*', '/var/opt/csm/cfmlocal*']; $::pkgdefs{logfiles} = $logfiles{$::mgmt_type}; # default sub routine for matching linux distribution CD sub linux_diskid_match_prog{ my ($base_dir,$ref) = @_; my ($key,$file,$orig_dir); $file = $ref->{file}; $key = $ref->{key}; if(! -e "$base_dir/$file"){return 0;} NodeUtils->runcmd("$::GREP \"$key\" $base_dir/$file",-1); if($::RUNCMD_RC) {return 0;} return 1; } sub rhel3_diskid_match_prog{ my ($base_dir,$ref)=@_; my ($orig_dir,$cmd,$file,$num,$rpm,$arch); $file=$ref->{file}; $key =$ref->{key}; $num = $ref->{num}; $arch = $ref->{arch}; $rpm = $ref->{rpm}; if(! -e "$base_dir/$file") {return 0;} NodeUtils->runcmd("$::GREP \"$arch\" $base_dir/$file",-1); if($::RUNCMD_RC) {return 0;} NodeUtils->runcmd("$::GREP \"$key\" $base_dir/$file",-1); if($::RUNCMD_RC) {return 0;} $cmd = "$::HEAD -n 4 $base_dir/$file|$::TAIL -n 1|$::GREP \"$num\""; NodeUtils->runcmd($cmd,-1); if($::RUNCMD_RC) {return 0;} if($rpm ne ""){ NodeUtils->runcmd("$::LS $base_dir/$rpm",-1); if($::RUNCMD_RC) {return 0;} } return 1; } 1; # end sm_ k 0PB$7uŴ]A]A]A Ŵ./opt/csm/lib/libcsm_clog.anux.$ 44332 44452 96 96 0 44137 44332 0 1096669905 30007 1 755 5 shr.o` A]H0 9'|&RE.text9@o` .data'|;0}rX@.bss'|'|.loader ba|a;!```!``{aG@D88T8X8;aj8` H3%A{H|@AcH3-A`~;8a8cH35A8H8aPH3MAaPT<8B@|gp`H1|08|1|p9||2|(8`|9`hlapxa(8a48`aXa8ccHm,A8` 8!a}HccH!,Ax8`ccH8(a@L,,APA9^Dxaaha9~09`p!8P8aؓXAȑaБHaP} 8`8 ,8@89H+!A|fy@a@,@8}XH* A(8}XH*uA8`8!ແ}H88~8H(A8!໡}8`N 88~8H(aA8!໡}8` N AH88~8H(1Ac8%H888~ d8&Hua@,A8f88899.9`?9`09~9#/#/#/#/#/#/#/#/#/#/$/$/$/&& &$V&,&0V&8&<V&D&HV&P&TV&\&`V&h&lV&t&xV&&V&&V&&V&&V&&V&&V&&"&@&D&J& & &&F&&T&P&<&1'''' ''' '' &'$ '( ',('0'4'8'<'@$'D8'HH'L'PL'T'X'\'`>'d:'hN'lB'p6'tR'x   ( D _ w          $ 9 J a p  __mull1.__mull1malloc free _Errno strlen catopen catgets catclose  snprintf strdup   strerror    TOC&k_$STATIC&kJ&kcatgets&k&k&kw&k&k&ksnprintf&k(&k&k&kstrlen&k*&k'k_'k'k' k>'kI'kV'kD'kp' kj'$k'(k',k'0k'4k'8k'<ka'@kfree'Dkstrdup'Hk'Lk'Pk'Tk'Xk$'\kcatopen'`k_Errno'dkstrerror'hkcatclose'lkmalloc'pk'tk9'xk g.file+gk3 k p kl kC  \  ku k  k` k      k k0` kI k_4 ki  kz k k  h     ! # ,$ >&\ Q' a(D m) w* , -\ 9k _$STATICk#>%4I'|V'j& &&   &,  &8  &D  &P  &\  -&h  ?&t  R&  b&  clog_rec&  x&  &  &  .file3gCLOG_set.c_$STATIC$k*#4moveeq.s> g.bcopy5A).ovbcopy54._moveeq5 4.memcpy5 4.memmove5 4memset.sA g.memset9`)glink.sF g3k(3Bglink.sK g.catgets3k(.catgets3Gglink.sP g3k(3Lglink.sU g4k(4Qglink.sZ g4(k(4(Vglink.s_ g4Pk(4P[glink.sd g4xk(4x`glink.si g&4k(&4eglink.sn gC4k(C4jglink.ss gW5Dk(W5Doglink.sx g.strlen5lk(.strlen5ltglink.s} gm5k(m5yglink.s g}5k(}5~glink.s g5k(5glink.s g6 k(6 glink.s g64k(64glink.s g6\k(6\glink.s g6k(6glink.s g 6k( 6glink.s g6k(6glink.s g.6k(.6glink.s g>7$k(>7$glink.s gN7Lk(N7Lglink.s g.free7tk(.free7tglink.s g.strdup7k(.strdup7glink.s g^7k(^7glink.s gt7k(t7glink.s g8k(8glink.s g8<k(8<glink.s g8dk(8dglink.s g.catopen8k(.catopen8glink.s g._Errno8k(._Errno8glink.s g8k(8glink.s g9k(9glink.s g.malloc9,k(.malloc9,glink.s g9|k(9|glink.s g9k(9mc_end_session_1mc_start_session_2mc_enumerate_resources_bp_1mc_validate_rsrc_hndl_bp_1mc_define_resource_bp_1mc_invoke_action_bp_1mc_free_response_1cu_rel_errmsg_1cu_get_errmsg_1cu_rel_error_1cu_get_error_1cu_set_error_1cu_utf8_is_assumed_1cu_get_utf8_locale_1cu_catopen_1cu_rel_utf8_locale_1cu_get_node_id_1tr_record_fmt_string_1tr_record_id_1tr_unregister_component_1tr_register_component_1___memset.___memset___memmove.___memmovevsnprintfgettimeofdaysetlocalepthread_mutex_unlockpthread_mutex_initpthread_mutex_lockcu_mesgtbl_CLOG_set_lib_mutex_env_counter_lib_init_completedclog_trace_detail_levelsclog_trace_categories../../../../src/csm/clog/clog.cFri Oct 1 18:31:34 2004 C for AIX Compiler Version 5.0.1.0 --- ._logINFO_MSG._setAuditLogHandle._setOrCreateAuditLogTemplateInstance._AuditLogTemplateExists._createAuditLogInstance._stopRMCSession._startRMCSession._is_invalid_msg_type._is_invalid_env._decEnvCounter._incEnvCounter._finiCLOGLibrary._initCLOGLibrary._HandlesAreValid._unregister_with_ct_trace._register_with_ct_trace._recordInternalError._dumpEnv._clone_cu_error._cu_store_error.dumpLibraryError.recordID_f.clog_set_lpp_id.clog_set_component_id.clog_set_catalog_and_set.clog_set_message_set.clog_set_message_catalog.clog_is_enabled.clog_enable_msgs.clog_disable_msgs.clog_get_error.clog_rec_v.clog_rec.clog_set_error_log_info.clog_fini.clog_initFri Oct 1 18:31:29 2004 .tr_record_fmt_string_1.vsnprintf.gettimeofday.mc_invoke_action_bp_1.mc_free_response_1.snprintf.mc_enumerate_resources_bp_1.pthread_mutex_lock.pthread_mutex_unlock.cu_set_error_1.mc_define_resource_bp_1.mc_end_session_1.mc_start_session_2.mc_validate_rsrc_hndl_bp_1.tr_unregister_component_1.tr_register_component_1.cu_get_errmsg_1.cu_rel_errmsg_1.cu_rel_error_1.cu_get_error_1.tr_record_id_1.cu_utf8_is_assumed_1.setlocale.cu_get_utf8_locale_1.cu_catopen_1.cu_rel_utf8_locale_1.strerror.catclose.pthread_mutex_init.cu_get_node_id_130 44452 96 0 0 0 0 0 ` 1 96 shr.o1735 0 44332 0 0 0 0 0 ` T````````````````````````````````````````````````````````````````````````````````````._AuditLogTemplateExists._startRMCSession._decEnvCounter._incEnvCounter._finiCLOGLibrary._initCLOGLibrary.recordID_f.clog_set_lpp_id.clog_set_component_id.clog_set_catalog_and_set.clog_set_message_set.clog_set_message_catalog.clog_is_enabled.clog_enable_msgs.clog_disable_msgs.clog_get_error.clog_rec_v.clog_rec.clog_set_error_log_info.clog_fini.clog_init_lib_mutex_env_counter_lib_init_completedclog_trace_detail_levelsclog_trace_categoriesclog_set_lpp_idclog_set_component_idclog_set_catalog_and_setclog_set_message_setclog_set_message_catalogclog_is_enabledclog_enable_msgsclog_disable_msgsclog_get_errorclog_rec_vclog_recclog_set_error_log_infoclog_finiclog_initcu_mesgtbl_CLOG_set.bcopy.ovbcopy._moveeq.memcpy.memmove.memset.tr_record_fmt_string_1.catgets.vsnprintf.gettimeofday.mc_invoke_action_bp_1.mc_free_response_1.snprintf.mc_enumerate_resources_bp_1.pthread_mutex_lock.pthread_mutex_unlock.strlen.cu_set_error_1.mc_define_resource_bp_1.mc_end_session_1.mc_start_session_2.mc_validate_rsrc_hndl_bp_1.tr_unregister_component_1.tr_register_component_1.cu_get_errmsg_1.cu_rel_errmsg_1.cu_rel_error_1.cu_get_error_1.tr_record_id_1.free.strdup.cu_utf8_is_assumed_1.setlocale.cu_get_utf8_locale_1.cu_catopen_1.cu_rel_utf8_locale_1.catopen._Errno.strerror.catclose.malloc.pthread_mutex_init.cu_get_node_id_1 k0PB$7uWq@q@q@ W./opt/csm/man/man1/mgmtsvr.1ux.$mgmtsvr Command Purpose mgmtsvr - Displays or sets the management server entry for the Managed node. Syntax mgmtsvr [-h] [-k] [-v | -V] [-N] [-n hostname] [host | -d] Description The mgmtsvr command runs on Managed nodes to display or set the management server for the node. Parameters None. Flags -d Deletes the management server entry. -h Writes the command's usage statement to standard output. host Specifies the host name or IP address of the CSM management server that will be managing this node. If no host is specified, and the -d flag is not specified, the current setting will be displayed. In this case, the exit status can be examined to distinguish between nodes and the management server. -k Exchanges RSCT public keys, host name, and node identifier between the node and the management server. Only use this flag if the host name, node identifier, or public key of either machines has changed. At the time this flag is used, you must trust your network to ensure that a rogue machine is not going to insert its public key in place of the public key of the real node. -n hostname Specifies the host name known to the CSM management server for this node. Passing a node name to the updatenode command is normally only needed for diagnostic purposes. The updatenode command uses the -n flag to ensure correct operation when the hostname value on the node resolves to a different name than the name known to the management server. The default is /bin/hostname Before using the updatenode command with the -n flag, you must run chnode nodename AllowManageRequest=1. -N Displays the value for the local node name and management server. This flag is valid only if a host name or IP address for the management server is not specified. -v | -V Writes the command's verbose messages to standard output. Exit Status 0 This is a Managed node only and the management server value is set. 1 The combination of flags is not valid. 11 This is a Managed node only and the management server value is not set. 21 This node is its own management server. 22 This node is also a management server for a separate cluster. 23 This machine is a CSM management server and a node, but the node does not currently have a management server set for it. 31 This machine is a CSM management server only. 101 This machine is neither a CSM management server or node. Security The command requires root access to the cluster management server. Examples To query the current CSM management server for this node, enter: mgmtsvr Implementation Specifics This command is part of IBM Cluster Systems Management (CSM) software. Files /var/log/csm/install.log Location of the log output from the updatenode command. Location /opt/csm/bin/mgmtsvr Related Information * The updatenode command. * See the cluster security section in the IBM CSM for AIX 5L: Administration Guide for information on editing the RMC ACL file. k0~0PB$7u)r@)r@)r@ ./opt/csm/msgmaps/IBM.CLOG.Perl.map8.2.$EMsg_Missing_Clogger 1 2 '2653-975 Bad, missing, or unusable clogger command.' EMsgInternalError 2 2 '%1$s 2653-976 Internal error %2$s in CLOG.pm.' EMsgInvalidParamError 3 2 '2653-977 Invalid parameter %1$s.' EMsgMissingParamError 4 2 '2653-978 Missing parameter%1$s.' o kf0PB$7uEOAAA EO./opt/csm/msgmaps/csmInstall.csminstall.map64.p$IMsgRUN_CMD 1 3 'Executing the \"%1$s\" command.\n' IMsgCFMLogDate 2 3 'All CFM messages will be recorded in /var/log/csm/cfmerror.log under the entry dated: %1$s.\n' IMsgUpdateNodeUsage_old 3 3 '' IMsgMakeNodeExit 4 3 'MN_EX = %1$s\n' IMsgShow_Output 5 3 '%1$s\n' EMsgNO_RunCmd 6 3 '%1$s: 2653-021 Could not execute the \"%2$s\" command.\n' EMsgCANT_FIND 7 3 '%1$s: 2653-022 Could not find %2$s in %3$s.\n' EMsgDOESNT_EXIST 8 3 '%1$s: 2653-023 %2$s does not exist.\n' EMsgInstallError 9 3 '%1$s: 2653-025 An error occurred while installing CSM packages.\n' EMsgNO_MGMTSVR 10 3 '%1$s: 2653-026 An error occurred while attempting to execute the mgmtsvr command.\n' IMsgNODE_INSTALL_SUCCESS 11 3 'Node Install - Successful.\n' IMsgMakeNodeUsage 12 3 'Usage: makenode [-h] [-v | -V] [-f] [-k] [-t] -m management_server -n nodename\n -m management_server \n Hostname or IP address of the management server \n -n nodename \n Hostname that the CSM management server knows this node by. \n -f \n Force install \n -k \n Exchange RSCT public keys between the node and management server\n -t \n Test what would be installed but do not install. \n -v | -V \n Verbose mode \n -h \n Display this usage information. \n' EMsgMISSING_MS 13 3 '%1$s: 2653-027 Management server must be provided.\n' EMsgMISSING_Hostname 14 3 '%1$s: 2653-029 The node hostname must be provided.\n' EMsgCMD_FAILED_RC 15 3 '%1$s: 2653-030 The %2$s command failed with a return code of %3$s.\n' IMsgRPM_ALREADY_INSTALLED 16 3 '%1$s is already installed.\n' IMsgINSTALLING_RPM 17 3 'Installing %1$s .\n' IMsgSETTING_MS 18 3 'Setting Management Server to %1$s.\n' EMsgERROR_QUERYING 19 3 '%1$s: 2653-031 An error occurred while querying %2$s.\n' EMsgNO_MOUNT 20 3 '%1$s: 2653-032 Could not mount %2$s.\n' EMsgNO_UNMOUNT 21 3 '%1$s: 2653-033 Could not unmount %2$s.\n' EMsgNO_REMOVE 22 3 '%1$s: 2653-034 Could not remove %2$s from %3$s.\n' EMsgNO_FIND 23 3 '%1$s: 2653-035 Could not find %2$s.\n' EMsgNO_UPDATE 24 3 '%1$s: 2653-036 Could not update %2$s.\n' EMsgNO_INTERNAL_CALL 25 3 '%1$s: 2653-037 The internal call to %2$s was not successful.\n' EMsgNO_ScriptResource 26 3 '%1$s: 2653-039 Could not create NIM script resource.\n' EMsgDOES_NOT_EXIST 27 3 '%1$s: 2653-043 %2$s does not exist.\n' IMsgWRITING_LOGFILE 28 3 'Output log for %1$s is being written to %2$s.\n' IMsgSTART_LOGGING 29 3 '***********************************************\nLogging started %1$s.\n***********************************************\n' IMsgSTOP_LOGGING 30 3 '**********************************************\nLogging stopped %1$s.\n**********************************************\n' EMsgNO_RM 31 3 '%1$s: 2653-044 Could not remove %2$s.\n' EMsgCANT_WRITEtoFILE 32 3 '%1$s: 2653-045 Could not write to file %2$s.\n' EMsgNO_CORE 33 3 '%1$s: 2653-046 csm.core package is not installed. Please Install csm.core package first.\n' EMsgINVALID_OSTYPE 34 3 '%1$s: 2653-047 Invalid Operating System Type. Valid values are Linux or AIX.\n' IMsgCMD 35 3 'Running Command:\t%1$s.\n' EMsgCMD_FAILED 36 3 '%1$s: 2653-048 Command failed: %2$s. Error message: %3$s.\n' EMsgRUN_CMD_INVALID 37 3 '%1$s: 2653-049 Invalid argument to run_cmd subroutine: %2$s.\n' EMsgUNSUPPORTED_DISTRO 38 3 '%1$s: 2653-050 Linux distribution, %2$s, is not currently supported by CSM. Supported distributions are: %3$s.\n' IMsgDETECTED_DISTRO 39 3 'Detected Linux distribution %1$s.\n' IMsgCOPYING 40 3 'Copying %1$s.\n' IMsgCOPYING_RPMS 41 3 'About to copy CSM, RSCT and required RPMs.\n' IMsgCOPYING_INSTALLP 42 3 'About to copy CSM installp images.\n' IMsgCOPYING_OPENSRC_PREREQS 43 3 'About to copy open source prerequisites required by CSM.\n' IMsgCOPYING_CSMBINARIES 44 3 'About to copy CSM command binaries.\n' IMsgCOPYING_LINUX_RPMS 45 3 'About to copy Linux RPMs\n' IMsgSEARCHING_FOR_PREREQ 46 3 'Searching for %1$s in the pkg path.\n' IMsgINSERT_DISK 47 3 'Insert %1$s disk %2$s.\n' IMsgPRESS_ENTER 48 3 ' Press Enter to continue.\n' IMsgSEARCHING_FOR_PREREQ_ON_CD 49 3 'Searching for \"%1$s\" on the Linux distribution CD # \"%2$s\".\n' IMsgWAITING_FOR_ERRM 50 3 'Waiting for ERRM to start...\n' IMsgERRM_STARTED 51 3 'ERRM is started.\n' IMsgINSTALLING_RPMS 52 3 'Installing %1$s RPMs.\n' IMsgINSTALLING_INSTALLP_PACKAGES 53 3 'Installing %1$s installp packages.\n' EMsgNO_RPM 54 3 '%1$s: 2653-051 rpm command package is not installed. Please install rpm command package first to get the rpm command.\n' IMsgFOUND_RPM 55 3 'Found \"%1$s\" in \"%2$s\" .\n' IMsgFOUND 56 3 'Found rpm \"%1$s\", which is \"%2$s\" \"%3$s\". \n' EMsgVERSION_COMPARE_PROBLEM 57 3 '%1$s: 2653-052 Trouble comparing \"%2$s\". Eval message: \"%3$s\" \n' IMsgCOMPARING_VERSION 58 3 'Comparing versions \"%1$s\" and result is \"%2$s\".\n' IMsgINSTALLING_RPM_REQS 59 3 'Installing the following rpms required by \"%1$s\": \"%2$s\" \n' EMsgCANT_FIND_RPM 60 3 '%1$s: 2653-053 Cannot find a version of the \"%2$s\" rpm with the condition: \"%3$s\" \"%4$s\". (This is required by \"%5$s\"). \n' IMsgREQUIRE 61 3 'Rpm \"%1$s\" requires: \"%2$s\" \n' EMsgBAD_ATTR_VAL_FORM 62 3 '%1$s: 2653-054 Improper attribute=value form.\n' EMsgBAD_ATTR 63 3 '%1$s: 2653-055 Invalid attribute : \"%2$s\" \n' EMsgINVALID_ARGS_WITH_F_old 64 3 '' EMsgINVALID_ARGS_WITH_M 65 3 '%1$s: 2653-057 Cannot provide -c, -f, -H, -n or the HWControlPoint, HWControlNodeId or PowerMethod attributes with -M. \n' EMsgNEED_POWER_METHOD 66 3 '%1$s: 2653-058 PowerMethod attribute must be provided when using the -H flag.\n' EMsgNEED_CONSOLE_METHOD 67 3 '%1$s: 2653-059 ConsoleMethod attribute must be provided when using -C flag.\n' IMsgDEFAULT_ATTR_SET 68 3 'Attribute \"%1$s\" set to default: \"%2$s\".\n' EMsgCANT_GET_OSNAME 69 3 '%1$s: 2653-061 Cannot determine the operating system name on the Management Server.\n' EMsgCANT_GET_DISTROVERSION 70 3 '%1$s: 2653-062 Cannot determine the version of the distribution installed on the Management Server.\n' EMsgCANT_GET_DISTRONAME 71 3 '%1$s: 2653-063 Cannot determine the name of the distribution installed on the Management Server. Please set the InstallDistributionName attribute manually.\n' EMsgCANT_GET_PKGARCH 72 3 '%1$s: 2653-064 Cannot determine the architecture of the Management Server. Please set the InstallPkgArchitecture attribute manually.\n' EMsgCANT_GET_CSMVERSION 73 3 '%1$s: 2653-065 Cannot determine the CSM version installed on the Management Server.\n' IMsgNEW_NODES_TO_DEFINE 74 3 'New Nodes to define: \n' EMsgALREADY_DEFINED_MANAGEDNODES 75 3 '%1$s: 2653-066 The following nodes are already defined as ManagedNodes:\n \"%2$s\" \n' EMsgPORTNUM_IN_HEX 76 3 '%1$s: 2653-068 The starting console port number \"%2$s\" must be a hexidecimal digit. \n' IMsgASSIGNING_CONSOLE_PORT 77 3 'Assigning console \"%1$s\", num \"%2$s\", port \"%3$s\" to node \"%4$s\".\n' EMsgPORTS_IN_USE 78 3 '%1$s: 2653-069 The following requested ports\nfor console server \"%2$s\"\nare already assigned to existing nodes:\n%3$s\n' IMsgALL_PORTS_AVAILABLE 79 3 'All requested ports are available for console server \"%1$s\".\n' EMsgINSUFFICIENT_PORTS 80 3 '%1$s: 2653-070 \"%2$s\" nodes were specified, but only \"%3$s\" console ports are available.\n' EMsgINSUFFICIENT_SP 81 3 '%1$s: 2653-071 \"%2$s\" nodes were specified, but only \"%3$s\" service processors are available.\n' IMsgGETTING_ROUTE_TO_MS 82 3 'Determining network route from the node (\"%1$s\") to the management server.\n' EMsgCANT_RUN_CMD 83 3 '%1$s: 2653-072 Cannot run \"%2$s\".\n' IMsgEXISTING_MANAGEDNODES 84 3 'Existing Managed Nodes: \n' IMsgDEFINING_NODES 85 3 'Defining CSM Nodes: \n' IMsgDEFINING_NODE 86 3 'Defining Node \"%1$s\"(\"%2$s\")\n' EMsgFILE_NOT_FOUND 87 3 '%1$s: 2653-074 File not found: \"%2$s\".\n' IMsgREADING_NODEDEF 88 3 'Reading nodedef file: \"%1$s\".\n' EMsgNODEDEF_BAD_FORMAT 89 3 '%1$s: 2653-075 The nodedef file has an invalid format on line \"%2$s\".\n\tNo hostname for \"\"%3$s\"\"\n' EMsgNODEDEF_INVALID_ATTR 90 3 '%1$s: 2653-076 The nodedef file has an invalid attribute on line \"%2$s\":\n\t\"%3$s\". \n' EMsgERROR_IN_NODEDEF 91 3 '%1$s: 2653-077 Errors in nodedef file: \"%2$s\".\n' EMsgDUPLICATE_NODES 92 3 '%1$s: 2653-078 Nodes are already defined.\n' EMsgERROR_ASSIGNING_PORTS 93 3 '%1$s: 2653-080 Cannot assign console ports to nodes.\n' EMsgERROR_ASSIGNING_SP 94 3 '%1$s: 2653-081 Cannot assign service processors to nodes.\n' EMsgNO_NODES_DEFINED 95 3 '%1$s: 2653-082 No nodes were successfully defined.\n' EMsgERROR_INSTALLING_NODES 96 3 '%1$s: 2653-083 Nodes were successfully defined, but there was an error installing the nodes.\n' IMsgNOT_INSTALLED 97 3 'The RPM package %1$s is not yet installed.\n' EMsgNO_LIST 98 3 '%1$s: 2653-084 Could not get the list of install packages.\n' EMsgTEST_Error 99 3 '%1$s: 2653-085 An error occurred while checking CSM packages.\n' EMsgNO_FandT 100 3 '%1$s: 2653-086 The \"-f\" flag cannot be used with the \"-t\" flag.\n' IMsginstallmsUsage_old 101 3 '' IMsgdefinenodeUsage_old 102 3 '' EMsgUNSUPPORTED_AIX_DISTRO 103 3 '%1$s: 2653-087 AIX distribution, \"%2$s\", is not currently supported by CSM. Supported distributions are: \"%3$s\".\n' IMsgDETECTED_AIX_DISTRO 104 3 'Detected AIX distribution \"%1$s\".\n' EMsgUNSUPPORTED_CSM_DISTRO 105 3 '%1$s: 2653-088 CSM distribution, \"%2$s\", is not currently supported . Supported distributions are: \"%3$s\".\n' IMsgDETECTED_CSM_DISTRO 106 3 'Detected CSM distribution \"%1$s\".\n' EMsgIPADDR_ERROR 107 3 '%1$s: 2653-089 IP address (\"%2$s\") out of valid range.\n' IMsgMkgetmacUsage 108 3 'Usage: mkgetmacrd [-h]\n mkgetmacrd [-v | -V] \n \n -v | -V Verbose \n -h Display usage information \n\n' IMsgCREATE_GMRD 109 3 'Creating getmacs ramdisk. \n' IMsgGZIPPING 110 3 'Gzipping \"%1$s\" to \"%2$s\". \n' IMsgCDHCPUSAGE 111 3 'Usage: createdhcp [-h]\n createdhcp [-v | -V] [-a | -n node,node...][attr=value attr=value ...]\n -n Node List (comma-separated)(default will be premanaged nodes)\n attr=value attr={Netmask, Gateway, Nameserver[s]}\n -a Do all premanaged nodes\n' IMsgCDHCPNETMASKVAL 112 3 'Netmask = \"%1$s\".\n' IMsgCDHCPGATEWAYVAL 113 3 'Gateway = \"%1$s\".\n' IMsgCDHCPNAMESRVVAL 114 3 'Nameservers = \"%1$s\".\n' IMsgCDHCP_SUBNET 115 3 'Subnet = \"%1$s\".\n' IMsgNOT_FOUND_IN_HOSTS 116 3 'Node: \"%1$s\" was not found in /etc/hosts.\n' IMsgIP_NOT_ON_NET 117 3 '\"%1$s\" not on net \"%2$s\" / \"%3$s\"!\n' IMsgGETTING_IP_RANGE 118 3 'Now getting the range of IP addresses...\n' IMsgNODE_IP 119 3 'Node: \"%1$s\" IP: \"%2$s\" \n' IMsgCHK_IFACE 120 3 'Checking other active devices...\n' IMsgUpdateDHCP_USAGE 121 3 'updatedhcp [-v | -V][-h][-n node1, node2] \n' EMsgBAD_DHCP 122 3 '%1$s: 2653-090 The /etc/dhcpd.conf file does not look correct.\n The line: ### CSM STATIC ENTRIES in /etc/dhcpd.conf file could not be found.\n Please run \'createdhcp\' first and then \'updatedhcp\'.\n' EMsgNO_MAC_DEFINED 123 3 '%1$s: 2653-091 The MAC address for \"%2$s\" was not defined.\n' EMsgINVALID_INSTALL_METH 124 3 '%1$s: 2653-092 Node \"%2$s\" does not have a valid install method.\n The valid install methods are \"%3$s\".\n' EMsgPREREQ_NOT_FOUND 125 3 '%1$s: 2653-093 Could not find the following prerequisite RPMs: \"%2$s\".\n' EMsgERRM_NOT_STARTED 126 3 '%1$s: 2653-094 ERRM did not start - continuing with the installation of CSM anyway.\n' EMsgDIFFERENT_ATTR 127 3 '%1$s: 2653-095 All nodes must have the same value for the %2$s attribute.\n' EMsgNO_ATTR 128 3 '%1$s: 2653-096 The %2$s attribute is not set for any of the nodes.\n' EMsgINVALID_MODE 129 3 '%1$s: 2653-097 Invalid value for Mode attribute: %2$s. Valid Mode attributes are %3$s.\n' EMsgNO_MAC 130 3 '%1$s: 2653-098 Could not get Mac address for %2$s.\n' IMsgGETMACS_USAGE 131 3 'Usage: getmacs [-v | -V][-h][-f file][-d][-O][node list] \n -h Display usage information.\n -v | -V Verbose mode.\n -d Do not write data to CSM Database.\n -O Power off nodes when complete.\n -f Read nodes from a file.\n node list The list of nodes separated by spaces.\n\n' IMsgREBOOTING_NODE 132 3 'Rebooting %1$s\n' EMsgNODE_DID_NOT_REBOOT 133 3 '%1$s: 2653-100 Node: %2$s failed to reboot.\n' EMsgNO_NODES 134 3 '%1$s: 2653-101 There are no valid nodes given.\n' EMsgNODE_DID_NOT_POWER_OFF 135 3 '%1$s: 2653-102 Node: %2$s failed to power off.\n' EMsgNO_FILECOPY 136 3 '%1$s: 2653-105 An error occurred when copying files to %2$s.\n' EMsgCANT_OPEN 137 3 '%1$s: 2653-106 Could not open \"%2$s\".\n' IMsgSETUP_CSM_USAGE_old 138 3 '' EMsgAIX_ONLY 139 3 '%1$s: 2653-107 This command may only be run on AIX systems.\n' EMsgCANT_OPEN_FOR_CONSOLE 140 3 '%1$s: 2653-108 Cannot open \"%2$s\" to add remote console lines.\n' IMsgADDING_LINE 141 3 'Adding line to %1$s: %2$s\n' IMsgREMOVING_LINE 142 3 'Removing line from %1$s: %2$s' EMsgERROR_RUNNING_COMMAND 143 3 '%1$s: 2653-109 An error occurred when attempting to execute %2$s.\n' IMsgCheckingAtftp 144 3 '' IMsgfoundAtftp 145 3 '' IMsgAtftpRunning 146 3 '' IMsgAtftpNotUp 147 3 '' IMsgAtftpTryStart 148 3 '' IMsgAtftpNowRunning 149 3 '' IMsgAtftpCantUp 150 3 '' IMsgAtftpXinetdExistquest 151 3 '' IMsgAtftpXinetdExist 152 3 '' IMsgAtftpUrProblem 153 3 '' IMsgAtftpProblemHand 154 3 '' IMsgAtftpNotFound 155 3 '' IMsgDhcpCheck 156 3 'Checking to see that dhcp is up and running...\n' IMsgDhcpMissing 157 3 'Missing /var/lib/dhcp/dhcpd.leases\n' IMsgDhcpOutput 158 3 'dhcp : output... %1$s \n' IMsgDhcpProblemRestart 159 3 'There is a problem with the dhcp server.\nTrying to restart dhcp server...\n' IMsgDhcpNotWorking 160 3 'The dhcp server could not be started.\n' IMsginstallnodeUsage_old 161 3 '' EMsgINSTALLNODE_NO_TARGET 162 3 '%1$s: 2653-110 There is no target for the installnode command. Please specify a target with the -a, -P, -N or hostname positional arguments. \n' IMsgNODES_ALREADY_INSTALLED 163 3 '%1$s nodes already installed. \n' IMsgNODE_STATUS 164 3 'Node %1$s : %1$s. \n' EMsgINVALID_INSTALL_METHOD 165 3 '%1$s: 2653-111 The following nodes have an unsupported InstallMethod: \"%2$s\". \n' IMsgADD_TFTPBOOT_TO_EXPORTS 166 3 'Adding /tftpboot to /etc/exports.\n' IMsgREMOVE_TFTPBOOT_FROM_EXPORTS 167 3 'Removing /tftpboot from /etc/exports.\n' IMsgSTARTING_SERVICES 168 3 'Starting Services .\n' IMsgSTARTING_SERVICE 169 3 '%1$s is not running. Starting service.\n' EMsgERROR_STARTING_SERVICE 170 3 '%1$s: 2653-112 Error starting \"%2$s\" service. \n' EMsgModeSetErrMsg 171 3 '%1$s: 2653-113 Mode can only be set to PreManaged, Installing or Managed\n' IMsgCSM_FANOUT 172 3 'CSM_FANOUT = %1$s, CSM_FANOUT_DELAY = %2$s .\n' IMsgREBOOTING_NODE_FULL_INSTALL 173 3 'Rebooting Node for full install: %1$s\n' IMsgREBOOT_INITIATED 174 3 'Rebooting and Installing Node. \n' IMsgSLEEPING 175 3 'Sleeping for %1$s seconds (CSM_FANOUT_DELAY=%2$s).\n' IMsgCANT_DSH_NODE 176 3 'Cannot run dsh on node \"%1$s\" \n' EMsgNOT_INSTALLING_NODE 177 3 '%1$s: 2653-115 Not installing node %2$s.\n' EMsgSETUPKS_ERROR 178 3 '%1$s: 2653-116 Error running csmsetupks. \n' IMsgINSTALLING_FULLINSTALL_NODES 179 3 'Performing Full Install on Nodes: %1$s\n' EMsgSETUP_PXELINUX_ERROR 180 3 '%1$s: 2653-117 Error setting up /tftpboot/pxelinux.pxe files. \n' EMsgCANT_CHMOD 181 3 '%1$s: 2653-118 Cannot change the mode of \"%2$s\" to \"%3$s\". \n' EMsgCANT_CREATE 182 3 '%1$s: 2653-119 Cannot create file \"%2$s\". \n' IMsgSETTING_PXELINUX_TO_INSTALL 183 3 'Setting pxelinux to INSTALL for %1$s .\n' EMsgCANT_COPY 184 3 '%1$s: 2653-120 Cannot copy %2$s to %3$s. \n' IMsgVERIFYING_SETUPKS 185 3 'Verifying that csmsetupks was run properly.\n' IMsgNO_NODES 186 3 'There are no nodes to verify . %1$s \n' IMsgFILE_EXISTS 187 3 'File %1$s is in place. \n' EMsgDHCP_NOT_DEFINED 188 3 '%1$s: 2653-121 Node: \"%2$s\" is not statically defined in \"%3$s\".\n' IMsgDHCP_DEFINED 189 3 'Node %1$s is defined in \"%2$s\". \n' EMsgNODES_MISSING_FILES 190 3 '%1$s: 2653-122 The following nodes had missing files:\n \t\"%2$s\".\n' IMsgVERIFY_SETUPKS_OK 191 3 'It looks like csmsetupks ran okay. \n' EMsgNOT_COPIED 192 3 '%1$s: 2653-123 \"%2$s\" was not copied to /csminstall by installms or copycsmpkgs.\n' IMsgPREINSTALL_STATUS 193 3 'Status of nodes before the install: \n' IMsgPrint_Msg 194 3 ' %1$s \n' IMsgNODES_TO_INSTALL 195 3 'Nodes to install:\n %1$s\n' IMsgPOSTINSTALL_STATUS 196 3 'Status of nodes after the install: \n' EMsgMISSING_CSMINSTALL_FILES 197 3 '%1$s: 2653-124 Files are missing from /csminstall/csm.\n' EMsgCANT_START_TFTP 198 3 '' EMsgCANT_START_DHCP 199 3 '%1$s: 2653-126 Cannot start dhcp daemon.\n' EMsgBADNODES 200 3 '%1$s: 2653-127 The following nodes had a problem installing:\n\t%2$s\n' EMsgINIT_STATUS_ERROR 201 3 '%1$s: 2653-128 Error initializing the status directory or status file.\n' IMsgUNINSTALLING_TFTP 202 3 '' IMsgINSTALLING_ATFTP_RETRY 203 3 '' IMsgmonitorinstallUsage 204 3 '' EMsgNoNodeDefined_error 205 3 '%1$s: 2653-129 No node defined. Error in program.\n' IMsgNode_status 206 3 'Node status: %1$s.\n' IMsgFULL_INSTALL_INITATED 207 3 'Full Install Initiated.\n' IMsgINSTALLNODE_VERIFY_ALL_FLAG 208 3 'WARNING: The -a flag will cause all the nodes in your cluster to be installed. Nodes that are already installed will be reinstalled.\n\nIf you want to install all the nodes in your cluster, press "y" to continue. Otherwise press Enter to quit.\n' IMsgINSTALLNODE_NOT_INSTALLING 209 3 'No nodes will be installed.\n' IMsgADDNODE_DEPRECATED 210 3 'The addnode command is deprecated. Please run "definenode -U" instead.\n' EMsgXINETD_MISSING 211 3 '%1$s: 2653-137 The %2$s directory is missing. This probably means\nthat xinetd is not installed.\n' EMsgBadCFMoption 212 3 '%1$s: 2653-130 Invalid cfmoption: %2$s\n' EMsgBadSMSoption 213 3 '%1$s: 2653-060 Invalid smsoption: %2$s\n' IMsgCHANGING_TFTP_XINETD_FILE 214 3 '' IMsgcheckrpmprereqsUsage 215 3 'Usage: checkrpmprereqs [-p ] [-v | -V] [-h] \n -p Package name for which the open source rpm need \n to be verified.\n -v | -V Verbose mode\n -h Display usage information\n' EMsgRpmNotInstalled 216 3 '%1$s: 2653-131 %2$s prerequisite : %3$s is not installed .\n' EMsgNoConsoleMethod 217 3 '%1$s: 2653-132 No Console Methods are defined in the system. At least one Console Method should be defined in /opt/csm/bin/*_console. \n' EMsgNoPowerMethod 218 3 '%1$s: 2653-133 No Power Methods are defined in the system. At least one Power Method should be defined in /opt/local/*_power or /opt/csm/lib directory.\n' EMsgNoValidConsoleMethod 219 3 '%1$s: 2653-134 : %2$s is not a valid ConsoleMethod. The valid console methods are %3$s .\n' EMsgNoValidPowerMethod 220 3 '%1$s: 2653-135 : %2$s is not a valid PowerMethod. The valid power methods are %3$s .\n' EMsgNoConfigInfo 221 3 '%1$s: 2653-136 Required attribute values were not found in the configuration information file for node %2$s.\n' EMsgCommandFailed 222 3 '%1$s: 2653-140 Error: Command %2$s failed with return code %3$s.\n' EMsgCANT_WRITE_FILE 223 3 '%1$s: 2653-141 Cannot open file %2$s for writing.\n' EMsgCANT_READ_FILE 224 3 '%1$s: 2653-142 Cannot open file %2$s for reading.\n' EMsgNO_TARGET 225 3 '%1$s: 2653-143 There is no target for this command. Please specify a target with the -a, -P, -M, -N, or hostname positional arguments.\n' EMsgCANT_RUN 226 3 '%1$s: 2653-144 Error running command %2$s. Reported %3$s. \n' EMsgSEMAPHORE_ERROR 227 3 '%1$s: 2653-146 Error: Cannot open file \"%2$s\" to lock. Reported %3$s.\n' EMsgLOCK_ERROR 228 3 '%1$s: 2653-147 Error: Another execution of %2$s may be running. Cannot place lock on file \"%3$s\": %4$s. \n' IMsgGet_Lock 229 3 'Getting lock on file %1$s for this execution of %2$s.\n' EMsgCFM_and_P 230 3 '%1$s: 2653-148 Error: CFM or SMS cannot be run to nodes whose Mode is PreManaged.\n' EMsgBad_Setup 231 3 '%1$s: 2653-149 An error occurred when setting up CSM installation and configuration files.\n' EMsgNO_NFS 232 3 '%1$s: 2653-150 An error occurred when attempting to start NFS.\n' EMsgNO_EXPORT 233 3 '%1$s: 2653-151 An error occurred when attempting to export /csminstall.\n' EMsgNO_DSH 234 3 '%1$s: 2653-152 An error occurred when attempting to execute DSH.\n' EMsgNO_ConfigFile 235 3 '%1$s: 2653-153 Could not create configuration information files.\n' EMsgNO_NodemapFile 236 3 '%1$s: 2653-154 Could not create node name mapping file.\n' EMsgNO_UpdateClient 237 3 '%1$s: 2653-155 Could not find updatenode.client script.\n' EMsgNO_AKB_Hostname 238 3 '%1$s: 2653-156 Could not get hostname as known by the management server.\n' EMsgNO_Attr_Values 239 3 '%1$s: 2653-157 Could not get node attribute values from the node config_info file.\n' EMsgNO_CreateDir 240 3 '%1$s: 2653-158 Could not create the %2$s directory.\n' EMsgNO_CopyFile 241 3 '%1$s: 2653-159 Could not copy the %2$s file to %3$s.\n' EMsgNodesNotDefined 242 3 '%1$s: 2653-160 The following nodes are not defined: %2$s .\n' IMsgcsmsetupksnodeUsage_old 243 3 '' EMsgBAD_ARGS_X_P 244 3 '%1$s: 2653-161 Cannot use -x with -p option.\n' EMsgEth0NotUp 245 3 '%1$s: 2653-162 eth0 not up and running on Management Server.\n' EMsgSETUPKS_NO_TARGET 246 3 '%1$s: 2653-163 There is no target for the csmsetupks command. Please specify a target with the -a, -P, -N or -n flags.\n' IMsgCOPYING_SRC_DST 247 3 'Copying %1$s to %2$s.\n' EMsgNO_FILECOPY_RC 248 3 '%1$s: 2653-164 Cannot copy %2$s to %3$s. %4$s.\n' IMsgCOPYING_RPMS_OS 249 3 'Copying %1$s Images from %2$s.\n' EMsgNOT_COPYING_LINUX_RPMS 250 3 '%1$s: 2653-165 Skipping %2$s. This directory does not look like it contains the contents of a %3$s CD-ROM".\n' EMsgNOTHING_COPIED 251 3 '%1$s: 2653-166 None of the directories had anything to copy (PKGPATH= %2$s).\n' IMsgSETUP_MAC_COLLECTION 252 3 'Setting up MAC Address Collection.\n' IMsgCREATING_GETMAC_RAMDISK 253 3 'Creating the Ramdisk for MAC Address Collection.\n' IMsgCOLLECTING_MACS 254 3 'Collecting MAC Addresses for nodes %1$s\n' IMsgRUNNING_GETMACS 255 3 'Running getmacs for nodes %1$s\n' IMsgGETTING_MACS_VIA_DSH 256 3 'Attempting to use dsh to collect MAC addresses.\n' IMsgFOUND_MACADDR 257 3 'Found MAC Address for node %1$s : %2$s.\n' IMsgSETUP_KICKSTART 258 3 'Setting up Kickstart.\n' IMsgSETUP_PXE 259 3 'Setting up PXE.\n' IMsgCREATING_KS_FILE 260 3 'Creating Kickstart Configuration File %1$s.\n' IMsgCREATING_FIRSTBOOT_FILE 261 3 'Creating Firstboot Script %1$s.\n' IMsgGENERATING_DHCP 262 3 'Generating /etc/dhcpd.conf file for MAC address collection.\n' IMsgUPDATING_DHCP 263 3 'Adding nodes to /etc/dhcpd.conf file for Kickstart install: %1$s.\n' EMsgERROR_COPYING_RPMS 264 3 '%1$s: 2653-167 Error while copying the %2$s Images.\n' EMsgCANT_SETUP_PXE 265 3 '%1$s: 2653-168 Error setting up PXE.\n' EMsgGETMACS_ERROR 266 3 '%1$s: 2653-169 Error getting MAC addresses.\n' EMsgSETUPKS_ERROR_KS 267 3 '%1$s: 2653-170 Error setting up Kickstart configuration file.\n' EMsgUPDATEDHCP_ERROR 268 3 '%1$s: 2653-171 Error running updatedhcp.\n' EMsgSET_INSTALLMETHOD_ERROR 269 3 '%1$s: 2653-172 Error setting InstallMethod attribute to "kickstart".\n' EMsgNO_DHCP_ENTRY 270 3 '%1$s: 2653-173 The IP address of node %2$s is not found in the /etc/dhcpd.conf file.\n' IMsgNodeNodesCategory 271 3 'There aren\'t any nodes in that category to be displayed\n' IMsgNodeDisplay 272 3 'Node %1$s \n' IMsgNoStatusFile 273 3 'No status file. \n\n\n' IMsgPrintWarning 274 3 'Warnings: \n' IMsgGettingEspPortNumber 275 3 'Getting esp port number.\n' IMsgPrintNodeAndNodeAttrs 276 3 '%1$s : %2$s \t= %3$s\n' IMsgPrintHostNameMgmtServer 277 3 '%1$s : ManagementServer \t= %2$s\n' IMsgPrintNewFormatOutput 278 3 '\n %1$s :\n' EMsgNoNodesProvided 279 3 '%1$s: 2653-175 No nodes provided.\n' EMsgKill 280 3 '%1$s: 2653-176 The program was terminated by the user.\n' EMsgAssignAttrToMultNodes 281 3 '%1$s: 2653-177 Cannot assign the same %2$s to more than one node.\n' EMsgINVALID_ARGS_WITH_C 282 3 '%1$s: 2653-178 Cannot provide ConsolePortNum, ConsoleServerNumber or ConsoleServerName attributes with -C.\n' EMsgINVALID_ARGS_WITH_H 283 3 '%1$s: 2653-179 Cannot provide HWControlPoint attribute with -H.\n' IMsgrmnodeClientNodeUsage 284 3 'Usage: rmnode.client [-v | -V] [-h] \n -v | -V Verbose mode\n -h Display usage information\n' EMsgCannotDelete 285 3 '%1$s: 2653-180 Cannot delete directory or file %2$s.\n' EMsgRemoveRpm 286 3 '%1$s: 2653-181 Cannot erase rpm package %2$s.\n' EMsgRemoveInstallpImg 287 3 '%1$s: 2653-182 Cannot uninstall installp package %2$s.\n' IMsgUninstallingCsm 288 3 'Uninstalling CSM ...\n' IMsgREADING_HOSTNAME_MAP 289 3 'Reading hostname map file: \"%1$s\".\n' EMsgHOSTMAP_NO_HOSTNAME 290 3 '%1$s: 2653-183 The hostname map file has no hostname on line %2$s. This node will not be defined.\n' EMsgERROR_IN_HOSTNAME_MAP 291 3 '%1$s: 2653-184 Errors in hostname map file: \"%2$s\".\n' IMsgcopycsmpkgsUsage_old 292 3 '' EMsgNO_CORE_COPY 293 3 '%1$s: 2653-185 Could not get the CSM version from the system. Please supply the valid CSM version attribute value or please install csm.core package first .\n' IMsgVALID_ATTRS 294 3 'Valid attributes are:\n\t%1$s\n' EMsgSkipToValidHeader 295 3 '%1$s: 2653-188 Skipping to the next valid header.\n' EMsgNoMultStanzas 296 3 '%1$s: 2653-189 Node \"%2$s\" appears in multiple stanzas. It will not be defined.\n' IMsguninstallmsUsage 297 3 'Usage: uninstallms [-v | -V] [-h] [-u] [-f] \n -u Removes and cleans up nodes before uninstalling \n the management server.\n (Issues rmnode -u before uninstalling.)\n -f Force. Uninstalls Management Server without prompting\n -v | -V Verbose mode\n -h Display usage information\n' EMsgCannotRemoveNodegrpMembers 298 3 '%1$s: 2653-191 Cannot remove the members of the nodegroup.\n' EMsgCannotRemoveNodegrp 299 3 '%1$s: 2653-192 Cannot remove nodegroup from the system.\n' IMsgCSM2NIMGRPS_USAGE_old 300 3 '' EMsgNO_AandN 301 3 '%1$s: 2653-193 Cannot use the -a flag together with the -N flag.\n' EMsgAIX_MS_ONLY 302 3 '%1$s: 2653-194 This command may only be run on an AIX management server.\n' EMsgAorN_REQ 303 3 '%1$s: 2653-195 Either the -a or -N flag must be specified.\n' EMsgINV_FORMAT 304 3 '%1$s: 2653-196 An invalid format was used on the command line.\n' EMsgNO_NIM_GROUPS 305 3 '%1$s: 2653-197 Could not get list of NIM groups.\n' EMsgINV_GRP_NAME 306 3 '%1$s: 2653-198 An invalid group name (%2$s) was provided on the command line.\n' IMsgHAS_NO_MEMB 307 3 'Group %1$s has no members. Skipping to the next group.\n' IMsgALREADY_NIM_GROUP 308 3 'NIM group %1$s already exist. Skipping to the next group.\n' IMsgCSM2NIMNODES_USAGE_old 309 3 '' EMsgBAD_ARGS 310 3 '%1$s: 2653-199 Incorrect arguments were used when calling this command.\n' EMsgRINGorCABLE_REQ 311 3 '%1$s: 2653-200 Either the \"cable_type\" or \"ring_speed\" must be provided.\n' EMsgCSM2NIMNODES_NO_TARGET 312 3 '%1$s: 2653-201 There is no target for the csm2nimnodes command. \nPlease specify a target with the -a, -n or -N arguments.\n' EMsgINVALID_OPT 313 3 '%1$s: 2653-202 An invalid value was specified for the \"%2$s\" attribute.\n' EMsgVALUE_MISSING 314 3 '%1$s: 2653-203 The value of the \"%2$s\" attribute for node \"%3$s\" is missing.\nSkipping to the next node.\n' EMsgNO_LINUX 315 3 '%1$s: 2653-042 Linux nodes are not valid when using this command.\nSkipping \"%2$s\".\n' IMsgNIM_MACH_CREATE 316 3 'Created the \"%1$s\" NIM machine definition.\n' IMsgNIM_MACH_UPDATE 317 3 'Updated the \"%1$s\" NIM machine definition.\n' IMsgNIM_NO_UPDATE 318 3 'Did not update the NIM machine definition for \"%1$s\". \nSkipping to the next node.\n' EMsgNO_NIM_CLIENTS 319 3 '%1$s: 2653-204 Could not get list of NIM clients.\n' IMsgDidnotRemoveDir 320 3 'Did not remove the directories or files %1$s.\n' IMsgDidnotRemovePkgs 321 3 'Did not Remove the Packages %1$s.\n' EMsgDSHCannotConnect 322 3 '%1$s: 2653-206 dsh, using protocol %2$s, cannot connect to nodes: %3$s.\n' IMsgPasswd_old 323 3 '' IMsgCopySSHKeys 324 3 'Copying OpenSSH public keys to target nodes.\n' IMsgGatherSSHserverKeys 325 3 'Gathering nodes OpenSSH server keys and placing in /root/.ssh/known_hosts[2] files.\n' EMsgRemoteShellSetupFailed 326 3 '%1$s: 2653-207 Remote Shell setup failed on node(s) %2$s.\n' EMsgRemoteShellSetupFailed_MS 327 3 '%1$s: 2653-208 Remote Shell setup failed on the management server. The install of the nodes will continue anyway.\n' IMsgNoSetupRemoteProtocol 328 3 'The setup of Remote Shell %1$s cannot be automated through this tool.\n' IMsgremoteshellexpectUsage 329 3 'Usage: remoteshell.expect [-t remote_shell hostname] [-k] [-n hostname] \n [-s node_list] [-rA managment_server node_list] [-rL management_server node_list] [-rS management_server node_list] \n.' EMsgWrongHomePermissions 330 3 '%1$s: 2653-209 Directory %2$s has invalid permissions for Remote Shell Setup. Please ensure the write bits for both group and other are turned off.\n' IMsgDidnotUninstallOpenSrcPkgs 331 3 'Did not uninstall the Open Source prerequisites.\n' IMsgDidnotUnconfigureRemoteShellServer 332 3 'The remote shell (SSH or RSH) have not been unconfigured on the Management Server. To ensure security, you should unconfigure the remote shell on the server manually.\n' IMsgDidnotUnconfigureRemoteShellNode 333 3 'The remote shell (SSH or RSH) have not been unconfigured on the Managed Nodes. To ensure security, you should unconfigure the remote shell on the nodes manually.\n' EMsgNoArch 334 3 '%1$s: 2653-210 InstallPkgArchitecture attribute must be provided.\n' EMsgNoDistributionName 335 3 '%1$s: 2653-211 InstallDistributionName attribute must be provided.\n' EMsgNoDistributionVersion 336 3 '%1$s: 2653-212 InstallDistributionVersion attribute must be provided.\n' EMsgNo_Dir_Export 337 3 '%1$s: 2653-024 The directory %2$s , to be exported, does not exist. please check for the directory existence.\n' EMsgNo_Directory 338 3 '%1$s: 2653-028 %2$s directory need to be created. But a file exits with the same name. Move the file to another name and rerun the command.\n' EMsgNoSetupRA_old 339 3 '' EMsgUnsupportedOS 340 3 '%1$s: 2653-040 Node %2$s has a unsupported value for InstallOSName attribute: %3$s\n' IMsgUNINSTALLMS_VERIFY 341 3 'WARNING: The command will remove all the nodes, nodegroups and uninstall Management Server.\nIf you want to continue , press "y". Otherwise press Enter to quit.\n' IMsgUNINSTALLMS_VERIFY_U 342 3 'WARNING: The command will clean the nodes and remove all the nodes, nodegroups and uninstall Management Server.\nIf you want to continue , press "y". Otherwise press Enter to quit.\n' IMsgUNINSTALLMS_NOT_UNINSTALLING_old 343 3 '' IMsgGPL_LICENSE 344 3 '\nCSM requires the Freeware Package syslinux to be installed. \nFreeware Packages are provided "AS IS" and are not warranted or \nsupported by IBM. IBM disclaims all liability for any damages \n(including without limitation direct and indirect damages) arising in \nconnection with these Freeware Packages. Freeware Packages are \nlicensed under the terms of the GPL, a copy of which is included in \neach Freeware Package. For more information about the license terms \nand source availability of these Freeware Packages, see \nhttp://www.linux.org/info/gnu.html and http://freshmeat.net/projects/syslinux, \n\n' IMsgPRESS_ENTER_TO_INSTALL 345 3 'Press enter to install syslinux and CSM, or any other character to quit:\n' IMsgCSM_NOT_INSTALLING 346 3 'CSM will not be installed.\n' IMsgINSTALLING_DIRECTOR 347 3 'Installing the IBM Director Agent and Linux Cluster Support Extension.\n' EMsgLINUX_ONLY_FLAG 348 3 '%1$s: 2653-213 The %1$s flag can only be used on a Linux machine.\n' EMsgHostnameMap 349 3 '%1$s: 2653-041 The hostname command returns %2$s on the following nodes: %3$s. Operations will not be completed on these nodes. Please make sure each node has a unique hostname.\n' EMsgNoAutoupdate 350 3 '%1$s: 2653-073 The Autoupdate RPM is missing from %2$s. This means that Autoupdate is probably not installed on the nodes. Please download the Autoupdate RPM from %3$s and place it in %4$s.\n' IMsgMissingRPM 351 3 'The %1$s RPM is missing. This may prevent the use of some CSM funtionality. Please consult the Install Guide for information on where to get this RPM.\n' EMsgAutoupdateNotInstalled 352 3 '%1$s: 2653-079 Autoupdate is not installed. Software Maintenance cannot be performed on this node.\n' IMsgINSTALLMS_SUCCESSFUL 353 3 'Installation of CSM has successfully completed!\n' EMsgINSTALLMS_UNSUCCESSFUL 354 3 '%1$s: 2653-214 Installation of CSM was unsuccessful (rc = %2$s).\n' EMsgINETD_MISSING 355 3 '%1$s: 2653-301 The %2$s file is missing. This probably means\nthat inetd is not installed.\n' EMsgSETUPSIS_ERROR 356 3 '%1$s: 2653-302 Error running csmsetupsis. \n' IMsgVERIFYING_SETUPSIS 357 3 'Verifying that csmsetupsis was run properly.\n' IMsgVERIFYING_SETUPSIS_OK 358 3 'It looks like csmsetupsis ran okay. \n' EMsgSETUPSIS_NO_TARGET 359 3 '%1$s: 2653-303 There is no target for the csmsetupsis command. Please specify a target with the -a, -P, -N or -n flags.\n' IMsgSETUP_SIS 360 3 'Setting up SIS.\n' IMsgCREATING_SIS_FILE 361 3 'Creating SIS Configuration File %1$s.\n' EMsgSETUPSIS_ERROR_SIS 362 3 '%1$s: 2653-304 Error setting up SIS configuration file.\n' IMsgCOPYING_SISRPMS 363 3 'About to copy SIS RPMs.\n' IMsgUPDATING_DHCP_SIS 364 3 'Adding nodes to /etc/dhcpd.conf file for SIS install: %1$s.\n' EMsgBAD_ARGS_A_I 365 3 '%1$s: 2653-305 Cannot use -A with -I option.\n' EMsgBAD_ARGS_A_I_2 366 3 '%1$s: 2653-306 Must specify either -A or -I option.\n' IMsgcsmsetupsisnodeUsage 367 3 'Usage: csmsetupsis [-h]\n csmsetupsis [-v | -V] [-p pkg_path | -x]\n [-P | -a | [-N nodegroups] [-n node_list]]\n [ -A | -I ] image_name\n [Attr=value [Attr=value...]]\n -a Setup SIS for all nodes. This cannot be used with\n the -n, -N or -P flags.\n -A Build a new image. This cannot be used with the -I flag.\n -h Writes usage information to standard output\n -I Using a preexist image. This cannot be used with the -A flag.\n -n node_list\n Provide a comma-separated list of nodes and node ranges to set\n up SIS for. (See the noderange man page for information on\n node ranges.) This option cannot be used with the -a or -P\n options.\n -N nodegroups\n Provide a comma-separated list of nodegroups to set up\n SIS for. This cannot be used with the -a or -P flags.\n -p pkg_path\n Specifies one or more directories, separated by colons, that\n contain copies of the SuSE-SLES CD-ROMs. The default is\n /cdrom. This cannot be used with the -x flag.\n -P Setup SIS for all nodes whose Mode attribute is\n "PreManaged". This cannot be used with the -a, -n or -N flags.\n -v | -V Writes the verbose messages of the command to standard output.\n -x Specifies to not copy SuSE/SLES disks. This cannot be used\n with the -p flag.\n Valid attributes (see the csmsetupks man page for details):\n\t\t%1$s\n' IMsgCOPYING_RPMS_SuSE 368 3 'Copying SuSE Images from %1$s.\n' EMsgSET_CREATESISFILES_ERROR 369 3 '%1$s: 2653-307 Error creating sis script files.\n' EMsgNOT_COPYING_SuSE_RPMS 370 3 '%1$s: 2653-308 Skipping %2$s. This directory does not look like it contains the contents of a SuSE CD-ROM".\n' EMsgSET_MKBOOTSERVER_ERROR 371 3 '%1$s: 2653-309 Error when making boot server.\n' EMsgERROR_PXE_RUN 372 3 '%1$s: 2653-310 Pxe daemon did not start up successfully.\n' EMsgERROR_CHANGE_PXECMD 373 3 '%1$s: 2653-311 Error when changing pxe command.\n' EMsgADDIMAGE_ERROR 374 3 '%1$s: 2653-312 Error adding new image.\n' EMsgCREATE_IMAGESCRIPT_ERROR 375 3 '%1$s: 2653-313 Error creating image script.\n' EMsgEXCESS_MAX_CONSOLE_NUM 376 3 '%1$s: 2653-314 Excess Max console server port number \"%2$s\".\n' EMsgERROR_COPYING_LINUX_RPMS 377 3 '%1$s: 2653-315 Error while copying the RPM packages.\n' EMsgNOManagementServer 378 3 '%1$s: 2653-316 This command can only be run on the Management Server.\n' IMsgUNINSTALLMS_NOT_UNINSTALLING 379 3 'The Management Server has not been uninstalled.\n' EMsgOSdiffer 380 3 '%1$s: 2653-103 The operating system of this machine: %2$s, does not match the value stored in the node\'s InstallOSName attribute: %3$s.\n' EMsgOSDistdiffer 381 3 '%1$s: 2653-104 The operating system distribution of this machine: %2$s, does not match the value stored in the node\'s InstallDistributionName attribute: %3$s\n' EMsgOSVersdiffer 382 3 '%1$s: 2653-138 The operating system version of this machine: %2$s, does not match the value stored in the node\'s InstallDistributionVersion attribute: %3$s\n' IMsgGottaWait 383 3 'The following command may take some time.\n' IMsgIMAGE_EXIST 384 3 'The image %1$s already exists!\n' IMsgIMAGE_DOESNOT_EXIST 385 3 'The image %1$s does not exist!\n' IMsgBUILDING_IMAGE 386 3 'Building image, please wait...\n' IMsginstallmsUsage 387 3 'Usage: installms {-p | -x} [-c] [-f] [-v | -V] [-h]\n [Attr=value [Attr=value...]]\n -p List of directories containing packages (p1:p2:p3)\n -c Force copy from the path\n -f Force install\n -x Do not copy packages.\n -v | -V Verbose mode\n -h Display usage information\n Valid attributes (see the installms man page for details):\n\t\t%1$s\n' IMsgcsmsetupksnodeUsage 388 3 'Usage: csmsetupks [-h]\n csmsetupks [-v | -V] [-p pkg_path | -x] [-k kscfg_file]\n [-P | -a | [-N nodegroups] [-n node_list]]\n [Attr=value [Attr=value...]]\n -a Setup Kickstart for all nodes. This cannot be used with\n the -n, -N or -P flags.\n -h Writes usage information to standard output\n -k kscfg_file\n Specifies a kickstart configuration template file. The\n default is /opt/csm/install/kscfg.tmpl.RedHat.\n -n node_list\n Provide a comma-separated list of nodes and node ranges to set\n up Kickstart for. (See the noderange man page for information\n on node ranges.) This option cannot be used with the -a or -P\n options.\n -N nodegroups\n Provide a comma-separated list of nodegroups to set up\n Kickstart for. This cannot be used with the -a or -P flags.\n -p pkg_path\n Specifies one or more directories, separated by colons, that\n contain copies of the Red Hat CD-ROMs. The default is\n /mnt/cdrom. This cannot be used with the -x flag.\n -P Setup Kickstart for all nodes whose Mode attribute is\n "PreManaged". This cannot be used with the -a, -n or -N flags.\n -v | -V Writes the verbose messages of the command to standard output.\n -x Specifies to not copy Red Hat disks. This cannot be used\n with the -p flag.\n Valid attributes (see the csmsetupks man page for details):\n\t\t%1$s\n' IMsgDidnotUninstallRsct 389 3 'Did not uninstall any RSCT packages as other application are using them.\n' EMsgMinConserverNot 390 3 '%1$s: 2653-317 The conserver rpm must be 7.2.2-6 or higher. Copy the correct level of the rpm into %2$s and run "installms -x ".\n' IMsgPasswd_Multi 391 3 'Please enter the password for the current user (normally root) for access to target nodes:' EMsgDSHCannotConnect_Multi 392 3 '%1$s: 2653-139 dsh, using protocol %2$s, cannot connect to target nodes.\n' IMsgISvrNotSupported 393 3 'Install servers are not currently supported for %1$s machines.\n' EMsgRPMWrongVersion 394 3 '%1$s: 2653-187 The %2$s RPM is required, but %3$s is installed. Remove %4$s and run "installms -x".\n' IMsgLoading 395 3 'Loading %1$s.\n' IMsgChecking_For 396 3 'Checking for %1$s.\n' EMsgNoDefsFiles 397 3 '%1$s: 2653-190 No definition files to load in %2$s.\n' IMsgMOVE_DIRECTORY 398 3 'Moving the directory %1$s to %2$s for backup.\n' EMsgERROR_INSTALLED_SIS 399 3 'Cannot find the expected SIS directory, please verify if SIS was installed correctly.\n' EMsgERROR_MOVE_DIRECTORY 400 3 'An error occurred when moving the directory %1$s to %2$s.\n' EMsgERROR_LINK_SIS 401 3 '%1$s: An error occured when trying to move and link the SIS image directory.\n' IMsgUpdateNodeUsage 402 3 'Usage: updatenode [-h] \n updatenode [-v | -V] \n [-f] [-t | --test] [-k | -K[auth_meth,[auth_meth...] | hba]]\n [--nopwd][-I |--installcsm] [-F | --cfm] \n [--cfmoptions "options to pass to CFM"]\n [-S | --sms] [--smsoptions "options to pass to SMS"]\n {-a | -P | -M | -N nodegroups | --file file |\n [-n] node_list } \n -a Updates are performed on all nodes.\n --cfmoptions "options to pass to CFM"\n Forwards options to the CFM command. This flag implies\n the [--F | --cfm] flag.\n -F | --cfm \n Update the configuration files from /cfmroot.The -I, -S,\n and -F flags are the default behavior of updatenode. When\n individual command line options are used, updatenode only\n performs the actions specified by the given flags.\n -f force the updates of CSM filesets. Perform a\n binary check on configuration files .\n --file filename\n specifies a file that contains a list of nodes names.\n If the file name "-", then the list is read from stdin.\n The file can contain multiple lines and each line can have\n one or node names, separated by spaces.\n -h shows usage information.\n [-n] node_list\n Specifies a comma or space separated list of node \n hostnames, IP addresses, or node ranges on which to \n run the command. (See the noderange man page for \n information on node ranges.) Hostnames may not be \n specified with either of the -a, -P, or -M flags.\n Hostnames may be specified positional arguments or \n preceded by the -n flag.\n -I | --installcsm\n Adds the nodes to the cluster and runs customization scripts.\n When run to Linux nodes, it will also install or update the\n CSM packages. The -I, -S, and -F flags are the default\n behavior of updatenode. When individual command line options\n are used, updatenode only performs the actions specified by\n the given flags.\n -k Exchange RSCT public keys between the node and management\n server. Only use this option if the RSCT public key of\n either of the machines or the Kerberos Version 5 \n host principal keytab has changed. When this option is\n used you must trust your network at the time to be sure\n that a rogue machine is not going to insert their public\n key in place of the real node public key.\n With this option, the -I -F and -S options are run.\n -K authentication_method_list \n Specify a comma separated list of authentication\n methods to setup on the node. Valid options are \n rsh, ssh, krb5, or hba. \n hba cannot be used in combination with ssh, krb5,or rsh.\n hba cannot be used with the -F, --cfm, --cfmoptions, \n -S, --sms,or --smsoptions flags.\n rsh sets up remote shell authentication by creating a root\n .rhosts file on the node when all these conditions are true:\n * csmconfig shows SetupRemoteShell=1 & RemoteShell=/.../rsh.\n * rsh using Kerberos is currently failing to the node.\n * rexec is enabled on the node.\n ssh exchanges the ssh public keys, when:\n * csmconfig shows SetupRemoteShell=1 & RemoteShell=/.../ssh.\n * ssh using Kerberos is currently failing to the node. \n krb5 updates the Kerberos Version 5 krb5.keytab file\n on the node with the host principal keytab if SetupKRB5 > 8.\n hba exchanges RSCT public keys between the node and\n the management server. When hba is selected you must\n trust your network at the time to insure that a rogue\n machine is not going to insert their public\n key in place of the real node public key.\n -M Updates are performed on all nodes that are in "Managed"\n mode.\n -N nodegroups\n Specifies a comma-separated list of nodegroups on which to\n run the command. This flag may not be used with either of the\n -a, -P, or -M flags.\n --nopwd Do not prompt for the node password even if the remote shell\n is not set up yet. (Normally, updatenode will prompt for the\n node root password and try to set it up in this case.)\n -P Updates are performed on all nodes that are in "PreManaged"\n mode.\n -t | --test\n Only report what would be done by the command. Do not\n perform any updates.\n -S | --sms\n Installs/updates the Linux RPMS stored under the /csminstall\n subdirectory corresponding to the target Linux node. The -I,\n -S, and -F flags are the default behavior of updatenode. When\n individual command line options are used, updatenode only\n performs the actions specified by the given flags.\n --smsoptions "options to pass to SMS"\n Forwards options to the SMS command. This flag implies the\n [--S | --sms] flag. All flags following the --smsoptions\n operand must be enclosed within double quotes. The following\n are the allowed flags "[--noinsdeps] [-i | --install\n packagename(s)] [-e | --erase [[--deps] | [--nodeps]]\n packagename(s)] [-p | --packages packagename(s)]",\n where packagename(s) denotes a commas separated list. \n -v | -V Verbose mode.\n' IMsgCHANGE_TO_NON_CDROM_DRIVE 403 3 'Please start the %1$s command from a directory other than %2$s.\n' EMsgNoCustScripts 404 3 '%1$s: 2653-215 Could not get lists of customization scripts.\n' EMsgSkipDir 405 3 '%1$s: 2653-216 The directory \"%2$s\" does not exist.\nSkipping to the next directory.\n' EMsgSkipScript 406 3 '%1$s: 2653-217 Skipping to the next script name.\n' EMsgExecScript 407 3 '%1$s: 2653-218 Script \"%2$s\" is not executable.\n' IMsgListScript 408 3 '\"%1$s\" will be run on the following nodes: \"%2$s\"\n' EMsgBadScript 409 3 '%1$s: 2653-219 An incorrect file name format was used for the script \"%2$s\". \"%3$s\" is neither a node name nor a group name.\n' IMsgUpdatenode_Running 410 3 'Updatenode is running\n' IMsgUpdatenode_Failed 411 3 'Updatenode failed\n' EMsgMSNoInstallServer 412 3 '%1$s: 2653-205 Node %2$s is its own management server, therefore it does not need an install server and it will use its own CSM files for install.\n' IMsgMSisInstallServer 413 3 'The install server for %1$s is the same as the management server, therefore the existing CSM files will be used.\n' IMsgPxebootMacUsage 414 3 'Usage: pxeboot_mac [-h]\n pxeboot_mac [-v | -V] {[-f nodlist_file | -n node_list]} \n [Attr=value [Attr=value...]] \n \n -f The name of the file which contains list of \n nodes to process. \n -h Display usage information. \n -n\n Provide a comma-seperated list of nodes.\n This option cannot be used with the -f options.\n -v | -V Display verbose messages to standard out\n\nFor a list of valid attributes to use in the Attr=value pairs, refer\nto the documentation related to pxeboot_mac.\n' IMsgHWStatbootMacUsage 415 3 'Usage: hwstat_mac [-h]\n hwstat_mac [-v | -V] {[-f nodlist_file | -n node_list]} [Attr=value [Attr=value...]] \n \n -f The name of the file which contains list of \n nodes to process. \n -h Display usage information. \n -n\n Provide a comma-separated list of nodes.\n This option cannot be used with the -f options.\n -v | -V Display verbose messages to standard out\n\nFor a list of valid attributes to use in the Attr=value pairs, refer\nto the documentation related to hwstat_mac.\n' IMsgCSMSetupBootUsage 416 3 'Usage: csmsetupboot [-h]\n csmsetupboot [-v | -V] {[-b boot_method]} [-P yes|no|onlyhex] {[-f nodelist_file | -n node_list]} [Attr=value [Attr=value...]] \n \n -b The type of boot to be setup for: Supported values are \n "getmacs", "kickstart", "sis" and "disk" . \n -P Option to generate hex files. \n -f The name of the file which contains list of \n nodes to process. \n -h Display usage information. \n -n\n Provide a comma-seperated list of nodes.\n This option cannot be used with the -f options.\n -v | -V Display verbose messages to standard out\n\nFor a list of valid attributes to use in the Attr=value pairs, refer\nto the documentation related to csmsetupboot .\n' IMsgCsmsetupksNetmaskNotUsed 417 3 'Netmask - this attribute is no longer used.\n' IMsgGetmacsObsolete 418 3 'getmacs - this program is obsolete, instead use "getadapters". Now invoking getadapters.....\n' IMsgdefinenodeUsage 419 3 'Usage: definenode [-h]\n definenode [-v | -V] [-s][-m][-U] [--nopwd] -f nodedef_file \n definenode [-v | -V] [-s][-m][-U] [--nopwd] -M HostnameMapFile [-C ConsoleServers]\n [--minmanaged] [Attr=value [Attr=value...]]\n definenode [-v | -V] [-s][-m][-U] [--nopwd] [-n node_list [-c count]] \n [-C ConsoleServers] [-H HWControlPoints] \n [--minmanaged] [Attr=value [Attr=value...]]\n\n -c count Number of nodes to define (default = 1).\n This flag cannot be used with the -n flag if\n more than one node is specified with the -n flag.\n -C ConsoleServers List of console servers\n Format: csname[:csnum[:port[:num_nodes]]][,...]\n csname = Console server hostname or IP addr\n csnum = Console server number (default=1)\n port = Starting console port number (default=0)\n num_nodes = Number of nodes controlled by this\n Console Server (default=1)\n -f nodedef_file The name of the file which contains node \n definition information. A sample node \n definition file is in\n /opt/csm/install/nodedef.sample. See the nodedef\n man page for more information. This flag cannot\n be used with the -n, -c --minmanaged or -M flags.\n -h Display usage information\n -H HWControlPoints List of hardware control points\n Format: hwctrlpt[:num_nodes][,...]\n hwctrlpt = Hardware Control Point host name\n or IP address.\n num_nodes = Number of nodes controlled by this\n Hardware Control Point (default=1)\n -m Modify existing node definition if a node\n attribute changes\n --minmanaged Sets the Mode Attribute to MinManaged on the specified\n nodes. Cannot be used with the -f flag.\n -M HostnameMapFile Name of a file that map hostnames or IP addresses\n to hardware control information. This file is\n initially created by redirecting the output of \n the lshwinfo command. This flag cannot be used\n with the -n, -c or -f flags.\n -U After defining the nodes, the updatenode command\n is run to install the nodes.\n -s Send the list of node definitions to standard \n out instead of defining the nodes.\n -n node_list The list of nodes to define. This is a space or\n comma separated list of hostnames, ip addresses\n or node ranges (See the noderange man page for\n information on node ranges). Space separated lists\n must be double quoted. This flag cannot be\n used with the -c flag if more than one node is\n is specified with the -n flag.\n -v | -V Display verbose messages to standard out\n --nopwd Do not prompt for Kerberos Version 5 \n administrator name and password. \n Bypasses the Kerberos Version 5 setup. \n\nFor a list of valid attributes to use in the Attr=value pairs, refer\nto the man page for nodeattributes.\n' EMsgINVALID_ARGS_WITH_c 420 3 '%1$s: 2653-220 Cannot use the -c flag when multiple nodes or a node range are specified with the -n flag.\n' EMsgCSMSETUPBOOT_NO_TARGET 421 3 '%1$s: 2653-221 No target specified for this command. Please specify a target with the -f or -n option.\n' EMsgLiteNodes 422 3 '%1$s: 2653-222 Cannot perform this command on the following nodes whose Mode is %2$s: %3$s.\n' IMsgUpdateisvrUsage 423 3 'Usage: updateisvr [-h] [-v | -V]\n {-a | --file filename | -N nodegroups [[-n] node_list]}\n -a update all install servers\n --file filename\n specifies a file that contains a list of install server\n names.\n -h shows usage information.\n [-n] node_list\n Specifies a list of install server hostnames, IP\n addresses, or node ranges on which to run the command.\n (See the noderange man page for information on node ranges.)\n -N nodegroups\n Specifies one or more nodegroups on which to run the\n command.\n -v | -V Verbose mode.\n' EMsgNotIsvr 424 3 '%1$s: 2653-223 This machine: %2$s, is not defined as an install server for any nodes. Run "lsnode -a InstallServer" for a list of all defined install servers.\n' EMsgNoIsvrsGiven 425 3 '%1$s: 2653-224 None of the given machines either are install servers, or have install servers defined. Run "lsnode -a InstallServer" for a list of all defined install servers.\n' IMsgREBOOT_FAILED 426 3 'Reboot failed\n' IMsgCSMSETUPBOOT_NO_BOOT_METHOD 427 3 'No boot method specified.\n' EMsgNO_POWER_ATTRS_FOR_MS 428 3 '%1$s: 2653-225 The node %2$s is the management server. The HWControlPoint, HWControlNodeId and PowerMethod attributes cannot be assigned to a node that is the management server.\n' EMsgNoRpmFound 429 3 '%1$s: 2653-226 The following RPMs could not be found: %2$s\n' EMsgNoFilesetFound 430 3 '%1$s: 2653-227 The following filesets are not found: %2$s\n' IMsgPasswd 431 3 'Please enter the password for the current user (normally root) to access the nodes %1$s:' IMsgcopycsmpkgsUsage 432 3 'Usage: copycsmpkgs [-v | -V] [-h] [-c] -p [Attr=value [Attr=value...]]\n -p List of directories containing packages (p1:p2:p3)\n -c Force copy from the path\n -v | -V Verbose mode\n -h Display usage information\nValid attributes:\n InstallCSMVersion (default is Management Server CSM version)\n InstallOSName (default is Management Server OS name)\n InstallDistributionName (default is Management Server Distribution name)\n InstallDistributionVersion (default is Management Server Distribution version)\n InstallPkgArchitecture (default is Management Server package architecture)\n' EMsgFSTAB_INV_FORMAT 433 3 '%1$s: 2653-318 The fstab file \"%2$s\" has an invalid format.\n' EMsgNETWORK_INV_TYPE 434 3 '%1$s: 2653-319 The network type \"%2$s\" specified in config file: \"%3$s\" is invalid. \n Valid network type: dhcp or static.\n' EMsgDEFINE_PARTITION_TABLE_ERROR 435 3 '%1$s: 2653-320 Error defining partition table with the image.\n' EMsgCONFIG_IMAGE_ERROR 436 3 '%1$s: 2653-321 Error while configing the image based on the config file and distribution.\n' IMsgGETTING_MACS_VIA_PXEBOOT 437 3 'Attempting to use pxeboot to collect MAC addresses.\n' IMsgNO_SERIAL_DEVICE 438 3 '%1$s - no console serial device defined. Cannot use pxeboot to get MAC address.\n' IMsgCreatingDirectories 439 3 'Creating the required directories for CSM.\n' IMsgSearchingfor 440 3 'Searching for %1$s RPMs.\n' IMsgCopyingRpms 441 3 'Copying %1$s RPMs.\n' IMsgSearchAndCopy 442 3 'Searching and copying the %1$s RPMs.\n' IMsgChangeNodeAttr 443 3 '%1$s: Changing %2$s from: \"%3$s\" to: \"%4$s\".\n' IMsgSkipSubDir 444 3 'The \"%1$s\" subdirectory will not be checked for user-provided customization scripts.\n' EMsgBadScriptName 445 3 '%1$s: 2653-228 \"%2$s\" is not a valid customization script name.\n' IMsgUPDATING_DHCP_AUTOYAST 446 3 'Adding nodes to /etc/dhcpd.conf file for AutoYaST install: %1$s.\n' IMsgSETUP_YAST 447 3 'Setting up autoyast.\n' EMsgUnsupportedRpmName 448 3 '%1$s: 2653-229 The %2$s packaged by %3$s is already installed. This version of %4$s is not supported. Please uninstall this rpm and run installms -x.\n' IMsgVERIFYING_SETUPYAST_OK 449 3 'Verifying that csmsetupyast was run properly.\n' IMsgCREATING_YAST_FILE 450 3 'Creating AutoYaST Configuration File %1$s.\n' EMsgPARSING_YAST_FILE 451 3 '%1$s: 2653-230 Parsing autoyast control file %2$s error, a control file should include ,, sections.\n' IMsgOkToRemove 452 3 'Ok to remove %1$s (Y/N): ' IMsgUNINSTALLING 453 3 'Uninstalling %1$s.\n' IMsgRemoveFileOrNoInstall 454 3 'CSM will not continue installing until %1$s is removed.\n' IMsgcsmsetupyastUsage 455 3 'Usage: csmsetupyast [-h]\n csmsetupyast [-v | -V] {-p pkg_path | -x} [-k yastcfg_file]\n {-P | -a | [-N nodegroups] [-n node_list]}\n [Attr=value [Attr=value...]]\n -a Setup AutoYaST for all nodes. This cannot be used with\n the -n, -N or -P flags.\n -h Writes usage information to standard output\n -n node_list\n Provide a comma-separated list of nodes and node ranges to set\n up AutoYaST for. (See the noderange man page for information\n on node ranges.) This option cannot be used with the -a or -P\n options.\n -N nodegroups\n Provide a comma-separated list of nodegroups to set up\n AutoYaST for. This cannot be used with the -a or -P flags.\n -p pkg_path\n Specifies one or more directories, separated by colons, that\n contain copies of the SuSE/SLES CD-ROMs. The default is\n /media/cdrom. This cannot be used with the -x flag.\n -P Setup AutoYaST for all nodes whose Mode attribute is\n "PreManaged". This cannot be used with the -a, -n or -N flags.\n -v | -V Writes the verbose messages of the command to standard output.\n -x Specifies to not copy SuSE/SLES disks. This cannot be used\n with the -p flag.\n -k yastcfg_file\n Specifies a AutoYaST control file. The\n default is /opt/csm/install/yastcfg.SLES.xml.\n Valid attributes (see the csmsetupyast man page for details):\n\t\t%1$s\n' EMsgUNINSTALLMS_RUN_RMLCSEXT 456 3 '%1$s: 2653-231 The Linux Cluster Support extension is installed. Please run "rmlcsext -A" first, and then run uninstallms again.\n' EMsgWRONG_DISK 457 3 '%1$s: 2653-232 The disk in the CD-ROM drive does not look like %2$s disk %3$s.\n' IMsgPRESS_ENTER_OR_FORCE 458 3 'Press Enter to continue, or press "F" to force the use of this disk.\n' IMsgCOPYING_DISK 459 3 'Copying %1$s disk %2$s.\n' IMsgAIXandINSTALL_CSM 460 3 '%1$s: The "I" or "--installcsm" flag will not install CSM software onto AIX nodes. Instead, use AIX tools such as NIM.\n' EMsgAIXandInstallms 461 3 '%1$s: 2653-233 The installms command is not supported on AIX management servers. Please see the CSM Planning and Installation Guide for instructions on how to use base AIX commands to install the management server.\n' EMsgCopyingAIXpkgs 462 3 '%1$s: 2653-234 CSM does not manage the installation of AIX packages. See the CSM Planning and Installation Guide for instructions on how to use base AIX commands to install CSM onto AIX nodes.\n' EMsgSETUPYAST_NO_TARGET 463 3 '%1$s: 2653-235 There is no target for the csmsetupyast command. Please specify a target with the -a, -P, -N or -n flags.\n' IMsgMonitorinstallUsage 464 3 'Usage: monitorinstall [-h][-v | -V][-e][-i][-l][-u][-a] \n [-n node_list] [-f filename] [-N nodegroups]\n -a Monitor all nodes. This is the command default.\n -f filename\n The name of the file which contains list of \n nodes to process. \n -h Display usage information. \n -n node_list \n Provide a comma-seperated list of nodes.\n This option cannot be used with the -f options.\n -N nodegroups \n Provide a comma-seperated list of nodegroups.\n -v | -V Verbose mode.\n -e Shows only the nodes that had an error during the \n installation \n process. Can be used with -i or -u to display different \n types of nodes.\n -i Shows only the nodes that are installed.\n -l Displays output in long format.\n -u Shows only the nodes that are not installed and nodes \n that are in the process\n of installing. \n\nExample: monitorinstall -vel\n This will display all the nodes that had an error during the install\n process, in long format, with the maximum amount of messages\n being put on the screen (since the -v for verbose was done.)\n' IMsgNO_NODES_TO_GETMACS 465 3 'No nodes to process getmacs.\n' IMsgNO_NODES_TO_KICKSTART_SETUP 466 3 'No nodes to do kickstart setup.\n' IMsgNO_NODES_TO_SIS_SETUP 467 3 'No nodes to do SIS setup.\n' IMsgNoDeviceFile 468 3 'The device file specified for the HWControlPoint value, (%1$s), for node %2$s, does not exist.\n' IMsgBadHCP 469 3 'The HWControlPoint value provided for one or more nodes was invalid.\n' EMsgBadPowerMethod 470 3 '%1$s: 2653-236 Multiple nodes may not be specified when using a PowerMethod attribute of csp.\n' EMsgNoCwPM 471 3 '%1$s: 2653-237 The -C option is not a valid option when specifying a PowerMethod of csp or hmc.\n' EMsgERRinValues 472 3 '%1$s: 2653-238 Node definitions could not be created due to errors in one or more of the values provided.\n' EMsgNoSetupRA_Off 473 3 '%1$s: 2653-239 Cannot setup remote authentication on the following unreachable nodes because they have a PowerStatus of 0: %2$s.\n' IMsgRemoteSetupComplete 474 3 'Setup complete for remote shell: %1$s\n' EMsgSETUPYAST_ERROR 475 3 '%1$s: 2653-240 Error running csmsetupyast. \n' EMsgCANT_GET_NODE_ATTR 476 3 '%1$s: 2653-241 Cannot get the attribute %2$s for node %3$s.\n' IMsgcsmsis2yastUsage 477 3 'Usage: csmsis2yast [-h]\n csmssis2yast [-v | -V] -s siscfg_file -y yastcfg_file\n [-o output_file ]\n -h Writes usage information to standard output\n -o output_file\n The pathname to the new AutoYast file that will be created.\n -s siscfg_file\n The pathname to a SIS config file, which include links to \n SIS partition table and package list file.\n -v | -V Writes the verbose messages of the command to standard output.\n -y yastcfg_file\n The pathname to an existing AutoYast configuration file.\n' EMsgNO_SIS_FILE 478 3 '%1$s: 2653-242 No SIS config file specified.\n' EMsgNO_YAST_FILE 479 3 '%1$s: 2653-243 No AutoYast config file specified.\n' EMsgBAD_VALUE 480 3 'The value %1$s for the attribute %2$s/%3$s is invalid, please make sure it is a clean value without any MACRO.\n' IMsgCONVERT_CONFIG 481 3 'Converting %1$s setting %2$s from SIS to yast...\n' IMsgDISABLE_SIS 482 3 'CSM does not support SIS full installation now, please run "csmsetupyast" command on SuSE/SLES distribution instead.\n' IMsgVERIFYING_AUTOYAST 483 3 'Verifying that csmsetupyast was run properly.\n' IMsgVERIFYING_AUTOYAST_OK 484 3 'It looks like csmsetupyast ran okay. \n' EMsgISVR_OF_ITSELF 485 3 '%1$s: 2653-244 %2$s is an install server of itself. The management server will be used to serve its files during the operating system install.\n' IMsgSETUP_CSM_USAGE 486 3 'Usage: \n csmsetupnim [-h] [-v | -V] [-a] \n [-N nodegroups] \n [[-n] node_list] \n -a Sets up CSM customization scripts for all CSM nodes.\n May not be used with the -n or -N flags.\n -h Display usage information.\n [-n] node_list \n Specifies a comma or space separated list of node hostnames, \n IP addresses, or node ranges on which to run the command.\n (See the noderange man page for information on node ranges.)\n Hostnames may be specified as positional arguments or preceded \n by the -n flag.\n -N nodegroups \n Specifies a comma separated list of one or more nodegroups \n on which to run the command.\n -v | -V Verbose mode.\n' IMsgCSM2NIMGRPS_USAGE 487 3 'Usage: \n csm2nimgrps [-h] [-x] [-v | -V] [-a] \n [-N nodegroups] \n -a NIM groups are created or updated for all CSM groups.\n This flag may not be used with the -N flag. \n -h Displays usage information.\n -N nodegroups \n Specifies one or more CSM nodegroups to be used \n to create or update NIM groups.\n -v | -V Verbose mode.\n -x Do not update existing NIM groups.\n' IMsgCSM2NIMNODES_USAGE 488 3 'Usage: \n csm2nimnodes [-h] [-x] [-v | -V] [-a] \n [-n node_list] \n [-N nodegroups] [Attr=value[ Attr=value...]]\n -a Create NIM machine definitions for all CSM nodes.\n May not be used with the -n or -N flags.\n -h Display usage information.\n -n node_list \n Specifies a comma separated list of node hostnames, IP \n addresses, or node ranges on which to run the command. (See \n the noderange man page for information on node ranges.) \n -N nodegroups\n Specifies one or more CSM nodegroups. \n -v | -V Verbose mode.\n -x Do not update existing NIM client definitions.\n Attr=value[ Attr=value...] \n Valid attributes: type, network_name, ring_speed, cable_type,\n platform, netboot_kernel.\n' IMsginstallnodeUsage 489 3 'Usage: installnode [-h]\n installnode [-v | -V] [-t timeout] { -P | -a | [-N nodegroups] [[-n] node_list][--file filename] }\n -a install all nodes whose InstallMethod attribute is \n kickstart. This flag cannot be used with the -P or -N \n flags or the node_list. \n --file filename\n specifies a file that contains a list of nodes names.\n If the file name "-", then the list is read from stdin.\n The file can contain multiple lines and each line can have\n one or node names, separated by spaces.\n -h Display this usage information.\n [-n] node_list\n Space or comma separated list of nodes and node ranges.\n (See the noderange man page for information on node\n ranges.) This option cannot be used with the -a or -P\n options. Node names may be specified as positional\n arguments or preceded by the -n flag.\n -N nodegroups \n Comma-separated list of nodegroups to install. This \n flag cannot be used with the -a or -P flags. \n -P install all nodes whose Mode attribute is PreManaged and \n whose InstallMethod attribute is kickstart. This flag \n cannot be used with the -a or -N flags or the node_list. \n -t timeout\n Timeout in minitues. After this period the install \n process is assumed to be failed. The default value is \n 60 minitues.\n -v | -V Verbose mode \n' EMsgCSMVersdiffer 490 3 '%1$s: 2653-138 The CSM version on this machine: %2$s, does not match the value stored in the node\'s InstallCSMVersion attribute: %3$s\n' IMsgCheckingTftp 491 3 'Checking to see if tftp server is running...\n' IMsgTftpNotRunning 492 3 'Could not detect if %1$s is running\n' IMsgRunning 493 3 '%1$s is up and running\n' IMsgStillCantRestart 494 3 'Still can not restart %1$s.\n' IMsgRestart 495 3 'Attempting to restart %1$s\n' IMsgCreatingTFTPGroup 496 3 'Creating default %1$s group for the tftp server.\n' IMsgGroupAlreadyCreated 497 3 'The %1$s group has already been created.\n' IMsgCreatingTFTPUser 498 3 'Creating default %1$s user for the tftp server.\n' IMsgUserAlreadyCreated 499 3 'The %1$s user has already been created.\n' IMsgSecureFiles 500 3 'Securing file permissions in the %1$s directory and all subdirectories...\n' IMsgTFTPInfo 501 3 'CSM ships with %1$s by default.\nThe above tftp RPMs may conflict with\n%2$s.\nYou have several options at this point:\n' IMsgTFTPOptions 502 3 '1. Remove the above tftp RPMs and install %1$s\n2. Install %2$s without removing already installed RPMs\n\t(note: There may be conflicting files with this option, and \n\t%3$s may not install correctly.)\n3. Keep the above tftp RPMs. Continue without installing %4$s\n4. Quit\nPlease choose 1, 2, 3, or 4:\n' IMsgWILL_NOT_INSTALL 503 3 'CSM will not install %1$s\n' EMsgINVALID_ARGS_WITH_F 504 3 '%1$s: 2653-056 Cannot provide -c, -C, -H, -m, --minmanaged or -n with -f.\n' EMsgISDown 505 3 '%1$s: 2653-245 The following install servers are unreachable over dsh: %2$s. Please use other install servers in their place, or fix the dsh connectivity problems.\n' EMsgNoSetupRA 506 3 '%1$s: 2653-038 Cannot setup remote authentication on the following unreachable nodes because they are no longer in PreManaged or MinManaged mode (run updatenode -k to setup remote authentication these nodes): %2$s.\n' IMsgChangeTftpUser 507 3 'CSM will change the owner and group of the /tftpboot directory and all \nsubdirectories to be owned by the tftpd user and group.\nFor your tftp server to work correctly, you should ensure that it runs as \nthe %1$s user.\nPress any key to continue...\n' EMsgSETUPMKINITRD_ERROR 508 3 '%1$s: 2653-246 The required mkinitrd file was not created successfully. Please make sure to download the update-mkinitrd.gz file and put in %2$s directory.\n' IMsgNO_NODES_TO_AUTOYAST_SETUP 509 3 'No nodes to do autoyast setup.\n' IMsgTftpProcFound 510 3 'CSM has detected that there is a tftp server process running,\nbut could not detect whether any tftp server rpm was installed.\nCSM ships with %1$s by default.\nYou have several options at this point:\n' IMsgTftpOptionsMenu 511 3 '1. Install %1$s\n2. Continue without installing %2$s\n3. Quit\nPlease choose 1, 2, or 3:\n' EMsgUNSUPPORTED_FULLINST_DISTRO 512 3 'Linux distribution %2$s full installation is not currently supported by CSM.\n' EMsgSET_YASTINSTALLMETHOD_ERROR 513 3 '%1$s: Error setting InstallMethod attribute to "autoyast".\n' EMsgERROR_SETTINGUP_KRB5 514 3 '%1$s: 2653-247 Nodes were successfully defined, but there was an error creating the KRB5 host principal. Correct the error condition and run csmconfig -K with your desired SetupKRB5 attribute setting to create the principals.\n' EMsgNO_KRB5client 515 3 '%1$s: 2653-248 An error occurred while attempting to setup the KRB5 client on the node.\n' EMsgNO_SetupKRB5 516 3 '%1$s: 2653-249 Could not get SetupKRB5 attribute from the node config_info file.\n' EMsgERROR_KRB5_NonRoot 517 3 '%1$s: 2653-250 You must be root to run the KRB5 setup commands.\n' IMsgNO_SETUP_KRB5 518 3 'No prompt flag set. Automatic creation of KRB5 principals will not be done.\n' IMsgListNoPowerMethodNodes 519 3 'The following nodes could not be rebooted because their PowerMethod\nattribute is not set. Please reboot these nodes manually so that the\ninstall process on these nodes can proceed:\n %1$s \n' IMsgNoDefaultTFTPServerFound 520 3 'The %2$s RPM was not found, and CSM can not detect if a tftp server is currently installed. You will need a tftp server installed on this Management Server to perform full Operating System and CSM installations to the nodes in this cluster. Please ensure that a tftp server is running on this machine.\n' IMsgSetingNodeAttr 521 3 '%1$s: Setting %2$s to: \"%3$s\".\n' IMsgNODE_REBOOT_REQ 522 3 'Node reboot required to activate changes.\n' EMsgNO_kandK 523 3 '%1$s: 2653-300 The \"-k\" flag cannot be used with the \"-K\" flag.\n' EMsgBadKoption 524 3 '%1$s: 2653-322 Invalid K option: %2$s. Only hba,krb5,ssh, and rsh are allowed.\n' EMsgBadKKRB5option 525 3 '%1$s: 2653-323 option -K krb5 should not be chosen, if SetupKRB5 < 8.\n' EMsgBadKSSHoption 526 3 '%1$s: 2653-324 option -K ssh should not be chosen, unless SetupRemoteShell=1 and RemoteShell=/../ssh.\n' EMsgBadKRSHoption 527 3 '%1$s: 2653-325 option -K rsh should not be chosen, unless SetupRemoteShell=1 and RemoteShell=/../rsh.\n' IMsgExchangeHBAkeys 528 3 'Exchanging host based authentication (hba) keys with Management Server.\n' IMsgCreateRAMDISKFAIL 529 3 'The ramdisk for getting MAC addresses could not be created, getadapters \nwill try to get MAC addresses from the BIOS instead.\n' IMsgNoIPRDriver 530 3 'Can not find ipr drivers! This will result in installation failure if you are installing a pSeries model 615 or 655 node!\n' IMsgNoSg3utilsRPM 531 3 'Can not find sg3_utils rpm package under %1$s! This may result in full installation failure when setting boot disk for managed node.\n' EMsgInvalidRpm 532 3 '%1$s: 2653-326 %2$s is not a valid rpm.\n' EMsgBadKHBAoption 533 3 '%1$s: 2653-327 -K hba can not be used in combination with rsh, ssh or krb5 options.\n' EMsgBadKHBAoption2 534 3 '%1$s: 2653-328 option -K hba can not be used in combination with -F, --cfm, --cfmoptions, -S, --sms, or --smsoptions flags.\n' EMsgAdapterNotValid 535 3 '%1$s: 2653-327 %2$s is not a valid InstallAdapterName. Please specify a valid InstallAdapterName for %3$s. \n' IMsgCopycdsUsage 536 3 'Usage: copycds [-v | -V] [-x] [-p pkg_path] [-h] [Attr=value [Attr=value...]]\n\t-h Display usage information.\n\t-p List of directories containing distribution packages(p1:p2:p3), default is from CDROM.\n\t-x Do not copy packages, just switch between base level and service level.\n\t-v | -V Verbose mode.\nValid attributes:\n\tInstallOSName (default is Management Server OS name)\n\tInstallDistributionName (default is Management Server Distribution name)\n\tInstallDistributionVersion (default is Management Server Distribution version)\n\tInstallPkgArchitecture (default is Management Server package architecture)\n\tInstallServiceLevel (default is null)\n' IMsgSetInstallAdapterNull 537 3 'CSM can not get an accurate Macaddress for InstallAdapterName=%1$s for %2$s, so it will set InstallAdapterName to null.\n' IMsgdefinehwdevUsage 538 3 'Usage: definehwdev [-h]\n definehwdev [-v | -V] [-s][-m] -f devicedef_file \n definehwdev [-v | -V] [-s][-m] -M HostnameMapFile [-C ConsoleServers]\n [Attr=value [Attr=value...]]\n definehwdev [-v | -V] [-s][-m] [-d device_list [-c count]] \n [-C ConsoleServers] [-H HWControlPoints] \n [Attr=value [Attr=value...]]\n\n -c count Number of devices to define (default = 1).\n This flag cannot be used with the -d flag if\n more than one device is specified with the -d flag.\n -C ConsoleServers List of console servers\n Format: csname[:port[:num_devices]][,...]\n csname = Console server hostname or IP addr\n port = Starting console port number (default=0)\n num_devcies = Number of devices controlled by this\n Console Server (default=1)\n -f devicedef_file The name of the file which contains device \n definition information. A sample device \n definition file is in\n /opt/csm/install/devicedef.sample. See the devicedef\n man page for more information. This flag cannot\n be used with the -d, -c or -M flags.\n -h Display usage information\n -H HWControlPoints List of hardware control points\n Format: hwctrlpt[:num_devices][,...]\n hwctrlpt = Hardware Control Point host name\n or IP address.\n num_devices = Number of devices controlled by this\n Hardware Control Point (default=1)\n -m Modify existing device definition if a device\n attribute changes\n -M HostnameMapFile Name of a file that map hostnames or IP addresses\n to hardware control information. This file is\n initially created by redirecting the output of \n the lshwinfo command. This flag cannot be used\n with the -d, -c or -f flags.\n -s Send the list of device definitions to standard \n out instead of defining the devices.\n -d device_list The list of devices to define. This is a space or\n comma separated list of names. Space separated lists\n must be double quoted. This flag cannot be\n used with the -c flag if more than one device is\n is specified with the -d flag.\n -v | -V Display verbose messages to standard out\n\nFor a list of valid attributes to use in the Attr=value pairs, refer\nto the man page for deviceattributes.\n' EMsgINVALID_ARGS_WITH_F_dev 539 3 '%1$s: 2653-251 Cannot provide -c, -C, -H, -m, or -d with -f.\n' EMsgINVALID_ARGS_WITH_c_dev 540 3 '%1$s: 2653-252 Cannot use the -c flag when multiple devices or a node range are specified with the -d flag.\n' EMsgINVALID_ARGS_WITH_M_dev 541 3 '%1$s: 2653-253 Cannot provide -c, -f, -H, -d or the HWControlPoint, HWControlDeviceId or PowerMethod attributes with -M. \n' EMsgBadPowerMethod_dev 542 3 '%1$s: 2653-254 Multiple devices may not be specified when using a PowerMethod attribute of csp.\n' EMsgAssignAttrToMultDevices 543 3 '%1$s: 2653-255 Cannot assign the same %2$s to more than one device.\n' IMsgEXISTING_MANAGEDDEVICES 544 3 'Existing Managed Devices: \n' IMsgDEFINING_DEVICES 545 3 'Defining CSM Devices: \n' IMsgDEFINING_DEVICE 546 3 'Defining Device \"%1$s\"\n' EMsgBadConsoleMethodForDevice 547 3 '%1$s: 2653-256 The console method \"%2$s\" cannot be used for devices.\n' IMsgASSIGNING_CONSOLE_PORT_dev 548 3 'Assigning console \"%1$s\", port \"%2$s\" to device \"%3$s\".\n' IMsgREADING_DEVICEDEF 549 3 'Reading devicedef file: \"%1$s\".\n' EMsgDEVICEDEF_BAD_FORMAT 550 3 '%1$s: 2653-257 The devicedef file has an invalid format on line \"%2$s\".\n\tNo name for \"\"%3$s\"\"\n' EMsgDEVICEDEF_INVALID_ATTR 551 3 '%1$s: 2653-258 The devicedef file has an invalid attribute on line \"%2$s\":\n\t\"%3$s\". \n' EMsgERROR_IN_DEVICEDEF 552 3 '%1$s: 2653-259 Errors in devicedef file: \"%2$s\".\n' EMsgNoMultStanzas_dev 553 3 '%1$s: 2653-260 Device \"%2$s\" appears in multiple stanzas. It will not be defined.\n' EMsgNO_ATTR_WITH_F 554 3 '%1$s: 2653-262 Cannot specify attributes with -f.\n' EMsgHOSTMAP_NO_HOSTNAME_dev 555 3 '%1$s: 2653-263 The hostname map file has no hostname on line %2$s. This device will not be defined.\n' EMsgINSUFFICIENT_PORTS_dev 556 3 '%1$s: 2653-264 \"%2$s\" devices were specified, but only \"%3$s\" console ports are available.\n' EMsgINSUFFICIENT_SP_dev 557 3 '%1$s: 2653-265 \"%2$s\" devices were specified, but only \"%3$s\" service processors are available.\n' EMsgDUPLICATE_DEVICES 558 3 '%1$s: 2653-266 Devices are already defined.\n' EMsgALREADY_DEFINED_MANAGEDDEVICES 559 3 '%1$s: 2653-267 The following devices are already defined as ManagedDevices:\n \"%2$s\" \n' EMsgERROR_ASSIGNING_PORTS_dev 560 3 '%1$s: 2653-268 Cannot assign console ports to devices.\n' EMsgERROR_ASSIGNING_SP_dev 561 3 '%1$s: 2653-269 Cannot assign service processors to devices.\n' IMsgBadHCP_dev 562 3 'The HWControlPoint value provided for one or more devices was invalid.\n' EMsgERRinValues_dev 563 3 '%1$s: 2653-270 Device definitions could not be created due to errors in one or more of the values provided.\n' EMsgNO_PING_STATUS_WITH_C 564 3 '%1$s: 2653-271 You must specify a StatusMethod of \"ping\" when defining devices with -c.\n' EMsgDevicesNotDefined 565 3 '%1$s: 2653-272 The following devices are not defined: %2$s .\n' IMsgCANT_MOUNT 566 3 'Warnings: Could not mount %1$s, file may not be an iso image or could be some mount problem. \n' EMsgNO_DEVICES_DEFINED 567 3 '%1$s: 2653-073 No devices were successfully defined.\n' IMsgScriptUpdate 568 3 'Warnings: %2$s has been updated.\n' IMsgWRITE_TIMEOUT_MESSAGE 569 3 '%1$s is still installing - updating status file with timeout message.\n' IMsgCANT_READ_FILE 570 3 'Cannot open file %1$s for reading. Install timeout may not work.\n' IMsgNoIsvrs 571 3 'Warnings: Following machines are neither install servers nor have install servers defined, please check your input: \"%2$s\".\n' EMsgMissingPackage 572 3 '2653-274 The following package is missing and may need to be installed: %1$s .\n' EMsgReqOrigDisks 573 3 '2653-275 The CDs of base distribution must be copied before service level, please run copycds without InstallServiceLevel paratermer first.\n' EMsgBadServiceLevel 574 3 '2653-276 InstallServiceLevel \"%2$s\" is not currently supported by CSM.\n' EMsgDisksMissing 575 3 '2653-277 It seems that the content of distribution you specified has not been copied yet, please run without -x option.\n' IMsgCHANGED_BOOT_ORDER 576 3 'Changed boot order to hard disk for the node %1$s.\n' IMsgWROTE_STATUS_MSG 577 3 'Wrote status message \"%1$s\" to the node %2$s status file.\n' IMsgMINMANAGED_INSTALLED 578 3 'Changed mode attribute to MinManaged for the node %1$s.\n' IMsgNODE_INSTALL_INCOMPLETE 579 3 'Node Install - Incomplete. See messages above and take corrective action. Then run updatenode to complete installation of this node.\n' EMsgNO_NODES_DEFINED_OR_MODIFIED 580 3 '%1$s: 2653-278 No nodes have been defined or modified.\n' IMsgGATEWAY_INVALID 581 3 'The Gateway attribute %1$s is not valid, the router of management server will be choosed as default . \n' IMsgSKIP_SETUP_DHCP 582 3 'CSM_NO_SETUP_DHCP is set , skip setup dhcp.\n' d D kL0PB$7ur@r@r@ ./opt/csm/msgmaps/csmKRB5p.csmKRB5p_msg.map64.p$IMsgStartup 1 1 '%1$s: started %2$s.\n' IMsgEnd 2 1 '%1$s: ended %2$s with rc=%3$s.\n' IMsgKRB5ConfigFileExists 3 1 '%1$s: %2$s exists. KRB5 server already setup.\n' IMsgKRB5ClientCfgExists 4 1 '%1$s: %2$s exists. Will not update the %3$s file.\n' IMsgKRB5EnterAdminName 5 1 'Specify the principal name for the Kerberos (KRB5) database administrator.\n' IMsgKRB5EnterDomain 6 1 'Specify the DNS domain name for Kerberos (KRB5) server. Check to ensure that the DNS (Domain Name Server) is configured.\n' IMsgKRB5NULLName 7 1 'A NULL name is not valid.\n' IMsgKRB5CMD 8 1 'Running %1$s.\n' IMsgKRB5SetupRemoteCmds 9 1 '%1$s: Setup KRB5 remote commands requested.\n' IMsgKRB5CreateCSMPrinc 10 1 '%1$s: Creating KRB5 CSM principal:%2$s.\n' IMsgKRB5CreateNodePrinc 11 1 '%1$s: Create KRB5 Node principal requested for %2$s.\n' IMsgKRB5SetupClient 12 1 '%1$s: Setup KRB5 client requested.\n' IMsgKRB5NoClientSetup 13 1 '%1$s:No KRB5 client setup requested.\n' IMsgKRB5NoPrincipalSetup 14 1 '%1$s:No KRB5 principal creation requested.\n' IMsgKRB5CfgCreated 15 1 '%1$s: %2$s created.\n' IMsgk5loginUpdated 16 1 '%1$s: .k5login updated with CSM principal.\n' IMsgSupplyPWD 17 1 'Please enter the kadmin administrator password.\n' IMsgNULLSupplyPWD 18 1 'A NULL password is not valid.\n' IMsgkadminTxt 19 1 '%1$s: Call to kadmin returned %2$s\n' IMsgPrincipalExists 20 1 '%1$s: The KRB5 principal:%2$s already exists. Will not create. \n' IMsgNoPrincipals 21 1 '%1$s: No Kerberos principals need to be created at this time. \n' IMsgKRB5OpenFailed 22 1 '%1$s: The open of file:%2$s failed. \n' EMsgNASMissing 23 1 '%1$s: 2657-101 The %2$s executable is missing. Can not setup the KRB5 server. \n' EMsgNASError 24 1 '%1$s: 2657-102 The %2$s routine returned rc=%3$s. \n' EMsgNotAIXError 25 1 '%1$s: 2657-103 %2$s can only be run on AIX. \n' EMsgUpdtk5loginError 26 1 '%1$s: 2657-104 The popk5login routine returned rc=%2$s. See /var/log/csm/popk5login.log for more details. \n' EMsgCopyKRB5ConfigError 27 1 '%1$s: 2657-105 The copy of %2$s to %3$s did not succeed rc=%4$s. \n' EMsgUnableToCreatePrincipal 28 1 '%1$s: 2657-106 The KRB5 principal could not be created.\n' EMsgNokadminError 29 1 '%1$s: 2657-107 The kadmin executable cannot be found due to missing or empty CSM KRB5 configuration file. \n' EMsgkadminError 30 1 '%1$s: 2657-108 An error was returned from the call to kadmin. Check the message and the kadmin.log for more information. \n' EMsgmkdirError 31 1 '%1$s: 2657-109 mkdir %2$s returned rc=%3$s. \n' EMsgLinkKRB5ConfigError 32 1 '%1$s: 2657-110 The link of %2$s to %3$s did not succeed rc=%4$s. \n' EMsgKRB5ConfigError 33 1 '%1$s: 2657-111 The %2$s file exists and the %3$s file does not exist. This configuration is not valid. \n' EMsgKRB5CSMConfigError 34 1 '%1$s: 2657-112 The %2$s file does not exists and the %3$s file does not exist. Unable to determine path to kadmin on Linux. \n' EMsgKRB5NASAdminError 35 1 '%1$s: 2657-113 The %2$s executable does not exists. \n' EMsgKRB5XFERKEYError 36 1 '%1$s: 2657-114 The transfer of the KRB5 keytab did not succeed. Error was returned from sendkeytab. Check /var/log/csm/sendkeytab.%2$s.log. \n' EMsgKRB5ReadConfigError 37 1 '%1$s: 2657-115 Could not read the CSM KRB5 configuration file: %2$s. Unable to determine path to kadmin on Linux. \n' EMsgKRB5CopyConfigError 38 1 '%1$s: 2657-116 Could not copy the /etc/krb5.conf file to the %2$s.\n' EMsgKRB5ChkaddKRB5 39 1 '%1$s: 2657-117 Check the /var/log/csm/add_KRB5principals.log for more information.\n' IMsgMadeKRB5Save 40 1 '%1$s: %2$s exists on the node and is different from the krb5.conf on the Management Server, saving in %3$s and copying the krb5.conf from the Management Server to the node. \n' D k0PB$7u)r@r@r@ )./opt/csm/msgmaps/nodecmds.NodeUtils.mapap64.p$IMsgCMD 1 7 'Running cmd: %1$s\n' IMsgRESOLVING 2 7 'Resolving names in the specified node list...\n' EMsgBAD_IPADDR 3 7 '%1$s: 2651-027 Cannot resolve %2$s to a host name.\n' EMsgBAD_HOSTNAME 4 7 '%1$s: 2651-028 Cannot resolve %2$s to an IP address.\n' EMsgCMD_FAILED 5 7 '%1$s: 2651-029 Exit code %2$s from command: %3$s\n\nError message from cmd: %4$s\n' EMsgNODELIST_FILE 6 7 '%1$s: 2651-030 Error opening file %2$s to read node list. Message from system: %3$s.\n' EMsgGROUP_NOT_FOUND 7 7 '%1$s: 2651-031 Could not find nodegroup %2$s in the database. Run nodegrp -l to see a list of valid nodegroups.\n' EMsgSOME_GROUPS_NOT_FOUND 8 7 '%1$s: 2651-032 Could not find one or more of the following nodegroups in the database: %2$s. Run nodegrp -l to see a list of valid nodegroups.\n' EMsgNO_RES2UNRES 9 7 '%1$s: 2651-033 Internal error in NodeUtils.listNodeAttrs() - SkipResolve set, but Res2Unres not set.\n' EMsgCannotRunCSMCommands 10 7 '%1$s: 2651-052 You cannot run CSM commands on this machine, since it is an inactive CSM management server.\n' $s crea kL0PB$7u r@r@r@  ./opt/csm/msgmaps/nodecmds.mgmtsvr.mapp$IMsgMgmtsvrUsage 1 6 'Usage: mgmtsvr [-h] [-v | -V] [-k] [-n nodename] [-N] [host | -d]\n -d Delete the management server entry.\n -n nodename\n Hostname that the CSM management server knows this node by.\n Normally the user does not need to specify this option.\n It is used internally by installnode and makenode to ensure\n correct operation even when name resolution of the hostname\n value on the node results in a different name than the\n management server knows it by. This argument is only valid\n when a hostname or ipaddr for the management server is also\n specified.\n -N Display the value for the local nodename along with the\n management server. This argument is only valid when a\n hostname or ipaddr for the management server is not \n specified.\n -k Re-exchange the public keys with the management server also.\n -v | -V Verbose mode, including messages from the DBI layer.\n -h Display this usage information.\n host The hostname or IP address of the CSM management server that\n will be managing this node. If no host is specified (and -d\n is not specified) the current setting will be displayed. In\n this case, the exit status can be examined to distinguish\n between nodes and the management server as follows:\n 0: this is only a node and the mgmt svr value is set\n 11: this is only a node and the mgmt svr value is not set\n 21: this is a mgmt svr and a node and the mgmt svr value is set to itself\n 22: this is a mgmt svr and a node and the mgmt svr value is set to another mgmt svr\n 23: this is a mgmt svr and a node and the mgmt svr value is not set\n 31: this is only a mgmt svr\n 101: this is neither a mgmt svr or a node\n' IMsgNOT_SET 2 6 'This node does not currently have a CSM management server managing it.\n' IMsgBOTH_ITSELF 3 6 '%1$s (This node is also the CSM management server for itself.)\n' IMsgBOTH_OTHER 4 6 '%1$s (This node is also the CSM management server for other nodes.)\n' IMsgBOTH_NOT_SET 5 6 'This machine is a CSM management server and a node, but the node does not currently have a CSM management server managing it.\n' IMsgMGMT_SVR 6 6 'This machine is a CSM management server.\n' IMsgMS_AND_LHN 7 6 'Management server: %1$s, Local node name: %2$s\n' EMsgNEITHER 8 6 '%1$s: 2651-023 This machine is neither a CSM management server or node. To make this machine a CSM management server, install csm.server. To make this machine a node, install csm.client.\n' EMsgNOT_A_NODE 9 6 '%1$s: 2651-024 The management server value cannot be set or removed. This machine is not a CSM node. A hostname or -d can only be specified on a machine that has csm.client installed.\n' EMsgDAEMON_NOT_STARTED 10 6 '%1$s: 2651-040 The %2$s daemon did not start or is not running.\n' dete kX0PB7u;]A;]A;]A ./opt/csm/pm/ArchiveUtils.pmmts# IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG #!/usr/bin/perl # @(#)30 1.49.1.1 src/csm/core/pm/ArchiveUtils.pm.perl, setup, csm_rveg, rvegs006a 9/30/04 10:00:49 # ##################################################################### package ArchiveUtils; use strict; # locale tells perl to honor locale for sorting, dates, etc. # More info about locale.pm and perl handling of locales can be found in # /usr/lib/perl5/5.6.0/locale.pm and the man page for perllocale. use locale; use Socket; my $msgs; my $distro; my $useTranslatedMsg; my %catHashes; my $csmroot; my ($MSGCAT, $MSGMAPPATH, $MSGSET); my $NO_NODERANGES; my $NODEGROUPEXPMEM_WARNING = 1; # $NodeUtils::NO_MESSAGES; # Set this to 1 if you do not want NodeUtils to # print any error msgs # $NodeUtils::errno; # Will be set if an error occurs. You must zero # this out before calling a NodeUtils function, # if you want to check it afterwards. BEGIN { # This enables us to redirect where it looks for other CSM files during development $csmroot = $ENV{'CSM_ROOT'} ? $ENV{'CSM_ROOT'} : '/opt/csm'; $MSGCAT = 'nodecmds.cat'; if (defined $::MSGMAPPATH) { $MSGMAPPATH = $ENV{'CSM_ROOT'} ? "$csmroot/msgmaps" : $::MSGMAPPATH; } else { $MSGMAPPATH = "$csmroot/msgmaps"; } $MSGSET = 'NodeUtils'; } umask(0022); # This sets umask for all CSM files so that group and world only # have read permissions. # To change it, simply use the umask call in your script, after # the "use ArchiveUtils;" line #-------------------------------------------------------------------------------- =head1 ArchiveUtils =head2 Package Description This program module file, supports the CSM/install archiving and open source dependencies. If adding to this file, please take a moment to ensure that: 1. Your contrib has a readable pod header describing the purpose and use of your contrib. 2. Your contrib is under the correct heading and is in alphabetical order under that heading. 3. You test your contribution by running from the command line: pod2html --verbose --title=ArchiveUtils ArchiveUtils.pm.perl --outfile=ArchiveUtils.html and examining the ./ArchiveUtils.html file in a browser. =cut #-------------------------------------------------------------------------------- =head2 Package Dependancies use strict; use Fcntl qw(:flock); use File::Basename; use File::Find; use File::Path; # Provides mkpath() =cut #-------------------------------------------------------------------------------- =head1 Subroutines by Functional Group =head2 Licence Support =cut #-------------------------------------------------------------------------------- =head3 display_opensrcLicence Display the open source product licence Arguments: rpm name Returns: none Globals: @::GPL_PACKAGES) $::DISPLAYED_GPL_LICENSE $::PREREQS_ATTR{ Error: none Example: ArchiveUtils->display_opensrcLicence( $rpmName ); Comments: none =cut #-------------------------------------------------------------------------------- sub display_opensrcLicence { my ($class, $rpm) = @_; # If this is one of the GPL open source packages, display a license # agreement. Don't display the license again if it has already been # displayed. if (grep(/^$rpm$/, @::GPL_PACKAGES) and !$::DISPLAYED_GPL_LICENSE) { if ($::PREREQS_ATTR{'PkgArchitecture'} =~ /ppc64/) { # NodeUtils->message('I', 'IMsgGPL_LICENSE_PPC64'); # NodeUtils->message('P', 'IMsgPRESS_ENTER_TO_INSTALL_PPC64'); } else { NodeUtils->message('I', 'IMsgGPL_LICENSE'); NodeUtils->message('P', 'IMsgPRESS_ENTER_TO_INSTALL'); my $t = ; chop($t); if (length($t) > 0) { NodeUtils->message('I', 'IMsgCSM_NOT_INSTALLING'); exit 1; } } # Set to 1 so the license is not displayed again. $::DISPLAYED_GPL_LICENSE = 1; } } #-------------------------------------------------------------------------------- =head3 invokeLAP Invoke the LAP tool and display the CSM license agreements. The LAP tool will be invoked and copy the LA and LI files to /var/opt/csm///license/.txt Where: = CSM Version (1.3, etc) = tryandbuy or full, depending upon the license. = one of the 17 supported LAP languages. Arguments: A string - either: "tab" or "full" Returns: one of [ 3 | 9 | 127 ] If everything ran successful, then LAP will return 9, otherwise, if the user returns 3, the license was not accepted. If something went wrong with the LAP tool, then an error of 127 will be returned. Error: 127 Example: Doesn't appear to be used in csm/install Comments: none =cut #-------------------------------------------------------------------------------- sub invokeLAP { my ($class, $licType) = @_; my ($csmVersion, $laDir, $strCmd, $rc); my $laptool = "/opt/csm/install/lapapp.jar"; # make sure that $licType is either tab or full if ($licType eq "tab") { $licType = "tryandbuy"; } elsif ($licType ne "full") { #print "don't know..\n"; return 127; } # get the CSM version: $csmVersion = InstallUtils->get_CSMVersion("csm.server"); $csmVersion = sprintf "%.1f", $csmVersion; # e.g. "1.3" # check that the LA and LI files are in place: if (NodeUtils->isLinux()) { $laDir = "/opt/csm/install/$csmVersion/Linux/license/$licType"; } else # AIX { $laDir = "/opt/csm/install/$csmVersion/AIX/license/$licType"; } unless (-f "$laDir/LA_en") { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E127', 'EMsgCANT_READ_FILE', "$laDir/LA_en" ); } # check that the LAP tool is in place: unless (-f "$laptool") { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E127', 'EMsgCANT_READ_FILE', $laptool); } # Everything should be in place now, so let's call LAP and construct the command: if (NodeUtils->isLinux()) { #try to find java my $found_java=0; my ($java, $rt, $i18n); my @output = NodeUtils->runcmd("$::LS -1d /opt/IBMJava\*"); while(($found_java!=1) && (@output)){ my $dir = shift @output; $dir =~ s/^\s*//; # Remove any leading whitespace $dir =~ s/\s*$//; # Remove any trailing whitespace my $tmp_java = "$dir/jre/bin/java"; my $tmp_rt = "$dir/jre/lib/rt.jar"; my $tmp_i18n = "$dir/jre/lib/i18n.jar"; if(-e "$tmp_java") { $found_java=1; $java = $tmp_java; $rt = $tmp_rt; $i18n = $tmp_i18n; } } if($found_java){ $strCmd = "$java -cp /opt/csm/install/lapapp.jar:${rt}:${i18n}:"; } else{ #try the old way # check that Java is installed... and use the right one. if (-d "/opt/IBMJava2-141") { $strCmd = "/opt/IBMJava2-141/jre/bin/java -cp "; $strCmd .= "/opt/csm/install/lapapp.jar:"; $strCmd .= "/opt/IBMJava2-141/jre/lib/rt.jar:"; $strCmd .= "/opt/IBMJava2-141/jre/lib/i18n.jar:"; } elsif (-d "/opt/IBMJava2-131") { $strCmd = "/opt/IBMJava2-131/jre/bin/java -cp "; $strCmd .= "/opt/csm/install/lapapp.jar:"; $strCmd .= "/opt/IBMJava2-131/jre/lib/rt.jar:"; $strCmd .= "/opt/IBMJava2-131/jre/lib/i18n.jar:"; } elsif (-d "/opt/IBMJava2-13") { $strCmd = "/opt/IBMJava2-13/jre/bin/java -cp "; $strCmd .= "/opt/csm/install/lapapp.jar:"; $strCmd .= "/opt/IBMJava2-13/jre/lib/rt.jar:"; $strCmd .= "/opt/IBMJava2-13/jre/lib/i18n.jar:"; } elsif (-d "/opt/IBMJava2-ppc-141") { $strCmd = "/opt/IBMJava2-ppc-141/jre/bin/java -cp "; $strCmd .= "/opt/csm/install/lapapp.jar:"; $strCmd .= "/opt/IBMJava2-ppc-141/jre/lib/rt.jar:"; $strCmd .= "/opt/IBMJava2-ppc-141/jre/lib/i18n.jar:"; } elsif (-d "/opt/IBMJava2-ppc-131") { $strCmd = "/opt/IBMJava2-ppc-131/jre/bin/java -cp "; $strCmd .= "/opt/csm/install/lapapp.jar:"; $strCmd .= "/opt/IBMJava2-ppc-131/jre/lib/rt.jar:"; $strCmd .= "/opt/IBMJava2-ppc-131/jre/lib/i18n.jar:"; } elsif (-d "/usr/lib/IBMJava2-1.3.1") { $strCmd = "/usr/lib/IBMJava2-1.3.1/jre/bin/java -cp "; $strCmd .= "/opt/csm/install/lapapp.jar:"; $strCmd .= "/usr/lib/IBMJava2-1.3.1/jre/lib/rt.jar:"; $strCmd .= "/usr/lib/IBMJava2-1.3.1/jre/lib/i18n.jar:"; } else # java isn't installed maybe { my $string = "IBMJava2-13[1]"; NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E127', 'EMsgMissingPackage', $string ); } } } else { # AIX #try to find java my $found_java=0; my ($java, $rt, $i18n); my @output = NodeUtils->runcmd("$::LS -1d /usr/java\*"); while(($found_java!=1) && (@output)){ my $dir = shift @output; $dir =~ s/^\s*//; # Remove any leading whitespace $dir =~ s/\s*$//; # Remove any trailing whitespace my $tmp_java = "$dir/jre/bin/java"; my $tmp_rt = "$dir/jre/lib/rt.jar"; my $tmp_i18n = "$dir/jre/lib/i18n.jar"; if(-e "$tmp_java") { $found_java=1; $java = $tmp_java; $rt = $tmp_rt; $i18n = $tmp_i18n; } } if($found_java){ $strCmd = "$java -cp /opt/csm/install/lapapp.jar:${rt}:${i18n}:"; } else{ if (-d "/usr/java141") { $strCmd = "/usr/java141/jre/bin/java -cp "; $strCmd .= "/opt/csm/install/lapapp.jar:"; $strCmd .= "/usr/java141/jre/lib/rt.jar:"; $strCmd .= "/usr/java141/jre/lib/i18n.jar:"; } else { $strCmd = "/usr/java131/jre/bin/java -cp "; $strCmd .= "/opt/csm/install/lapapp.jar:"; $strCmd .= "/usr/java131/jre/lib/rt.jar:"; $strCmd .= "/usr/java131/jre/lib/i18n.jar:"; } } } # this part of the command is common in both AIX and Linux: $strCmd .= " com.ibm.lex.lapapp.LAP "; $strCmd .= "-l $laDir "; $strCmd .= "-s /var/opt/csm/$csmVersion/$licType "; $strCmd .= "-text_only"; $rc = system("$strCmd"); $rc = $rc >> 8; # kill processes if they exist: if (NodeUtils->isLinux) { foreach (`ps -efl --columns 300 | grep lapapp | awk '{print \$4}'`) { chomp $_; `kill -9 $_ 2>/dev/null`; } } return $rc; } #-------------------------------------------------------------------------------- =head2 RPM Support =cut #-------------------------------------------------------------------------------- =head3 checkDistroCopied Determine if there are more than 100 files in /csminstall/RPMS directory Arguments: $rpmDirectory Returns: 1 - more than 100 files in /csminstall/RPMS 0 - eveything okay Globals: none Error: 1 Example: never used Comments: never used??? =cut #-------------------------------------------------------------------------------- sub checkDistroCopied { my ($class, $rpmdir) = @_; if (!-e "$rpmdir") { return 0; } my @output = `$::LS -l $rpmdir/ | /usr/bin/wc -l`; chomp @output; my $lines = $output[0]; $lines =~ s/\s+//; if ($lines > 100) { return 1; } else { return 0; } } #-------------------------------------------------------------------------------- =head3 checkForRpmTool Exits E2 if the rpm tool is not installed on the local host. =cut #-------------------------------------------------------------------------------- sub checkForRpmTool { my $ret_code; $ret_code = NodeUtils->get_CSMVersion("rpm"); if (length($ret_code) == 0) { NodeUtils->message('E2', 'EMsgNO_RPM'); } } #-------------------------------------------------------------------------------- =head3 checkRPMInstall Checks if a given rpm is installed. The full pathname of the rpm must be given. Arguments: $rpmName Returns: 0 - not installed 1 - installed Globals: $::PLTFRM $::rpmShortnames $::rpmBasenames Error: 0 Example: my $installed = ArchiveUtils->checkRPMInstall($rpmFileName); Comments: checkRPMInstall must be called before this function is used. =cut #-------------------------------------------------------------------------------- sub checkRPMInstall { my ($class, $filename) = @_; #rpm name my $file; if ($::PLTFRM eq "AIX") { my @output = `$::RPMCMD -q --qf %{NAME}-%{VERSION}-%{RELEASE} -p $filename`; chomp @output; $file = $output[0]; } else { my @path = split '/', $filename; $file = pop @path; } #determine if the given rpm is installed on the system #we need to check to see if this rpm is already installed my ($shortname, $basename, $p); my @parts = split /-/, $file; $shortname = shift @parts; SNAME: while ($p = shift @parts) { if ($p !~ m/^\d/) { #if it doesn't start with a digit $shortname .= "-$p"; } else { unshift @parts, $p; last SNAME; } } $basename = $shortname; $shortname .= "-" . $parts[0] . "-" . (split /\./, $parts[1])[0]; if (!exists $::rpmShortnames{$shortname}) { #so check the basename if (!exists $::rpmBasenames{$basename}) { #no version of this rpm is installed #push @rpms, $wholename; return 0; } else { # If the required os package is installed, CSM need not install them # This is because the cooperation between different the Service Level foreach my $rpm (@::linux_os_prereqs) { if ($rpm =~ /^(.*)\*$/) { $rpm=$1; } my $rpmname = substr ($shortname,0,length $rpm); if ($rpmname eq $rpm) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgRPM_ALREADY_INSTALLED', $file); return 1; } } # a different version of this rpm is installed #test to see if this rpm is installed # Check if the RPM is already installed at the correct version my $cmd = "$::RPMCMD -U --test $filename"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); my @cmdout = `LANG=C $cmd 2>&1`; my $rc = $? >> 8; my $cmdout = join('', @cmdout); # Put output into a single string if ($cmdout !~ /package .* is already installed/) { #not installed return 0; } } } NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgRPM_ALREADY_INSTALLED', $file); return 1; #it is installed } #-------------------------------------------------------------------------------- =head3 check_valid_install_distros Check whether current node's InstallDistributionName and InstallDistributionVersion is valid for full installation Arguments: $installMethod $distribution Returns: -1 - not valid 0 - valid Globals: none Error: returns -1 Example: my $installed = ArchiveUtils->check_valid_install_distros( $installMethod, $distribution ); Comments: none =cut #-------------------------------------------------------------------------------- sub check_valid_install_distros { my ($class, $installmethod, $distro) = @_; my @VALID_AUTOYAST_DISTROS = ('SuSE8.1', 'SLES8.1'); if (!grep(/^$distro$/, @VALID_AUTOYAST_DISTROS)) { return -1; } return 0; } #-------------------------------------------------------------------------------- =head3 getServiceLevel Notes: This routine just a temperary solution for RedHatEL-AS3 =cut #-------------------------------------------------------------------------------- sub getServiceLevel { my $readme = "/csminstall/Linux/$::DISTRO_NAME/$::DISTRO_VERSION/$::ARCH/README"; my $sp=undef; if(-l "$readme") { my $target = readlink "$readme"; if($target =~ /RedHatEL\-AS3\-ppc64/){ $sp = "QU1"; }elsif($target =~ /RedHatEL\-AS3\-QU2/){ $sp = "QU2"; } } return $sp; } # # Compatible for original routine # sub copyDistroCD { my ($class, $distro_top, $distro_name, $distro_version) = @_; my $orig_dir; if (( $::PLTFRM eq "AIX") && !(($::ATTRS{'InstallDistributionName'} =~ /SuSE/) || ($::ATTRS{'InstallDistributionName'} =~ /SLES/))) { #change to the destination dir. if on AIX copying RedHat CDs use Cwd; $orig_dir = getcwd(); chdir($distro_top); } ArchiveUtils->copyDistroPkgs($::ARCH,$distro_top,$distro_name,$distro_version,undef); ArchiveUtils->setupBootOrder($::ARCH,$distro_top,$distro_name,$distro_version,undef); if (($::PLTFRM eq "AIX") && !(($::ATTRS{'InstallDistributionName'} =~ /SuSE/) || ($::ATTRS{'InstallDistributionName'} =~ /SLES/))) { chdir($orig_dir); } } sub copyDistroPKGPATH { my ($class, $distro_top, $distro_name, $distro_version) = @_; my $orig_dir; if (( $::PLTFRM eq "AIX") && !(($::ATTRS{'InstallDistributionName'} =~ /SuSE/) || ($::ATTRS{'InstallDistributionName'} =~ /SLES/))) { #change to the destination dir. if on AIX copying RedHat CDs use Cwd; $orig_dir = getcwd(); chdir($distro_top); } ArchiveUtils->copyDistroPkgs($::ARCH,$distro_top,$distro_name,$distro_version,undef); ArchiveUtils->setupBootOrder($::ARCH,$distro_top,$distro_name,$distro_version,undef); if (($::PLTFRM eq "AIX") && !(($::ATTRS{'InstallDistributionName'} =~ /SuSE/) || ($::ATTRS{'InstallDistributionName'} =~ /SLES/))) { chdir($orig_dir); } } sub foundPkgPath { my ($class,$suffix)=@_; my @files=(); use DirHandle; $suffix=lc($suffix); foreach my $dir(@::PKGPATH) { next if(! -d $dir); push @files,$dir; my $d=new DirHandle "$dir"; if(defined $d) { while (defined($_ = $d->read)) { next if($_ eq "." || $_ eq ".."); next if($_ !~/$suffix$/); my $tmp_filenam="$dir"."/"."$_"; next if(! -f $tmp_filenam); push @files,$tmp_filenam; } } undef $d; } return @files; } sub probeImages { my ($class,$r_pkgpath,$r_disks)=@_; my @pkgpath = @$r_pkgpath; my @disks = @$r_disks; my $images = { }; my ($mntpoint,$ismounted); foreach my $diskref(@disks) { my $diskname = $diskref->{name}; my $disknum = $diskref->{num}; foreach my $path(@pkgpath) { $ismounted = 0; if(-f $path && $path =~ /iso$/ ) { # AIX does not support iso image next if ($::PLTFRM eq "AIX"); $mntpoint = ArchiveUtils->mount_iso_image($path); if($mntpoint) { $ismounted = 1; #$path = $mntpoint; }else{ NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgCANT_MOUNT', $path); next; } }elsif( -d $path){ $mntpoint = $path; } # valid the disk my $progref = $diskref->{diskid_searchprog}; my $progarg = $diskref->{diskid_searchargs}; if( &$progref($mntpoint,$progarg) ) { # yes , this is the required disk, save it $images->{$diskname}->{$disknum} = $path; } if($ismounted) { ArchiveUtils->unmount_iso_image($mntpoint); $ismounted = 0; } } } return $images; } sub is_req_disks_copied{ my ($class,$distro_top,$ref_disks)=@_; my @disks = @$ref_disks; foreach my $diskref(@disks) { next if(defined($diskref->{not_for_full_install}) && $diskref->{not_for_full_install} eq 'TRUE'); if(defined $diskref->{diskid_target}) { my $target = $diskref->{diskid_target}; if($target ne ""){ if(!-e "$distro_top/$target"){return 0;} } } } return 1; } sub remove_all_links{ my ($class,$basedir)=@_; my $d=new DirHandle "$basedir"; if(defined $d) { while (defined($_ = $d->read)) { next if($_ eq "." || $_ eq ".."); my $tmp_filenam="$basedir"."/"."$_"; if(-l "$tmp_filenam") { unlink($tmp_filenam); } } } undef $d; } sub setupBootOrder { my ($class,$arch,$distro_top, $distro_name,$distro_version,$sp) = @_; my ($cmd,$output); my (@origdirs,@spdirs); my ($first_origdir,$first_spdir); if($arch =~ /i.86/) { $arch = "i386"; } my @orig_disks=@{$::pkgdefs{'distro_disks'}}; # Make sure the original disks were copied if($distro_name =~ /SLES/ && !ArchiveUtils->is_req_disks_copied($distro_top,\@orig_disks)) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgDisksMissing'); } foreach my $diskref(@orig_disks){ if(!grep(/$diskref->{diskid_target}/,@origdirs)){ push(@origdirs,$diskref->{diskid_target}); } } $first_origdir = $orig_disks[0]->{diskid_target}; if($sp){ if(defined $::pkgdefs{'sp_disks'}{$sp}) { my @sp_disks=@{$::pkgdefs{'sp_disks'}{$sp}}; foreach my $diskref(@sp_disks){ if(!grep(/$diskref->{diskid_target}/,@spdirs)){ push(@spdirs,$diskref->{diskid_target}); } } $first_spdir = $sp_disks[0]->{diskid_target}; if(!ArchiveUtils->is_req_disks_copied($distro_top,\@sp_disks)){ NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgDisksMissing'); } }else{ NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgBadServiceLevel',$sp); } } if (($distro_name =~ /SuSE/) || ($distro_name =~ /SLES/)) { my $realRPMS = "$distro_top/$distro_name/RPMS"; if (($distro_name =~ /SLES/) && ($distro_version eq 8.1)) { foreach my $subpath(@origdirs){ $cmd = "cd $realRPMS; $::LN -s ../../$subpath/*/*/*.rpm ."; NodeUtils->runcmd($cmd,-1); } if ($sp) { foreach my $subpath(@spdirs){ $cmd = "cd $realRPMS; $::LN -s ../../$subpath/*/*/*.rpm ."; NodeUtils->runcmd($cmd,-1); } } $cmd = "$::COPY -a $distro_top/$first_origdir/yast $distro_top/$first_origdir/boot $distro_top/$first_origdir/content $distro_top/$first_origdir/media.1 $distro_top"; NodeUtils->runcmd($cmd,-1); if($arch =~ /ppc64/){ $cmd = "$::MKDIR $distro_top/yast"; NodeUtils->runcmd($cmd, -1); if($sp){ $cmd = "$::COPY -a $distro_top/$first_spdir/media.1 $distro_top/$first_spdir/driverupdate $distro_top/$first_spdir/boot $distro_top"; NodeUtils->runcmd($cmd, -1); $cmd= "$::MKDIR -p $distro_top/updates/kernel ; $::COPY $distro_top/$first_spdir/suse/ppc/kernel-ppc64*.ppc.rpm $distro_top/updates/kernel"; NodeUtils->runcmd($cmd, -1); } }else{ $cmd = "$::MKDIR -p $distro_top/yast/sles8/suse/setup/descr"; NodeUtils->runcmd($cmd,-1); $cmd = "$::COPY -a $distro_top/$first_origdir/suse/setup/descr $distro_top/yast/sles8/suse/setup"; NodeUtils->runcmd($cmd, -1); $cmd = "$::COPY -a $distro_top/$first_origdir/content $distro_top/$first_origdir/media.1 $distro_top/yast/sles8"; NodeUtils->runcmd($cmd,-1); if($sp){ $cmd = "$::COPY -a $distro_top/$first_spdir/linux $distro_top/$first_spdir/driverupdate $distro_top"; NodeUtils->runcmd($cmd,-1); $cmd = "$::COPY -a $distro_top/$first_spdir/boot/loader/linux $distro_top/boot/loader/"; NodeUtils->runcmd($cmd,-1); $cmd = "$::COPY -a $distro_top/$first_spdir/boot/loader/initrd $distro_top/boot/loader/"; NodeUtils->runcmd($cmd,-1); } } my $order = "$distro_top/yast/order"; my $instorder = "$distro_top/yast/instorder"; if($arch =~ /ppc64/){ if (open(FILE, ">$instorder")) { print FILE "$first_origdir\t$first_origdir\n"; if($sp) { print FILE "$first_spdir\t$first_spdir\n"; } close(FILE); } } if ( open(FILE, ">$order")) { if($arch =~ /ppc64/){ if ($sp) { print FILE "$first_spdir\t$first_spdir\n"; } print FILE "$first_origdir\t$first_origdir\n"; }else{ if ($sp=~ /SP3/) { print FILE "/$first_spdir\t/$first_spdir\n"; } my $sec_origdir=$orig_disks[1]->{diskid_target}; print FILE "/yast/sles8\t/$first_origdir\n"; print FILE "/yast/ul\t/$sec_origdir\n"; } close(FILE); } # end of SLES8.1 support }else{ # for SuSE $cmd = "cd $realRPMS; $::LN -s ../../suse/*/*.rpm ."; NodeUtils->runcmd($cmd,-1); #end of SuSE support } }# end of SuSE && SLES elsif($distro_name =~ /RedHat/){ ArchiveUtils->remove_all_links("$distro_top/RedHat"); ArchiveUtils->remove_all_links("$distro_top/RedHat/RPMS"); my $realRPMS = "$distro_top/RedHat/RPMS"; my $subDir = ""; if($sp ne undef){ # link the RPMS from GA disks first my $orig_subdir = "$distro_name$distro_version-$arch"; $cmd = "cd $realRPMS; $::LN -s ../../$orig_subdir/RedHat/RPMS/*.rpm . > /dev/null 2>&1"; NodeUtils->runcmd($cmd,-1); $subDir = "$distro_name$distro_version-$sp"; }else{ $subDir = "$distro_name$distro_version-$arch"; } $cmd = "cd $realRPMS; $::LN -s ../../$subDir/RedHat/RPMS/*.rpm . > /dev/null 2>&1"; NodeUtils->runcmd($cmd,-1); if(-e "$realRPMS/../../$subDir/RedHat/Updates") { $cmd = "cd $realRPMS; $::LN -s ../../$subDir/RedHat/Updates/*.rpm . > /dev/null 2>&1"; NodeUtils->runcmd($cmd,-1); } $cmd = "cd $distro_top; $::LN -sf $subDir/* . > /dev/null 2>&1;$::LN -sf $subDir/.* . > /dev/null 2>&1;"; NodeUtils->runcmd($cmd,-1); $cmd = "cd $distro_top/RedHat; $::LN -sf ../$subDir/RedHat/* . > /dev/null 2>&1"; NodeUtils->runcmd($cmd,-1); } if (($distro_name =~ /SuSE/) || ($distro_name =~ /SLES/)) { if (-f "$distro_top/media.1/info.txt") { $cmd = "$::RM $distro_top/media.1/info.txt"; NodeUtils->runcmd($cmd, 0); } } return; } sub copyDistroPkgs { my ($class,$arch,$distro_top, $distro_name,$distro_version,$sp) = @_; my ($cmd,$output,$orig_dir,$target,$ismounted,$pkghome); my ($progref,$progarg,$wrong_disk,$force_use_disk,$junk,$rc); my $platform = $::PLTFRM; if($arch =~ /i.86/) { $arch = "i386"; } my $orig_dir = getcwd(); # Create the directory if (!(-e $distro_top)) { $cmd = "$::MKDIR -p $distro_top;"; $output = NodeUtils->runcmd($cmd, 0); } my @disks=(); if(! defined($::pkgdefs{'distro_disks'}) ) { InstallUtils->get_pkgdefs($platform, $distro_name, $distro_version,$arch); } my @orig_disks=@{$::pkgdefs{'distro_disks'}}; if($sp eq ""){ @disks = @orig_disks; }else{ if($distro_name =~ /SLES/ && !ArchiveUtils->is_req_disks_copied($distro_top,\@orig_disks)) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgReqOrigDisks'); $rc = 0; goto done; } if(defined $::pkgdefs{'sp_disks'}{$sp}) { @disks=@{$::pkgdefs{'sp_disks'}{$sp}}; }else{ NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgBadServiceLevel',$sp); $rc = 0; goto done; } } if(scalar(@disks)<=0) { $rc = 0; goto done; } my @pkgpath = ArchiveUtils->foundPkgPath("iso"); my $images = ArchiveUtils->probeImages(\@pkgpath,\@disks); foreach my $diskref(@disks){ my $diskname = $diskref->{name}; my $disknum = $diskref->{num}; next if(defined($diskref->{not_for_full_install})); if(!defined $images->{$diskname}->{$disknum}) { # # the disk is not included either in PKGPATH or iso files list. # try to search pkgs from cd # # Is it a wrong disk? $wrong_disk = 1; # Should force to use the disk? $force_use_disk = 0; while($wrong_disk && !$force_use_disk) { # Prompt insert disk NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgINSERT_DISK', $diskname, $disknum ); NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'P', 'IMsgPRESS_ENTER'); $junk = getc; # Mount the CD-ROM if ($platform eq "AIX") { sleep(5);#this is needed for AIX and wont hurt Linux (too much) `$::UNMOUNT $::MNTCDROM 2>/dev/null 1>/dev/null`; InstallUtils->MountAixCdrom(); } else { $cmd = "$::MOUNT $::MNTCDROM"; # Ignore mount errors. Usually they are because # the CD was already mounted. NodeUtils->runcmd($cmd, -1); } # valid the disk if defined comp routine if(defined $diskref->{diskid_searchprog}){ $progref = $diskref->{diskid_searchprog}; $progarg = $diskref->{diskid_searchargs}; }else{ # suppose the inserted disk is correct if not defined # comp routine according to the orig logic $wrong_disk = 0; $ismounted = 1; $target = $::MNTCDROM; next; } if( &$progref($::MNTCDROM,$progarg) ) { $wrong_disk = 0; $target = $::MNTCDROM; $ismounted = 1; next; }else{ # wrong disk, print a warning message NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'W', 'EMsgWRONG_DISK', $diskname, $disknum); NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgPRESS_ENTER_OR_FORCE'); # Get user input $junk = getc; if ($junk eq "F" or $junk eq "f") { $force_use_disk = 1; $target = $::MNTCDROM; $ismounted = 1; next; } } } # end while($wrong_disk && $...) }else{ # # the disk is included in either PKGPATH or iso files list # $target = $images->{$diskname}->{$disknum}; # if the target is a iso image if( -f $target && $target=~/iso$/i ) { $target = ArchiveUtils->mount_iso_image($target); if($target) { $ismounted = 1; }else{ NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgCANT_MOUNT', $target); $ismounted = 0; } } } # Copy the contents of the Distro disk to /csminstall # Handle SLES 8.1 if($platform eq "Linux"){ $pkghome=$distro_top ."/". $diskref->{diskid_target}; if(! -d $pkghome){ $cmd = "$::MKDIR -p $pkghome"; NodeUtils->runcmd($cmd, -1); } $cmd = "$::TAR cf - -C $target . | $::TAR xvf - -C $pkghome; "; }else{ $cmd = "$::TAR cf - -C $target . | $::TAR xvf - "; } NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgCOPYING_DISK', $diskname, $disknum); $output = NodeUtils->runcmd($cmd, 0); &show_copy_progress($cmd,$target, $pkghome); # Unmount the CD-ROM if necessary if($ismounted) { if ($platform eq "AIX") { `$::UNMOUNT $target 2>/dev/null 1>/dev/null`; } else { $cmd = "$::UNMOUNT $target > /dev/null 2>&1"; NodeUtils->runcmd("$cmd", -1); } } } # end foreach my $diskref... $rc = 1; # successfully :) done: chdir($orig_dir); return $rc; } #-------------------------------------------------------------------------------- =head3 copyRpm Copies an rpm to a destination argument Arguments: $RpmFile, $Rpmpath, $destDir Returns: none Globals: none Error: exits on error from NodeUtils->run_cmd(...) Example: ArchiveUtils->copyRpm($basename, $path, $::INSTALLDIR_CSMINSTLP); Comments: none =cut #-------------------------------------------------------------------------------- sub copyRpm { my ($class, $rpmfile, $path, $destination) = @_; NodeUtils->message("I", 'IMsgCOPYING', $rpmfile); mkpath($destination, $::VERBOSE, 0755); NodeUtils->run_cmd("$::COPY $path/$rpmfile $destination"); NodeUtils->run_cmd("$::CHMOD +r $destination/$rpmfile"); #If there are any errors during the copy or chmod, run_cmd() exits. } #-------------------------------------------------------------------------------- =head3 copy_rpm Copies the rpms using the @::Rpms_to_be_copied and @::Rpm_name_path hash Arguments: none Returns: none Globals: @::Rpms_to_be_copied %::Rpm_name_path Error: csmInstall.cat E1 Example: ServerUtils->copy_rpm(); Comments: none =cut #-------------------------------------------------------------------------------- sub copy_rpm { foreach my $my_rpm (@::Rpms_to_be_copied) { my ($location, $destination, $full_name); $full_name = $::Rpm_name_path{$my_rpm}{'BaseName'}; $location = $::Rpm_name_path{$my_rpm}{'Location'}; $destination = $::Rpm_name_path{$my_rpm}{'Destination'}; # test parameters if ( !( (defined($full_name)) && (defined($location)) && (defined($destination)) ) ) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgNoRpmFound', $my_rpm); } NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgCOPYING', $full_name); =head3 mmm - copy_rpm ----------------- This disconnected block of code is being preserved in the file, rather than being removed. It is a part of a change which is pending, which, due to the scale of the change, is being defered to a bac or brahms, where it will be evaluated and accepted or rejected. ----------------- # There may be an rpm, which is contained in an iso image file # and listed in Rpms_to_be_copied. This filename would not be # in Rpm_name_path (by design for this fix). Check to see if the # rpm is in the RpmIndex as an "ISO". If it is, then copy it # using RpmIndex otherwise, error out. if ( RpmIndex->in_iso_image ( $full_name ) == $::OK ) { #print "copying $full_name in RpmIndex to $location\n"; RpmIndex->copy ($full_name, $destination ); } # need an else here # actually the logic is not quite there yet. =cut my $cmd = "$::COPY $location/$full_name $destination"; NodeUtils->runcmd("$cmd"); $cmd = "$::CHMOD +r $destination/$full_name"; NodeUtils->runcmd("$cmd"); } } #-------------------------------------------------------------------------------- =head3 create_rpm_list_to_copy This subroutine will create a real hash of the rpms to be copied, by comparing their versions. The final hash populated is %::Rpms_to_be_copied Arguments: none Returns: none Globals: %::temp_CmdLinePathVersionName $::PackageVersionName @::Rpms_to_be_copied (@::Rpms_not_found $::PackageVersionName $::PREREQS_ATTR{'OSName $::ATTRS Error: none Example: ServerUtils->create_rpm_list_to_copy(); Comments: none =cut #-------------------------------------------------------------------------------- sub create_rpm_list_to_copy { my (@my_rpm_array, @my_result); my $my_rpm_string; my @temp_RpmsNotFoundInCmdPath_array = (); foreach my $path (keys %::temp_CmdLinePathVersionName) { @my_rpm_array = (); foreach my $my_rpm (@{$::temp_CmdLinePathVersionName{$path}}) { push(@my_rpm_array, ($path . "/" . $my_rpm)); } $my_rpm_string = join(" ", @my_rpm_array); my $cmd = "$::RPMCMD -qp --qf '%{Name}::%{Version}::%{Release}::%{Arch}\n' $my_rpm_string"; @my_result = NodeUtils->runcmd("$cmd", -1); foreach my $i (@my_result) { if (!($i =~ /.*::.*::.*::.*/)) { if ($i =~ /warning/) { next; } else { my @error_message = split(/\s+/, $i); foreach my $p (@error_message) { if ($p =~ /\.rpm/) { my @full_path_name = split(/\//, $p); foreach my $temp (@full_path_name) { if ($temp =~ /\.rpm/) { my @rpm_full_name = split(/-/, $temp); my $rpm_name_base = shift(@rpm_full_name); NodeUtils->message('E1', 'EMsgInvalidRpm', $rpm_name_base); } } } } } } my ($name, $version, $release, $arch) = split(/::/, $i); if (exists $::CmdLinePathVersionName{$arch}) { if (exists $::CmdLinePathVersionName{$arch}{$name}) { my $ext_ver = $::CmdLinePathVersionName{$arch}{$name}{'Version'}; my $ext_rel = $::CmdLinePathVersionName{$arch}{$name}{'Release'}; if ( InstallUtils->testVersion( $version, ">=", $ext_ver, $release, $ext_rel ) ) { $::CmdLinePathVersionName{$arch}{$name}{'Version'} = $version; $::CmdLinePathVersionName{$arch}{$name}{'Release'} = $release; $::CmdLinePathVersionName{$arch}{$name}{'Location'} = $path; $::CmdLinePathVersionName{$arch}{$name}{'Longname'} = $name . "-" . $version . "-" . $release; } } else { $::CmdLinePathVersionName{$arch}{$name}{'Version'} = $version; $::CmdLinePathVersionName{$arch}{$name}{'Release'} = $release; $::CmdLinePathVersionName{$arch}{$name}{'Location'} = $path; $::CmdLinePathVersionName{$arch}{$name}{'Longname'} = $name . "-" . $version . "-" . $release; } } else { $::CmdLinePathVersionName{$arch}{$name}{'Version'} = $version; $::CmdLinePathVersionName{$arch}{$name}{'Release'} = $release; $::CmdLinePathVersionName{$arch}{$name}{'Location'} = $path; $::CmdLinePathVersionName{$arch}{$name}{'Longname'} = $name . "-" . $version . "-" . $release; } } } # check for the result with the temp_CmdLinePathVersionName #foreach my $arch (%::CmdLinePathVersionName) #{ #} #check the version and populate the to be copied hash and version not staisfied hash foreach my $arch (keys %::CmdLinePathVersionName) { if ($::COPY_OPT_FLAG) { #compare cm line vs defs foreach my $rpm_name (keys %{$::CmdLinePathVersionName{$arch}}) { my $def_ver = $::PackageVersionName{$rpm_name}{'Version'}; my $def_rel = $::PackageVersionName{$rpm_name}{'Release'}; my $cmd_line_ver = $::CmdLinePathVersionName{$arch}{$rpm_name}{'Version'}; my $cmd_line_rel = $::CmdLinePathVersionName{$arch}{$rpm_name}{'Release'}; if ( InstallUtils->testVersion($cmd_line_ver, ">", $def_ver, $cmd_line_rel, $def_rel) ) { #populate the copy hash push(@::Rpms_to_be_copied, $rpm_name); } elsif ( InstallUtils->testVersion($cmd_line_ver, "=", $def_ver, $cmd_line_rel, $def_rel) ) { #populate the copy hash push(@::Rpms_to_be_copied, $rpm_name); } else { # error :rpm of the required version not found push(@::Rpms_not_found, $rpm_name); } } } else { #compare and populate the copy hash only necessary # First check against the command line and if the rpms are # found than check the /csminstall.. directory foreach my $rpm_name (keys %{$::CmdLinePathVersionName{$arch}}) { if (exists $::PathVersionName{$arch}{$rpm_name}) { my $def_ver = $::PackageVersionName{$rpm_name}{'Version'}; my $def_rel = $::PackageVersionName{$rpm_name}{'Release'}; my $cmd_line_ver = $::CmdLinePathVersionName{$arch}{$rpm_name}{'Version'}; my $cmd_line_rel = $::CmdLinePathVersionName{$arch}{$rpm_name}{'Release'}; my $path_ver = $::PathVersionName{$arch}{$rpm_name}{'Version'}; my $path_rel = $::PathVersionName{$arch}{$rpm_name}{'Release'}; if ($::CmdLinePathVersionName{$arch}{$rpm_name}{'Longname'} eq $::PathVersionName{$arch}{$rpm_name}{'Longname'}) { #compare:Cmd vs defs and populate the copy hash the rpm if ( InstallUtils->testVersion( $cmd_line_ver, ">=", $def_ver, $cmd_line_rel, $def_rel) ) { #populate the copy hash push(@::Rpms_to_be_copied, $rpm_name); next; } else { push(@::Rpms_not_found, $rpm_name); next; } } else { #compare: command line vs path if ( InstallUtils->testVersion( $cmd_line_ver, ">=", $path_ver, $cmd_line_rel, $path_rel) ) { #compare :cmd vs defs if ( InstallUtils->testVersion( $cmd_line_ver, ">=", $def_ver, $cmd_line_rel, $def_rel ) ) { #populate the copy csm rpm push(@::Rpms_to_be_copied, $rpm_name); next; } else { push(@::Rpms_not_found, $rpm_name); next; } } else { if ( InstallUtils->testVersion( $path_ver, ">=", $def_ver, $path_rel, $def_rel) ) { next; } else { push(@::Rpms_not_found, $rpm_name); next; } } } } else { # path doesn't exist my $def_ver = $::PackageVersionName{$rpm_name}{'Version'}; my $def_rel = $::PackageVersionName{$rpm_name}{'Release'}; my $cmd_line_ver = $::CmdLinePathVersionName{$arch}{$rpm_name}{'Version'}; my $cmd_line_rel = $::CmdLinePathVersionName{$arch}{$rpm_name}{'Release'}; if ( InstallUtils->testVersion($cmd_line_ver, ">=", $def_ver, $cmd_line_rel, $def_rel) ) { #populate the copy hash push(@::Rpms_to_be_copied, $rpm_name); next; } else { push(@::Rpms_not_found, $rpm_name); next; } } } } } if ( (scalar(@::Rpms_not_found) >= 1) || (scalar(@my_result) == 0) || (scalar(@::RpmsNotFoundInCmdPath) >= 1)) { # check the /csminstall.. directory # gather the arch name and populate the valid arch array of # the PathVersionName hash depending on the os my (@my_temp_array, @valid_arch) = (); foreach my $arch (keys %::PathVersionName) { push(@my_temp_array, $arch); } if ($::PREREQS_ATTR{'OSName'} eq "AIX") { foreach my $arch (@my_temp_array) { if (($arch =~ /ppc/) || ($arch =~ /noarch/)) { push(@valid_arch, $arch); } } } elsif ( ($::PREREQS_ATTR{'OSName'} eq "Linux") || ($::ATTRS{'InstallOSName'} eq "Linux")) { foreach my $arch (@my_temp_array) { if ( ($arch =~ /86/) || ($arch =~ /ia64/) || ($arch =~ /ppc64/) || ($arch =~ /ppc/) || ($arch =~ /noarch/)) { push(@valid_arch, $arch); } } } chomp(@valid_arch); my (%temp_hash) = (); # remove the number for the rpm name in the RpmsNotFoundInCmdPath variable foreach my $rpm_name_notfound (@::RpmsNotFoundInCmdPath) { my @parts = split /-/, $rpm_name_notfound; my $shortname = shift @parts; my $p; SNAME: while ($p = shift @parts) { if ($p !~ m/^\d/) { #if it doesn't start with a digit $shortname .= "-$p"; } else { unshift @parts, $p; last SNAME; } } my $tmp_var1; my $my_rindex = rindex($shortname, "*"); if ($my_rindex != -1) { $tmp_var1 = substr($shortname, 0, rindex($shortname, "*")); } else { $tmp_var1 = $shortname; } $my_rindex = rindex($tmp_var1, "-"); if (($my_rindex + 1) == 0) { $shortname = $tmp_var1; } elsif (($my_rindex + 1) == length($tmp_var1)) { $shortname = substr($tmp_var1, 0, rindex($tmp_var1, "*")); } push(@temp_RpmsNotFoundInCmdPath_array, $shortname); } @my_temp_array = (@::Rpms_not_found, @temp_RpmsNotFoundInCmdPath_array); @::Rpms_not_found = InstallUtils->get_uniqu_arry_elemnts(@my_temp_array); my @temp_not_found_rpm = (); @temp_not_found_rpm = @::Rpms_not_found; @::Rpms_not_found = (); @::RpmsNotFoundInCmdPath = (); my (@temp_array, @Rpmfound) = (); if (scalar(@valid_arch) <= 0) { @::Rpms_not_found = @temp_not_found_rpm; } foreach my $my_rpm (@temp_not_found_rpm) { PATHVER: foreach my $arch (@valid_arch) { if (exists $::PathVersionName{$arch}{$my_rpm}) { my $def_ver = $::PackageVersionName{$my_rpm}{'Version'}; my $def_rel = $::PackageVersionName{$my_rpm}{'Release'}; my $path_ver = $::PathVersionName{$arch}{$my_rpm}{'Version'}; my $path_rel = $::PathVersionName{$arch}{$my_rpm}{'Release'}; if ( InstallUtils->testVersion( $path_ver, ">=", $def_ver, $path_rel, $def_rel ) ) { my %temp_Rpmsfound_hash = (); foreach my $my_Rpmfound (@::Rpmfound) { $temp_Rpmsfound_hash{$my_Rpmfound}++; } if (!exists($temp_Rpmsfound_hash{$my_rpm})) { push(@::Rpmfound, $my_rpm); last PATHVER; } else { push(@::Rpms_not_found, $my_rpm); next PATHVER; } } else { push(@::Rpms_not_found, $my_rpm); next PATHVER; } } else { push(@::Rpms_not_found, $my_rpm); next PATHVER; } } } @::Rpms_not_found = InstallUtils->get_uniqu_arry_elemnts(@::Rpms_not_found); my %temp_Rpms_hash = (); foreach my $my_Rpmfound (@::Rpmfound) { $temp_Rpms_hash{$my_Rpmfound}++; } foreach my $my_rpm_notfound (@::Rpms_not_found) { if (!exists($temp_Rpms_hash{$my_rpm_notfound})) { push(@temp_array, $my_rpm_notfound); } } @::Rpms_not_found = @temp_array; @temp_array = (); foreach my $my_rpm_notfound (@temp_RpmsNotFoundInCmdPath_array) { if (!exists($temp_Rpms_hash{$my_rpm_notfound})) { push(@temp_array, $my_rpm_notfound); } } @temp_RpmsNotFoundInCmdPath_array = @temp_array; } my %temp_hash = (); if (scalar(@::Rpms_to_be_copied) >= 1) { foreach my $rpm (@::Rpms_to_be_copied) { $temp_hash{$rpm}++; } foreach my $rpm (@temp_RpmsNotFoundInCmdPath_array) { if (!exists($temp_hash{$rpm})) { push(@::Rpms_not_found, $rpm); } } @::Rpms_not_found = InstallUtils->get_uniqu_arry_elemnts(@::Rpms_not_found); } } #-------------------------------------------------------------------------------- =head3 create_rpm_list_to_install Create the rpm list to be installed. The %::Rpms_to_be_installed hash the List of the rpms to be installed. %::Rpms_already_installed hash has the list of rpms that are already been installed and %::RpmsNotFoundInCmdPath hash has the rpms list which are not found. Arguments: none Returns: none Globals: %::Rpms_to_be_installed %::Rpms_already_installe %::RpmsNotFoundInCmdPath $::CmdLinePathVersionName $::PackageVersionName_Server Error: none Example: ServerUtils->create_rpm_list_to_install(); Comments: none =cut #-------------------------------------------------------------------------------- sub create_rpm_list_to_install { my (@my_rpm_array, @my_result); my $my_rpm_string; foreach my $path (keys %::temp_CmdLinePathVersionName) { @my_rpm_array = (); foreach my $my_rpm (@{$::temp_CmdLinePathVersionName{$path}}) { push(@my_rpm_array, ($path . "/" . $my_rpm)); } $my_rpm_string = join(" ", @my_rpm_array); my $cmd = "$::RPMCMD -qp --qf '%{Name}::%{Version}::%{Release}::%{Arch}\n' $my_rpm_string"; @my_result = NodeUtils->runcmd("$cmd", -1); foreach my $i (@my_result) { if (!($i =~ /.*::.*::.*::.*/)) { next; } my ($name, $version, $release, $arch) = split(/::/, $i); chomp($arch); if (exists $::CmdLinePathVersionName{$arch}) { if (exists $::CmdLinePathVersionName{$arch}{$name}) { my $ext_ver = $::CmdLinePathVersionName{$arch}{$name}{'Version'}; my $ext_rel = $::CmdLinePathVersionName{$arch}{$name}{'Release'}; if ( InstallUtils->testVersion( $version, ">=", $ext_ver, $release, $ext_rel ) ) { $::CmdLinePathVersionName{$arch}{$name}{'Version'} = $version; $::CmdLinePathVersionName{$arch}{$name}{'Release'} = $release; $::CmdLinePathVersionName{$arch}{$name}{'Location'} = $path; $::CmdLinePathVersionName{$arch}{$name}{'Longname'} = $name . "-" . $version . "-" . $release; } } else { $::CmdLinePathVersionName{$arch}{$name}{'Version'} = $version; $::CmdLinePathVersionName{$arch}{$name}{'Release'} = $release; $::CmdLinePathVersionName{$arch}{$name}{'Location'} = $path; $::CmdLinePathVersionName{$arch}{$name}{'Longname'} = $name . "-" . $version . "-" . $release; } ## } else { $::CmdLinePathVersionName{$arch}{$name}{'Version'} = $version; $::CmdLinePathVersionName{$arch}{$name}{'Release'} = $release; $::CmdLinePathVersionName{$arch}{$name}{'Location'} = $path; $::CmdLinePathVersionName{$arch}{$name}{'Longname'} = $name . "-" . $version . "-" . $release; } } } #check the version and populate the to be copied hash and version not staisfied hash foreach my $arch (keys %::CmdLinePathVersionName) { foreach my $rpm_name (keys %{$::CmdLinePathVersionName{$arch}}) { if (exists $::rpmBasenames{$rpm_name}) { my $def_ver = $::PackageVersionName_Server{$rpm_name}{'Version'}; my $def_rel = $::PackageVersionName_Server{$rpm_name}{'Release'}; my $path_ver = $::CmdLinePathVersionName{$arch}{$rpm_name}{'Version'}; my $path_rel = $::CmdLinePathVersionName{$arch}{$rpm_name}{'Release'}; my $exist_ver = $::rpmBasenames{$rpm_name}{'Version'}; my $exist_rel = $::rpmBasenames{$rpm_name}{'Release'}; if ( InstallUtils->testVersion( $path_ver, ">=", $def_ver, $path_rel, $def_rel ) ) { if ($::CmdLinePathVersionName{$arch}{$rpm_name}{'Longname'} eq $::rpmBasenames{$rpm_name}{'Longname'}) { push(@::Rpms_already_installed, $rpm_name); next; } elsif ( InstallUtils->testVersion($path_ver, ">", $exist_ver, $path_rel, $exist_rel) ) { push(@::Rpms_to_be_installed, $rpm_name); next; } elsif ( InstallUtils->testVersion( $path_ver, "<=", $exist_ver, $path_rel, $exist_rel) ) { push(@::Rpms_already_installed, $rpm_name); next; } } else { if ( InstallUtils->testVersion( $exist_ver, ">=", $def_ver, $exist_rel, $def_rel ) ) { push(@::Rpms_not_found_installed, $rpm_name); next; } else { push(@::Rpms_not_found, $rpm_name); next; } } } else { # rpm not in the already installed list my $def_ver = $::PackageVersionName_Server{$rpm_name}{'Version'}; my $def_rel = $::PackageVersionName_Server{$rpm_name}{'Release'}; my $path_ver = $::CmdLinePathVersionName{$arch}{$rpm_name}{'Version'}; my $path_rel = $::CmdLinePathVersionName{$arch}{$rpm_name}{'Release'}; if ( InstallUtils->testVersion( $path_ver, ">=", $def_ver, $path_rel, $def_rel ) ) { push(@::Rpms_to_be_installed, $rpm_name); next; } else { push(@::Rpms_not_found, $rpm_name); next; } } } } my %temp_hash = (); if ($::FORCE_INSTALL) { @::Rpms_to_be_installed = (@::Rpms_to_be_installed, @::Rpms_already_installed); @::Rpms_already_installed = (); } foreach my $rpm (@::Rpms_to_be_installed) { $temp_hash{$rpm}++; } foreach my $rpm (@::RpmsNotFoundInCmdPath) { if (!exists($temp_hash{$rpm})) { push(@::Rpms_not_found, $rpm); } } } #-------------------------------------------------------------------------------- =head3 createRPMSdir Creates the proper /csminstall/.../RPMS directory structure Arguments: $OS $distro_name $distro_version $arch Returns: undefined Globals: none Error: undefined Example: ServerUtils->createRPMSdir ( "Linux", $::DISTRO_NAME, $::DISTRO_VERSION, $::ARCH); Comments: none =cut #-------------------------------------------------------------------------------- sub createRPMSdir { my ($class, $OS, $dist, $distver, $arch) = @_; use File::Path; # Provides mkpath() my $base = InstallUtils->getBaseDir($OS, $dist, $distver, $arch); my $SMS_RPMS = InstallUtils->getRPMSDir($OS, $dist, $distver, $arch); my $SMS_updates = InstallUtils->getUpdateDir($OS, $dist, $distver, $arch); my $SMS_install = InstallUtils->getInstallDir($OS, $dist, $distver, $arch); my $realRPMS = InstallUtils->getRealRPMSDir($OS, $dist, $distver, $arch); if (!-e "$base") { mkpath($base, $::VERBOSE, 0755); } if (!-e "$realRPMS") { mkpath($realRPMS, $::VERBOSE, 0755); } if (!-e "$SMS_updates") { mkpath($SMS_updates, $::VERBOSE, 0755); } if (!-e "$SMS_install") { mkpath($SMS_install, $::VERBOSE, 0755); } # Now we make new symbolic links to make sure they are # up to date if ($dist =~ /RedHat/) { #this is a symbolic link to ->RedHat/RPMS # force the change to make the symbolic link # relative, instead of full path. if (-d $SMS_RPMS) { #print "removing $SMS_RPMS\n"; NodeUtils->runcmd("rm $SMS_RPMS"); } #print "Now linking\n"; #print "dir: $realRPMS\n"; my $basedir = "$realRPMS/../../"; my @pa = split("/", $realRPMS); my $srcd = pop @pa; $srcd = pop(@pa) . "/" . $srcd; $basedir = join("/", @pa); #print "basedir: $basedir\nsrc: $srcd\n"; my (undef, $target) = split("$basedir/", $SMS_RPMS); #print "target: $target\n"; my $ln_cmd = "cd $basedir; $::LN -s $srcd $target"; #print "LInk: $ln_cmd\n"; NodeUtils->runcmd($ln_cmd, 0); } #SuSE Changes elsif ($dist =~ /SuSE/ || $dist =~ /SLES/) { if (-d $SMS_RPMS) { #print "removing $SMS_RPMS\n"; NodeUtils->runcmd("rm $SMS_RPMS"); } #print "Now linking\n"; #print "dir: $realRPMS\n"; my $basedir = "$realRPMS/../../"; my @pa = split("/", $realRPMS); my $srcd = pop @pa; $srcd = pop(@pa) . "/" . $srcd; $basedir = join("/", @pa); #print "basedir: $basedir\nsrc: $srcd\n"; my (undef, $target) = split("$basedir/", $SMS_RPMS); #print "target: $target\n"; my $ln_cmd = "cd $basedir; $::LN -s $srcd $target"; #print "LInk: $ln_cmd\n"; NodeUtils->runcmd($ln_cmd, 0); #End of SuSE Changes } else { mkpath($SMS_RPMS, $::VERBOSE, 0755); } } #-------------------------------------------------------------------------------- =head3 createRPMList Creates a global hash of installed RPMS. Arguments: none Returns: none Globals: $::rpmShortnames $::rpmBasenames Error: undefined Example: ArchiveUtils->createRPMList(); Comments: Subroutine must be called before checkRPMInstall. =cut #-------------------------------------------------------------------------------- sub createRPMList { #first run rpm -qa to get a list of all rpms installed my @output = `$::RPMCMD -qa`; foreach my $line (@output) { chomp $line; $::rpmShortnames{$line} = 1; #now create the basename my @parts = split /-/, $line; my $basename = shift @parts; my $p; BNAME: while ($p = shift @parts) { if ($p !~ m/^\d/) { #if it doesn't start with a digit $basename .= "-$p"; } else { unshift @parts, $p; last BNAME; } } $::rpmBasenames{$basename} = 1; } } #-------------------------------------------------------------------------------- =head3 createRPMVersionListAlreadyInstalled Create a list(hash) of rpm's version, release and long name which are already been installed on the machine. This routine can replace the routine createRPMList. This routine also sets the variable which has been already used. Arguments: none Returns: undefined Globals: none Error: none Example: # determine if an rpm has already been installed ServerUtils->createRPMVersionListAlreadyInstalled(); Comments: none_ =cut #-------------------------------------------------------------------------------- sub createRPMVersionListAlreadyInstalled { #first run rpm -qa to get a list of all rpms installed my @output = `$::RPMCMD -qa --qf '%{Name}::%{Version}::%{Release}::%{Arch}\n'`; chomp @output; my ($name, $version, $release, $arch); foreach my $line (@output) { chomp $line; ($name, $version, $release, $arch) = split(/::/, $line); my $longname = $name . "-" . $version . "-" . $release; $::rpmBasenames{$name}{'Version'} = $version; $::rpmBasenames{$name}{'Release'} = $release; $::rpmBasenames{$name}{'Longname'} = $longname; $::rpmBasenames{$name}{'Arch'} = $arch; $::rpmShortnames{$longname} = 1; } } #-------------------------------------------------------------------------------- =head3 createBatch Groups the given nodes according to the fanout value. Arguments: $nodeList $batchNodes $fanout Returns: Fills $batchNodes. Globals: none Error: undefined Example: my (@nodeList) = @_; my @batch = (); my $fanout = $ENV{'CSM_FANOUT'}; if ($fanout eq '') { $fanout = $::DEFAULT_FANOUT; } ArchiveUtils->createBatch(\@nodeList, \@batch, $fanout); Comments: =cut #-------------------------------------------------------------------------------- sub createBatch { shift; my ($nodeList, $batchNodes, $fanout) = @_; my $length = @$nodeList; if ($length <= $fanout) { push(@$batchNodes, $nodeList); } else { #group them by the size of fanout value my $size = $fanout; my @batch; foreach my $node (@$nodeList) { push(@batch, $node); $size--; unless ($size) { my @newBatch = @batch; push(@$batchNodes, \@newBatch); $size = $fanout; @batch = (); } } #end of foreach if (@batch) { #last batch push(@$batchNodes, \@batch); } } # end of else } #-------------------------------------------------------------------------------- =head3 displayProgress Shows the %value of CD copy. This function is intended to be used by show_copy_progress subroutine. Arguments: $lastFile $total $totalSize $isLastFile Returns: $total Globals: none Error: undefined Example: none Comments: This function is intended to be used by show_copy_progress subroutine. =cut #-------------------------------------------------------------------------------- sub displayProgress { my ($lastFile, $total, $totalSize, $isLastFile) = @_; my @sizeString = (); my $size = 0; @sizeString = NodeUtils->runcmd("du -a $lastFile", -1); my ($size) = split(/\s+/, $sizeString[0]); $size =~ s/^\s*//; # Remove any leading whitespace $size =~ s/\s*$//; # Remove any trailing whitespace if ($size =~ /\d+/) { $total = $total + $size; my $progress = int(($total / $totalSize) * 100); if ($progress > 100) { $progress = 100; } if ($isLastFile) { print("$progress% complete...\n"); } else { print("$progress% complete...\r"); } } # end of else return $total; } #-------------------------------------------------------------------------------- =head3 findImagesInPath Find the images in the given path. Arguments: $image @path Returns: @array of found $images in $path Globals: none Error: undefined Example: my @images = ServerUtils->findImagesInPath($file, @::PKGPATH); Comments: The $image parameter can have a *, i.e. the routine can find more than one $image in the $path. =cut #-------------------------------------------------------------------------------- sub findImagesInPath { # the $image variable may have a *, so we may find more than one that # matches. my ($class, $image, @path) = @_; my (@tmpImages, @returnImages, $tmpImage, $realImage); foreach my $p (@path) { my $filename = "$p/$image"; # use the ls command here instead of the -e operator # so we can handle *s in the names if (`/bin/ls $filename 2> /dev/null`) { # put all of the images we just got into @tmpImages array chomp(@tmpImages = `/bin/ls $filename`); # Go through each tmpImage and see if the base name already # exists in the returnImages array. If it does exist, don't # put it in, otherwise, put it in! foreach $tmpImage (@tmpImages) { # get the base name of the test image. my $tstImageBaseName; my $defined = 0; ($tstImageBaseName = $tmpImage) =~ s:^.*/::g; foreach $realImage (@returnImages) { # get the base name of the real image my $realImageBaseName; ($realImageBaseName = $realImage) =~ s:^.*/::g; if ($realImageBaseName eq $tstImageBaseName) { $defined = "true"; last; } } unless ($defined) { push @returnImages, $tmpImage; } else { print "\n\nnot copying $tmpImage\n\n"; } } } } return @returnImages; } #-------------------------------------------------------------------------------- =head3 findRpm Try to find and return the rpm file that is the required version. Arguments: $pkg $operator $version @my_pat Returns: Full package name of required rpm - as a string. Globals: @::VALID_DISTRO $::TFTPBOOT $::DISTRO_SHORTNAME $::DISTRO_RPMDIR Error: messageFromCat E11 Example: my $newrpm = InstallUtils->findRpm( $pkg, $operator, $version, @my_path); Comments: none =cut #-------------------------------------------------------------------------------- sub findRpm { my ($class, $pkg, $operator, $version, @my_path) = @_; my $os_rpm_path = $my_path[0]; my $pkg_rpm_path = $my_path[1]; if ($::PREREQS_ATTR{'OSName'} eq "Linux") { # Get the current distribution if it was not already obtained. my $distro = $::DISTRO; if (!$distro) { $distro = NodeUtils->get_DistributionName . " " . NodeUtils->get_DistributionVersion; if (!grep(/^$distro$/, @::VALID_DISTROS)) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'W', 'EMsgUNSUPPORTED_DISTRO', $distro, join(', ', @::VALID_DISTROS)); } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgDETECTED_DISTRO', $distro); } } } # note: The -vr options on the ls command gives us the entries in # reverse version order to get the latest version first. my @rpms; my @rpms1; my @rpms2; # Look for the rpm in packages if (NodeUtils->isLinux) { @rpms1 = NodeUtils->runcmd("$::LS -vr $pkg_rpm_path/$pkg-*", -1); } else { @rpms1 = NodeUtils->runcmd("$::LS $pkg_rpm_path/$pkg-*", -1); } my $rc1 = $::RUNCMD_RC; if (!$rc1) { @rpms = (@rpms, @rpms1); } # Only add if no errors # Look for the rpm in RPMS #my $TFTPBOOT_DISTRORPM = "$::TFTPBOOT/$::DISTRO_SHORTNAME{$distro}/$::DISTRO_RPMDIR{$distro}"; if (NodeUtils->isLinux) { @rpms2 = NodeUtils->runcmd("$::LS -vr $os_rpm_path/$pkg-*", -1); } else { @rpms2 = NodeUtils->runcmd("$::LS $os_rpm_path/$pkg-*", -1); } my $rc2 = $::RUNCMD_RC; if (!$rc2) { @rpms = (@rpms, @rpms2); } # Only add if no errors if (($rc1 && $rc2) || !scalar(@rpms)) { return undef; } foreach my $r (@rpms) { #my ($ipkg, $iversion, $irelease) = split('-', $r); my ($fn) = $r =~ m|^.*?([^/]+)$|; # get rid of the directory, if any #print "fn=$fn\n"; my ($ipkg, $iversion, $irelease) = $fn =~ /^(.+)-(\d.*)-(.*)$/; #print "ipkg=$ipkg, iversion=$iversion, irelease=$irelease\n"; # Note: irelease has .i386.rpm on the end of it if ($ipkg ne $pkg || !length($iversion)) { next; } if ( !length($operator) || !length($version) || InstallUtils->testVersion($iversion, $operator, $version)) { $operator = " " if (!$operator); $version = " " if (!$version); NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgFOUND', $r, $operator, $version ); return $r; } } return undef; # didn't find a suitable rpm } #-------------------------------------------------------------------------------- =head3 findRpmInPath Find the rpm package in the given path Arguments: $rpmPackageName @path Returns: Absolute path to rpm package. Package name is not returned with path value. Globals: none Error: none Example: $path = ArchiveUtils->findRpmInPath($rpmfile, @my_path); Comments: none =cut #-------------------------------------------------------------------------------- sub findRpmInPath { my ($class, $rpmfile, @path) = @_; foreach my $p (@path) { my $filename = "$p/$rpmfile"; # use the ls command here instead of the -e operator so we can handle *s in the names #print "looking for $filename: ", `/bin/ls $filename`, "\n"; if (`/bin/ls $filename 2> /dev/null`) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgFOUND_RPM', $rpmfile, $p ); return $p; } } return undef; } #-------------------------------------------------------------------------------- =head3 findRpmInPath_java Find the IBMJava rpm package in the given path Arguments: $rpmFile @path Returns: rpm name as a string or undef. Globals: none Error: none Example: $path = ArchiveUtils->findRpmInPath_java ( $rpm_pre_file, @full_PKGPATH ); Comments: none =cut #-------------------------------------------------------------------------------- sub findRpmInPath_java { my ($class, $rpmfile, @path) = @_; foreach my $p (@path) { my $filename = "$p/$rpmfile"; # use the ls command here instead of the -e operator so we can handle *s in the names if (`/bin/ls $filename 2> /dev/null`) { # process the rpm name for the packager... my @outout = NodeUtils->runcmd( "$::RPMCMD -qp --qf '%{Name}::%{Version}::%{Release}::%{Arch}::%{Vendor}\n' $filename", -1 ); foreach my $i (@outout) { if (!($i =~ /.*::.*::.*::.*::.*/)) { next; } my ($name, $version, $release, $arch, $packager_name) = split(/::/, $i); if ( ($packager_name =~ /International Business Machines/) || ($packager_name =~ /UnitedLinux/)) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgFOUND_RPM', $rpmfile, $p); return $p; } else { next; } } } =head3 mmm - findRpmInPath ----------------- This disconnected block of code is being preserved in the file, rather than being removed. It is a part of a change which is pending, which, due to the scale of the change, is being defered to a bac or brahms, where it will be evaluated and accepted or rejected. ----------------- # Check if rpmfile is in an iso image. If we got here # we can assume that it will be in an iso image if it exists # in RpmIndex. If in_iso is true, then return the path # otherwise return undef. When it gets copied we need to # be there to resolve any iso_image issues (ie mount and copy). # find keys matching $rpmfile wildcard string my $hash_ref = RpmIndex->defs_filter ( $rpmfile ); my %ret_hash = %$hash_ref; foreach my $arch ( keys %ret_hash) { my $array = @ret_hash { $arch }; foreach my $key ($array) { if ( RpmIndex->in_iso_image ( $rpmfile ) == $::OK ) { my $ret_path = RpmIndex->path_filter ( $key ); #print "findRpmInPath: returning $ret_path \n"; return $ret_path; } } } =cut } return undef; } #-------------------------------------------------------------------------------- =head3 get_csminstall_pathVersion Get the version & release of the rpms in the /csminstall/{Linux|AIX} path. This routine will populate the PathVersionName hash Arguments: none Returns: undefined Globals: $::CSMINSTALLPATH_FLAG $::PREREQS_ATTR $::INSTALLDIR_CSMPKG $::INSTALLDIR_OS_NAME_RPMS $::PathVersionName Error: NodeUtills=->message E2 Example: ServerUtils->get_csminstall_pathVersion(); Comments: none =cut #-------------------------------------------------------------------------------- sub get_csminstall_pathVersion { $::CSMINSTALLPATH_FLAG = 0; my ($my_path1, $my_path2); if ( ($::PREREQS_ATTR{'OSName'} eq "Linux") || ($::ATTRS{'InstallOSName'} eq "Linux")) { $my_path1 = $::INSTALLDIR_CSMPKG; $my_path2 = $::INSTALLDIR_OS_NAME_RPMS; my (@my_rpms, @my_result, @my_temp_array) = (); my @my_path = ($my_path1, $my_path2); foreach my $mydir (@my_path) { opendir RPMDIR, $mydir; # use two temp files to handle each rpm file # only grep *.rpm files ( not . and .. files ) my $myfile1 = "/tmp/csm_$$.1"; my $myfile2 = "/tmp/csm_$$.2"; open(TMPFILE1, ">$myfile1") || NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgCANT_WRITE_FILE', "$myfile1"); while ($_ = readdir(RPMDIR)) { my $file = "$mydir/$_"; if ($file !~ /\.rpm$/) { next; } print TMPFILE1 "$file\n"; } close TMPFILE1; if (-z $myfile1) { next; } my $cmd = "cat $myfile1 | xargs /bin/rpm -qp --qf '%{Name}::%{Version}::%{Release}::%{Arch}\n' > $myfile2"; system($cmd); open(TMPFILE2, "<$myfile2") || NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_READ_FILE', $myfile2); while () { my $k = $_; if (!($k =~ /.*::.*::.*::.*/)) { next; } my ($name, $version, $release, $arch) = split(/::/, $k); chomp($arch); # check if the arch exits if (exists $::PathVersionName{$arch}) { # check of the rpm already exits, if yes, than get the latest if (exists $::PathVersionName{$arch}{$name}) { my $ext_ver = $::PathVersionName{$arch}{$name}{'Version'}; my $ext_rel = $::PathVersionName{$arch}{$name}{'Release'}; if ( InstallUtils->testVersion( $version, ">=", $ext_ver, $release, $ext_rel ) ) { $::PathVersionName{$arch}{$name}{'Version'} = $version; $::PathVersionName{$arch}{$name}{'Release'} = $release; $::PathVersionName{$arch}{$name}{'Location'} = $mydir; $::PathVersionName{$arch}{$name}{'Longname'} = $name . "-" . $version . "-" . $release; } } else { $::PathVersionName{$arch}{$name}{'Version'} = $version; $::PathVersionName{$arch}{$name}{'Release'} = $release; $::PathVersionName{$arch}{$name}{'Location'} = $mydir; $::PathVersionName{$arch}{$name}{'Longname'} = $name . "-" . $version . "-" . $release; } } else { $::PathVersionName{$arch}{$name}{'Version'} = $version; $::PathVersionName{$arch}{$name}{'Release'} = $release; $::PathVersionName{$arch}{$name}{'Location'} = $mydir; $::PathVersionName{$arch}{$name}{'Longname'} = $name . "-" . $version . "-" . $release; } } close TMPFILE2; system("$::RM -f $myfile1"); system("$::RM -f $myfile2"); closedir RPMDIR; } } elsif ($::PREREQS_ATTR{'OSName'} eq "AIX") { } else { NodeUtils->message('E2', 'EMsgINVALID_OSTYPE'); } } #-------------------------------------------------------------------------------- =head3 get_definition_version Returns the version and release of the definition rpm/fileset which is defined in the defs file. I/P - rpm name from the defs file O/P - version and release delimited by "::" Arguments: rpm definition file name Returns: the string: "$version::$release" Globals: none Error: undefined Example: my($my_version, $my_release) = split(/::/,ServerUtils->get_definition_version($tmp_var_rpm)); Comments: none =cut #-------------------------------------------------------------------------------- sub get_definition_version { my ($class, $my_rpm_def) = @_; my ($req_ver, $req_rel); my ($tmp_var1, $tmp_var2, $tmp_var3); #get the base name of the rpm my $my_rindex = rindex($my_rpm_def, "*"); if ($my_rindex != -1) { $tmp_var1 = substr($my_rpm_def, 0, rindex($my_rpm_def, "*")); } else { $tmp_var1 = $my_rpm_def; } #get the version and release by processing the filename $my_rindex = rindex($tmp_var1, "-"); if (($my_rindex + 1) == 0) { $req_ver = 0; $req_rel = 0; } else { $tmp_var2 = substr($tmp_var1, rindex($tmp_var1, "-") + 1); $tmp_var1 = substr($tmp_var1, 0, rindex($tmp_var1, "-")); $my_rindex = rindex($tmp_var1, "-"); if ($my_rindex != -1) { $tmp_var3 = substr($tmp_var1, rindex($tmp_var1, "-") + 1); if (length($tmp_var2) > 0) { if ($tmp_var2 =~ /^[\d\.]*$/) { if ($tmp_var3 =~ /^[\d\.]*$/) { $req_ver = $tmp_var3; $req_rel = $tmp_var2; } else { $req_ver = $tmp_var2; $req_rel = 0; } } else { $req_ver = 0; $req_rel = 0; } } else { $req_ver = 0; $req_rel = 0; } } else { if (length($tmp_var2) > 0) { if ($tmp_var2 =~ /^[\d\.]*$/) { $req_ver = $tmp_var2; $req_rel = 0; } else { $req_ver = 0; $req_rel = 0; } } else { $req_ver = 0; $req_rel = 0; } } } my $return_str = $req_ver . "::" . $req_rel; return ($return_str); } #-------------------------------------------------------------------------------- =head3 getPackageList get packages lists Arguments: none Returns: # Lists of Open Source Packages that are required on the node @::opensrc_rpm_prereqs # Lists of packages that are part of each CSM component @::csm_packages # rsct client packages @::rsct_packages # director packages @::director_packages # Operating System Prereqs for Managed Nodes @::os_prereq @ package version name $::PackageVersionName Globals: see returns Error: multipl E1 msgs Example: ArchiveUtils->getPackageList(); Comments: none =cut #-------------------------------------------------------------------------------- sub getPackageList { %::pkgdefs = ServerUtils->get_pkgdefs( $::ATTRS{'InstallOSName'}, $::ATTRS{'InstallDistributionName'}, $::ATTRS{'InstallDistributionVersion'}, $::ATTRS{'InstallPkgArchitecture'}, 'MgdNode', $::ATTRS{'InstallCSMVersion'} ); if ($::ATTRS{'InstallOSName'} eq "AIX") { $::osTypeVersion = $::ATTRS{'InstallOSName'} . $::ATTRS{'InstallDistributionVersion'}; $::INSTALLDIR = "/csminstall"; $::INSTALLDIR_CSM = $::INSTALLDIR . "/csm"; $::INSTALLDIR_CSMVR = $::INSTALLDIR_CSM . "/" . $::ATTRS{'InstallCSMVersion'}; $::INSTALLDIR_CSMVRBIN = $::INSTALLDIR_CSMVR . "/bin"; $::INSTALLDIR_OS = $::INSTALLDIR . "/" . $::ATTRS{'InstallOSName'}; $::INSTALLDIR_OSVER = $::INSTALLDIR_OS . "/" . $::ATTRS{InstallDistributionVersion}; $::INSTALLDIR_OSCSM = $::INSTALLDIR_OS . "/csm"; $::INSTALLDIR_CSMVER = $::INSTALLDIR_OSCSM . "/" . $::ATTRS{'InstallCSMVersion'}; $::INSTALLDIR_CSMBIN = $::INSTALLDIR_CSMVER . "/bin"; $::INSTALLDIR_CSMPKG = $::INSTALLDIR_CSMVER . "/packages"; $::INSTALLDIR_CSMRPM = $::INSTALLDIR_CSMPKG . "/rpms"; $::INSTALLDIR_CSMINSTLP = $::INSTALLDIR_CSMPKG . "/installp"; # # create package lists # # List of Open Source Packages that are required on the node my @mgdnode_open_srcrpms = (@{$::pkgdefs{opensrc_prereqs}}); @::opensrc_rpm_prereqs = (@mgdnode_open_srcrpms); # Lists of packages that are part of each CSM component my @csm_client_packages = (@{$::pkgdefs{csm_packages}}); @::csm_packages = (@csm_client_packages); my @rsct_client_packages = (@{$::pkgdefs{rsct_packages}}); @::rsct_packages = (@rsct_client_packages); # Operating System Prereqs we need for Managed Nodes @::os_prereq = (@{$::pkgdefs{os_prereqs}}); } elsif ($::ATTRS{'InstallOSName'} eq "Linux") { $::osTypeVersion = $::ATTRS{'InstallOSName'} . $::ATTRS{'InstallDistributionName'} . $::ATTRS{'InstallDistributionVersion'}; $::INSTALLDIR = "/csminstall"; $::INSTALLDIR_CSM = $::INSTALLDIR . "/csm"; $::INSTALLDIR_CSMVR = $::INSTALLDIR_CSM . "/" . $::ATTRS{InstallCSMVersion}; $::INSTALLDIR_CSMVRBIN = $::INSTALLDIR_CSMVR . "/bin"; $::INSTALLDIR_OS = $::INSTALLDIR . "/" . $::ATTRS{"InstallOSName"} . "/" . $::ATTRS{'InstallDistributionName'}; #/csminstall/Linux/RedHat $::INSTALLDIR_OSVER = $::INSTALLDIR_OS . "/" . $::ATTRS{InstallDistributionVersion}; $::INSTALLDIR_OSVER_ARCH = $::INSTALLDIR_OSVER . "/" . $::ATTRS{'InstallPkgArchitecture'}; $::INSTALLDIR_OSCSM = $::INSTALLDIR_OS . "/csm"; $::INSTALLDIR_CSMVER = $::INSTALLDIR_OSCSM . "/" . $::ATTRS{InstallCSMVersion}; my $INSTALLDIR_OS_NAME = $::PREREQS_ATTR{DistributionName}; if ($::PREREQS_ATTR{DistributionName} =~ /RedHat/) { $INSTALLDIR_OS_NAME = "RedHat"; } $::INSTALLDIR_OS_NAME_RPMS = $::INSTALLDIR_OSVER_ARCH . "/" . $INSTALLDIR_OS_NAME . "/RPMS"; #/csminstall/Linux/RedHat/7.3/i386/RedHat/RPMS $::INSTALLDIR_CSMBIN = $::INSTALLDIR_CSMVER . "/bin"; $::INSTALLDIR_CSMPKG = $::INSTALLDIR_CSMVER . "/packages"; # # create package lists # # Lists of Open Source Packages that are required on the node my @mgdnode_open_srcrpms = (@{$::pkgdefs{opensrc_prereqs}}); @::opensrc_rpm_prereqs = (@mgdnode_open_srcrpms); # Lists of packages that are part of each CSM component my @csm_client_packages = (@{$::pkgdefs{csm_packages}}); @::csm_packages = (@csm_client_packages); my @rsct_client_packages = (@{$::pkgdefs{rsct_packages}}); @::rsct_packages = (@rsct_client_packages); # No need of director if the OS is AIX if ($::PLTFRM eq "Linux") { @::director_packages = (@{$::pkgdefs{director_packages}}); } else { @::director_packages = (); } # Operating System Prereqs for Managed Nodes @::os_prereq = (@{$::pkgdefs{os_prereqs}}); foreach my $tmp_var_rpm ( @::opensrc_rpm_prereqs, @::csm_packages, @::rsct_packages, @::director_packages, @::os_prereq ) { my ($my_version, $my_release) = split(/::/, ArchiveUtils->get_definition_version($tmp_var_rpm)); my @parts = split /-/, $tmp_var_rpm; my $basename = shift @parts; my $p; BNAME: while ($p = shift @parts) { if ($p !~ m/^\d/) { #if it doesn't start with a digit $basename .= "-$p"; } else { unshift @parts, $p; last BNAME; } } my $tmp_var1; my $my_rindex = rindex($basename, "*"); if ($my_rindex != -1) { $tmp_var1 = substr($basename, 0, rindex($basename, "*")); } else { $tmp_var1 = $basename; } $my_rindex = rindex($tmp_var1, "-"); if (($my_rindex + 1) == 0) { $basename = $tmp_var1; } elsif (($my_rindex + 1) == length($tmp_var1)) { $basename = substr($tmp_var1, 0, rindex($tmp_var1, "*")); } else { $basename = $tmp_var1; } $::PackageVersionName{$basename}{'Version'} = $my_version; $::PackageVersionName{$basename}{'Release'} = $my_release; $::PackageVersionName{$basename}{'FullName'} = $tmp_var_rpm; } } else { MessageUtils->message("E2", 'EMsgINVALID_OSTYPE'); } } #-------------------------------------------------------------------------------- =head3 get_PkgArchitecture Linux only routine. Returns the rpm package architure for the OS in $::PLTFRM i.e. i386 for linux Arguments: $output, $osarch Returns: none Globals: $::PLTFRM Error: messageFromCat E2 Example: $::ATTRS{'InstallPkgArchitecture'} = ServerUtils->get_PkgArchitecture; Comments: Works for Linux. Returns null values $::PLTFRM is AIX, and exits with E2 for any other $::PLTFRM. =cut #-------------------------------------------------------------------------------- sub get_PkgArchitecture { my ($cmd, $output, $osarch); if ($::PLTFRM eq "Linux") { $cmd = "$::UNAME -m"; $output = NodeUtils->runcmd($cmd); chomp($output); $osarch = $output; return (length($osarch) ? $osarch : undef); } elsif ($::PLTFRM eq "AIX") { $osarch = ""; return (length($osarch) ? $osarch : undef); } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E2', 'EMsgINVALID_OSTYPE'); } } #-------------------------------------------------------------------------------- =head3 getRealRPMSDir Get the RPMS directory for the install attributes parameters Arguments: $InstallOSName $InstallDistributionName $InstallDistributionVersion $InstallPkgArchitectur Returns: appropriate path name for parameter values Globals: none Error: none Example: my $realRPMS = ArchiveUtils->getRealRPMSDir($OS, $dist, $distver, $arch); Comments: none =cut #-------------------------------------------------------------------------------- sub getRealRPMSDir { my ($class, $os, $distributor, $version, $arch) = @_; my $distro_dir = $distributor; if ($distributor =~ /RedHat/) { $distro_dir = "RedHat"; } if ($arch =~ /i.86/) { $arch = "i386"; } return "/csminstall/$os/$distributor/$version/$arch/$distro_dir/RPMS"; } #-------------------------------------------------------------------------------- =head3 getRecentVersionRpm Get the most recent version of the rpm argument. Arguments: $rpmName Returns: Recent RPM as a string Globals: none Error: none Example: $rpmfile = ArchiveUtils->getRecentVersionRpm($path, $rpmFileName); Comments: none =cut #-------------------------------------------------------------------------------- sub getRecentVersionRpm { my ($class, $path, $rpm_name) = @_; my %localversions_hash = (); my %file_name_hash = (); my %packver; my $rpm_basename; my $test_rpm_name; my $test_rpm_name_short; my @output = NodeUtils->runcmd("$::LS -1 $path/$rpm_name"); chomp @output; # Determine the basename of this rpm (strip off .arch.rpm) # %::PackageVersionName hash. This code can handle an rpm # provided in these formats: # rpmname # rpmname* # rpmname-* # rpmname-** my (@test_rpm_split) = split(/\./, $rpm_name); my $splitpos = $#test_rpm_split - 2; $test_rpm_name = join('.', @test_rpm_split[0 .. $splitpos]); # Replace two *'s with one * (in case the rpm in pkgdefs already has a *) $test_rpm_name =~ s/\*\*$/*/; # Also, try stripping off the "-*" at the end $test_rpm_name_short = $test_rpm_name; $test_rpm_name_short =~ s/-\*$//; foreach my $r (keys %::PackageVersionName) { my $fullname = $::PackageVersionName{$r}{'FullName'}; if ( ($fullname eq $test_rpm_name) or ($fullname eq $test_rpm_name_short)) { $rpm_basename = $r; last; } } =head3 mmm - getRecentVersionRpm ----------------- This disconnected block of code is being preserved in the file, rather than being removed. It is a part of a change which is pending, which, due to the scale of the change, is being defered to a bac or brahms, where it will be evaluated and accepted or rejected. ----------------- # it might be in an iso file if (!$rpm_basename) { #print "getRecentVersionRpm: rpm_basename not found using defs_filter.\n"; my $hash_ref = RpmIndex->defs_filter ( $rpm_name ); my %ret_hash = %$hash_ref; my $key; foreach my $arch ( keys %ret_hash ) { my @key_array = @ret_hash { $arch }; foreach $key ( @key_array ) { #print "found $key\n"; } if (RpmIndex->in_iso_image($key) == $::OK ) { #print "found $key to be in an iso - returning it\n"; #$rpm_basename = $key; return $key; } } } =cut if (!$rpm_basename) { #print "CANNOT FIND BASENAME FOR $rpm_name\n"; NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgPREREQ_NOT_FOUND', $rpm_name, $path ); exit 1; } # if there is only one rpm with the same basename, then return that rpm name if (scalar(@output) == 1) { my ($fn) = $output[0] =~ m|^.*?([^/]+)$|; # get rid of the directory. # Get the basename of the rpm found in the path or on the CD. my ($ipkg, $VERSION, $RELEASE) = $fn =~ /^(.+)-(\d.*)-(\d.*)\..+\..+$/; # The name of the RPM must match the basename of the rpm in pkgdefs if ($rpm_basename ne $ipkg) { #print "$rpm_basename DOES NOT MATCH $ipkg\n"; NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgPREREQ_NOT_FOUND', $rpm_basename, $path ); exit 1; } return $output[0]; } # If there are multiple RPMs with the same basename, then compare their # versions to see which is the latest. my $i = 0; foreach my $rpm1 (@output) { ####jcran changes start #### --getting the version from the output of LS, instead of running rpm multiple times # my $VERSION=NodeUtils->runcmd("$::RPMCMD -qp --qf '%{Version}' $rpm1"); #my $VERSION=`rpm -qp --qf '%{Version}' $rpm1`; my ($fn) = $rpm1 =~ m|^.*?([^/]+)$|; # get rid of the directory, if any #print "fn=$fn\n"; #my ($ipkg, $VERSION) = $fn =~ /^(.+)-(\d.*)-.*$/; my ($ipkg, $VERSION, $RELEASE) = $fn =~ /^(.+)-(\d.*)-(\d.*)\..+\..+$/; ####jcran changes end chomp $VERSION; chomp $RELEASE; # The basename of the rpm must match the name given in pkgdefs if ($rpm_basename eq $ipkg) { $localversions_hash{$i}{'VERSION'} = $VERSION; $localversions_hash{$i}{'RELEASE'} = $RELEASE; $file_name_hash{$VERSION}{$RELEASE} = $rpm1; $i++; } } if ($i == 0) { #print "BASENAME DOES NOT MATCH NAME IN PKGDEFS FOR $rpm_basename\n"; NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgPREREQ_NOT_FOUND', $rpm_basename, $path ); exit 1; } my $versionout = ""; my $releaseout = ""; $i = 0; foreach my $k (keys %localversions_hash) { if ($i == 0) { $versionout = $localversions_hash{$k}{'VERSION'}; $releaseout = $localversions_hash{$k}{'RELEASE'}; } if ( InstallUtils->testVersion( $localversions_hash{$k}{'VERSION'}, ">", $versionout, $localversions_hash{$k}{'RELEASE'}, $releaseout ) ) { $versionout = $localversions_hash{$k}{'VERSION'}; $releaseout = $localversions_hash{$k}{'RELEASE'}; } $i++; } return ($file_name_hash{$versionout}{$releaseout}); } #-------------------------------------------------------------------------------- =head3 getReqsNotSatisfied Return the rpms (and versions) that the given rpm requires that are not already on the system Arguments: $rpmPackageName Returns: Posibly empty array of rpm package names. Globals: none Error: none Example: my @reqs = ArchiveUtils->getReqsNotSatisfied($rpm); Comments: none =cut #-------------------------------------------------------------------------------- sub getReqsNotSatisfied { my ($class, $rpm) = @_; my @requires; my @output = `LANG=C $::RPMCMD -i --test $rpm 2>&1`; my $RC = $? >> 8; if ($RC == 0) { return @requires; } # all dependencies were satisfied if ($RC > 1) { return @requires; } my $firstline = shift @output; my $secondline = $output[0]; if ($firstline =~ /is already installed/) { return @requires; } if ($secondline =~ /conflicts with/) { return @requires; } if (!($firstline =~ /failed dependencies/)) { return @requires; } foreach my $o (@output) { #print "o=$o\n"; my ($pkg, $operator, $version) = InstallUtils->parseRequire($o); #print "pkg=$pkg, operator=$operator, version=$version\n"; if (!defined($pkg)) { next; } # was not an rpm require # Hack for glibc version because I can not find a way to have the require # statement in the rpm be different for different distribution levels. if ($pkg eq 'glibc' && NodeUtils->distribution() =~ /^RedHat 7/i) { $o = "$pkg $operator 2.2"; } my $req = "$pkg $operator $version"; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgREQUIRE', $rpm, $req); push(@requires, $req); } return @requires; } #-------------------------------------------------------------------------------- =head3 getRequiredRpms Return the names of any rpms that the rpm parameter depends on if they are not already on the system at the required level. The rpm passed in as the 1st arg is the complete rpm file name. The rest of the args are the list of reqs we have already found in previous, recursive invokations of the function. Arguments: $rpm @my_path Returns: @array of rpm dependancies for the $rpm argument Globals: none Error: messageFromCat E11 Example: my @reqs = ArchiveUtils->getRequiredRpms($rpm, @my_path); Comments: none =cut #-------------------------------------------------------------------------------- sub getRequiredRpms { my ($class, $rpm, @my_path) = @_; my @reqrpms; my @reqs = InstallUtils->getReqsNotSatisfied($rpm); #print "num=" . scalar(@reqs) . ' ,reqs=' . join(':', @reqs) . ".\n"; foreach my $r (@reqs) { my ($pkg, $operator, $version) = split(' ', $r); my $newrpm = InstallUtils->findRpm($pkg, $operator, $version, @my_path); if (defined($newrpm)) # found an appropriate one to install { # make sure it is not already on the list if (grep(/^$newrpm$/, @_)) { next; } # already on the list push @reqrpms, $newrpm; push @reqrpms, InstallUtils->getRequiredRpms($newrpm, @reqrpms, @my_path); } else { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E11', 'EMsgCANT_FIND_RPM', $pkg, $operator, $version, $rpm ); } } return @reqrpms; } #-------------------------------------------------------------------------------- =head3 getRPMSDir Returns the RPMS directory (for SMS) for input params Arguments: $InstallOSName $InstallDistributionName $InstallDistributionVersion $InstallPkgArchitectur Returns: appropriate pathname for parameters Globals: none Error: none Example: my $SMS_RPMS = ArchiveUtils->getRPMSDir($OS, $dist, $distver, $arch); Comments: none =cut #-------------------------------------------------------------------------------- sub getRPMSDir { my ($class, $os, $distributor, $version, $arch) = @_; if ($arch =~ /i.86/) { $arch = "i386"; } return "/csminstall/$os/$distributor/$version/$arch/RPMS"; } #-------------------------------------------------------------------------------- =head3 getRPMVersionRelease Get RPM version and release if aviable. Arguments: $rpmPackageName $productFlag Returns: Rpm version and release as an array of two strings. Globals: none Error: E1 from csmInstallCat Example: (@temp_array) = ArchiveUtils->getRPMVersionRelease($conserrpmfile, 1); Comments: $productFlag values are: 0 = already installed rpm or default 1 = product rpm =cut #-------------------------------------------------------------------------------- sub getRPMVersionRelease { my ( $cmd, $version, $release, $my_str, $my_cmd, $class, $RPM_NAME, $product_flag, @my_array ); @my_array = (); $product_flag = 0; ($class, $RPM_NAME, $product_flag) = @_; if ($product_flag == 0) { $my_cmd = "$::RPMCMD -q --qf '%{Version}:|:%{Release}' $RPM_NAME"; $my_str = NodeUtils->runcmd($my_cmd, -1); } else { $my_cmd = "$::RPMCMD -qp --qf '%{Version}:|:%{Release}' $RPM_NAME"; $my_str = NodeUtils->runcmd($my_cmd, -1); } if ($::RUNCMD_RC != 0) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgCANT_RUN', $my_cmd, $::RUNCMD_RC ); } ($version, $release) = split(/:\|:/, $my_str); push(@my_array, $version); push(@my_array, $release); return (@my_array); } #-------------------------------------------------------------------------------- =head3 installRequiredRpms Install any rpms that the rpm parameter is dependent on if they are not already on the system at the required level. Arguments: $rpmPkgName @path Returns: undefined Globals: $::FORCE_INSTALL Error: messageFromCat E11 Example: ArchiveUtils->installRequiredRpms($rpmPkgFileName, @path); Comments: The rpm passed in is the whole rpm package name. =cut #-------------------------------------------------------------------------------- sub installRequiredRpms { my ($class, $rpm, @my_path) = @_; my @reqs = InstallUtils->getRequiredRpms($rpm, @my_path); if (scalar(@reqs)) # need to install at least 1 rpm { my $reqlist = join(' ', @reqs); NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgINSTALLING_RPM_REQS', $rpm, $reqlist ); my $cmd = "$::RPMCMD -U "; if ($::FORCE_INSTALL) { $cmd .= "--force "; } if ($::TEST) { $cmd .= "--test "; } $cmd .= "$reqlist"; NodeUtils->runcmd("$cmd"); } } #-------------------------------------------------------------------------------- =head3 MountAixCdrom Mounts Aix Cdrom Arguments: none Returns: none Globals: $::AIX_MNT_DEV $::MNTCDROM Error: undefined Example: ServerUtils->MountAixCdrom(); Comments: The caller should unmount the directory or cdrom before using this function. After using this subroutine, it is the responsibility of the caller to unmount the drive or directory. =cut #-------------------------------------------------------------------------------- sub MountAixCdrom { use File::Path; # Provides mkpath() #$cmd = "$::MOUNT -v cdrfs -o ro /dev/cd0 $::MNTCDROM"; #MOUNT_CMD="/usr/sbin/mount -rvcdrfs $DEVICE $2" -- mount command used if (!(-d $::MNTCDROM)) { mkpath($::MNTCDROM, $::VERBOSE, 0755); } my $cmd = "$::MOUNT -rvcdrfs $::AIX_MNT_DEV $::MNTCDROM"; NodeUtils->runcmd($cmd, 0); if ($::RUNCMD_RC) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgNO_MOUNT', $::MNTCDROM); } } #-------------------------------------------------------------------------------- =head3 mount_iso_image Tries to mount a file parameter as an ISO image file - a CD image as a file. The file is mounted to a predetermined mount point "/tmp_loop_mnt". Arguments: ISO image file including path from root. Returns: $::OK if mount worked $::NOK if not Globals: none Error: none Example: my $rc = ArchiveUtils->mount_iso_image($file}; Comments: $file parameter must include the path from root. =cut #-------------------------------------------------------------------------------- sub mount_iso_image { my ($class, $file) = @_; # uses predefined mount point #my $mnt_point = "/tmp_loop_mnt"; my $mnt_point = $::MNTCDROM; # futz with the mount point if (!(stat($mnt_point))[2]) { # need to make the mount point my $cmd = "$::MKDIR -m 777 -p $mnt_point"; my $rc = NodeUtils->runcmd($cmd, -1); # no exit on error if (!($rc == 1)) { return $::NOK; } } my $cmd = "$::MOUNT -o loop $file $mnt_point"; NodeUtils->runcmd($cmd, -1); # no exit on error my $rc = $::RUNCMD_RC; if ($rc == 0) { return $mnt_point; } # umount in case the mount op worked, but cmd failed for some reason. my $cmd = "$::UMOUNT $mnt_point"; NodeUtils->runcmd($cmd, -1); # no exit on error return $::NOK; } #-------------------------------------------------------------------------------- =head3 parseRequire Parse a single require string, distinguishing between rpms and individual libraries of executables. Arguments: $requiredRpmString Returns: ($package, $operator, $version); Globals: none Error: none Example: my ($pkg, $operator, $version) = ArchiveUtils->parseRequire($requiredRpmString); Comments: none =cut #-------------------------------------------------------------------------------- sub parseRequire { my ($class, $line) = @_; $line =~ s/ is needed by .*$//; my ($pkg, $operator, $version, $therest) = split(' ', $line); if ($pkg =~ /^rpmlib/ || $pkg =~ m|/| || $pkg =~ /\.so/) { return undef; } else { return ($pkg, $operator, $version); } } #-------------------------------------------------------------------------------- =head3 search_copy_distro_rpms Check for the OS required rpms in tha path. If an rpm is not found then check the /csminstall.. directory. If the rpm is still not found, prompt for the OS CDs. If an rpm is found then add it to t$::temp_CmdLinePathVersionName and %::Rpm_name_path - otherwise add it to %::RpmsNotFoundInCmdPath. Arguments: none Returns: none Globals: $::temp_CmdLinePathVersionName %::Rpm_name_path %::RpmsNotFoundInCmdPath @::Rpms_to_be_copied=(); @::Rpms_not_found=(); $::pkgdefs @::os_prereq $::command_line @::sis_packages $::Svrpkgdefs $::PREREQS_ATTR $::ATTRS $::PKGPATH $::DISTRO $::INSTALLDIR_OS_NAME_RPMS Error: none Example: ServerUtils->search_copy_distro_rpms(); Comments: none =cut #-------------------------------------------------------------------------------- sub search_copy_distro_rpms { if ( ($::PREREQS_ATTR{'OSName'} eq "Linux") || ($::ATTRS{'InstallOSName'} eq "Linux")) { #if( $::DISTRO =~ /SLES/ || $::DISTRO =~/SuSE/ ) #{ # NodeUtils->messageFromCat('csmInstall.cat',$::MSGMAPPATH,'csminstall','I','IMsgSearchAndCopy',"Distribution and SIS"); #} #else #{ NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgSearchAndCopy', "Distribution"); #} my $distro = $::DISTRO; my $destination = $::INSTALLDIR_OS_NAME_RPMS; my ($disk, $cmd, $rc); my (@notfound); my ($my_prereq, $prereq, $path, $dir); # First try to get the distro rpms out of the pkg path (which may # include the CSM CD). This allows us to put newer versions of some # distro rpms on our media if we need to. # Note: DISTRO_PREREQS is a hash of array references, thus the # funny syntax below. my (@DISTRO_PKGPATH) = @::PKGPATH; #SuSE Changes if ($distro =~ /SLES/ || $distro =~ /SuSE/) { if ($::command_line =~ /copycsmpkgs/) { my @Temp = @DISTRO_PKGPATH; map { s|$|/$::pkgdefs{DISTRO_RPMDIR}/*| } @DISTRO_PKGPATH; if ( ($::pkgdefs{DISTRO_NAME} =~ /SLES/) && ($::pkgdefs{DISTRO_NAME} =~ /8\.1/)) { map { s|$|/UnitedLinux/*| } @Temp; @DISTRO_PKGPATH = (@DISTRO_PKGPATH, @Temp); } } else { my @Temp = @DISTRO_PKGPATH; map { s|$|/$::Svrpkgdefs{DISTRO_RPMDIR}/*| } @DISTRO_PKGPATH; if (($distro =~ /SLES/) && ($distro =~ /8\.1/)) { map { s|$|/UnitedLinux/*| } @Temp; @DISTRO_PKGPATH = (@DISTRO_PKGPATH, @Temp); } } } else { if ($::command_line =~ /copycsmpkgs/) { map { s|$|/$::pkgdefs{DISTRO_RPMDIR}| } @DISTRO_PKGPATH; } else { map { s|$|/$::Svrpkgdefs{DISTRO_RPMDIR}| } @DISTRO_PKGPATH; } } @DISTRO_PKGPATH = (@DISTRO_PKGPATH, @::PKGPATH); #Empty the the hashes already used %::temp_CmdLinePathVersionName = (); %::Rpm_name_path = (); %::CmdLinePathVersionName = (); @::Rpms_to_be_copied = (); @::Rpms_not_found = (); @::RpmsNotFoundInCmdPath = (); # Determine the RPM architectures to search for on each platform. my @archs; my $arch = $::PREREQS_ATTR{'PkgArchitecture'}; if (!$arch) { $arch = $::ATTRS{'InstallPkgArchitecture'}; } if ($arch =~ /i.86/) { @archs = ('i?86', 'noarch'); } elsif ($arch =~ /ppc64/) { @archs = ($arch, 'ppc', 'noarch'); } elsif ($arch =~ /x86_64/) { @archs = ($arch, 'i?86', 'noarch'); } elsif ($arch =~ /ia64/) { @archs = ($arch, 'i?86', 'noarch'); } else # Any other unknown architectures. { @archs = ($arch, 'noarch'); } #foreach $prereq (@::os_prereq, @::sis_packages) foreach $prereq (@::os_prereq) { NodeUtils->message('V', 'IMsgSEARCHING_FOR_PREREQ', $prereq); $my_prereq = ''; $path = ''; foreach my $a (@archs) { if (!($path)) { $my_prereq = "${prereq}.$a.rpm"; $path = InstallUtils->findRpmInPath($my_prereq, @DISTRO_PKGPATH); } else { last; } } if (defined($path)) { # Get the latest version of the file in the first location found my $rpm_pre_file = InstallUtils->getRecentVersionRpm($path, $my_prereq); chomp $rpm_pre_file; my $rpmfile_basename; ($rpmfile_basename = $rpm_pre_file) =~ s:^.*/::g; #find the shortname my @parts = split /-/, $rpmfile_basename; my $shortname = shift @parts; my $p; SNAME: while ($p = shift @parts) { if ($p !~ m/^\d/) { #if it doesn't start with a digit $shortname .= "-$p"; } else { unshift @parts, $p; last SNAME; } } push @{$::temp_CmdLinePathVersionName{$path}}, $rpmfile_basename; $::Rpm_name_path{$shortname}{'BaseName'} = $rpmfile_basename; $::Rpm_name_path{$shortname}{'Location'} = $path; $::Rpm_name_path{$shortname}{'Destination'} = $destination; } else { #get the shortname of the rpm my @parts = split /-/, $prereq; my $shortname = shift @parts; my $p; SNAME: while ($p = shift @parts) { if ($p !~ m/^\d/) { #if it doesn't start with a digit $shortname .= "-$p"; } else { unshift @parts, $p; last SNAME; } } my $tmp_var1; my $my_rindex = rindex($shortname, "*"); if ($my_rindex != -1) { $tmp_var1 = substr($shortname, 0, rindex($shortname, "*")); } else { $tmp_var1 = $shortname; } $my_rindex = rindex($tmp_var1, "-"); if (($my_rindex + 1) == 0) { $shortname = $tmp_var1; } elsif (($my_rindex + 1) == length($tmp_var1)) { $shortname = substr($tmp_var1, 0, rindex($tmp_var1, "*")); } else { $shortname = $tmp_var1; } push(@::RpmsNotFoundInCmdPath, $shortname); #push(@::RpmsNotFoundInCmdPath,$prereq); } } my @temp_array2 = (); #copy the pacakges found in the path InstallUtils->create_rpm_list_to_copy(); foreach my $my_rpm_name (@::Rpms_not_found) { push(@temp_array2, $::PackageVersionName{$my_rpm_name}{'FullName'}); } @notfound = @temp_array2; InstallUtils->copy_rpm(); # return if all the packages are found if (!scalar(@notfound)) { return; } # if the packages are not found in the path than check in the # /csminstall.. directory if the copy flag is not set # Copy RPMs from distribution CD-ROM(s) $cmd = "$::UNMOUNT $::MNTCDROM > /dev/null 2>&1"; NodeUtils->runcmd("$cmd", -1); #NodeUtils->run_cmd($cmd, "W", "ignore_errors"); #my $my_DISTRO_DISKLIST; my $my_DISTRO_NAME; my $my_DISTRO_RPMDIR; #my @disks; my @all_disks; if ($::command_line =~ /copycsmpkgs/) { #$my_DISTRO_DISKLIST=$::pkgdefs{DISTRO_DISKLIST}; push( @all_disks , $::pkgdefs{'distro_disks'} ); if($distro =~ /RedHat/) { foreach my $obj (keys %{$::pkgdefs{'sp_disks'}}) { push (@all_disks , $::pkgdefs{'sp_disks'}{$obj}); } } $my_DISTRO_NAME = $::pkgdefs{DISTRO_NAME}; $my_DISTRO_RPMDIR = $::pkgdefs{DISTRO_RPMDIR}; } else { #$my_DISTRO_DISKLIST=$::Svrpkgdefs{DISTRO_DISKLIST}; #@disks = (@{$::Svrpkgdefs{'distro_disks'}}); push( @all_disks , $::Svrpkgdefs{'distro_disks'} ); if($distro =~ /RedHat/) { foreach my $obj (keys %{$::Svrpkgdefs{'sp_disks'}}) { push (@all_disks , $::Svrpkgdefs{'sp_disks'}{$obj}); } } $my_DISTRO_NAME = $::Svrpkgdefs{DISTRO_NAME}; $my_DISTRO_RPMDIR = $::Svrpkgdefs{DISTRO_RPMDIR}; } my $first_disk = 0; my @disks = @{$all_disks[0]}; foreach my $diskref (@disks) { my $diskname = $diskref->{name}; my $disknum = $diskref->{num}; #Empty the the hashes already used %::temp_CmdLinePathVersionName = (); %::Rpm_name_path = (); %::CmdLinePathVersionName = (); @::Rpms_to_be_copied = (); @::Rpms_not_found = (); @::RpmsNotFoundInCmdPath = (); NodeUtils->message('I', 'IMsgINSERT_DISK', $diskname, $disknum); NodeUtils->message('P', 'IMsgPRESS_ENTER'); my $junk = getc; my $wrong_disk = 1; while ($wrong_disk) { # Mount the CD-ROM if ($::PLTFRM eq "AIX") { sleep(5); #this is needed for AIX `$::UNMOUNT $::MNTCDROM 2>/dev/null 1>/dev/null`; InstallUtils->MountAixCdrom(); } else { $cmd = "$::MOUNT $::MNTCDROM"; # Ignore mount errors. Usually they are because # the CD was already mounted. NodeUtils->runcmd("$cmd", -1); } # Check for valid disk inserted if (defined $diskref->{diskid_searchprog}) { my $progref = $diskref->{diskid_searchprog}; my $progarg = $diskref->{diskid_searchargs}; $wrong_disk = !(&$progref($::MNTCDROM, $progarg)); goto check_over; } # Save the original logic for compatiable with old pkgdefs my $diskid_searchstring = $diskref->{diskid_searchstring}; my $diskid_filename = "$::MNTCDROM/" . $diskref->{diskid_filename}; $cmd = "$::LS $diskid_filename 2> /dev/null"; chomp($diskid_filename = NodeUtils->runcmd($cmd, -1)); # First make sure the file exists if (!$::RUNCMD_RC and -f $diskid_filename) { if ($diskid_searchstring) { open(DISKID_FILE, $diskid_filename) || NodeUtils->message('E', 'EMsgCANT_READ_FILE', $diskid_filename); if (grep (/$diskid_searchstring/, )) { #print "CORRECT DISK!\n"; $wrong_disk = 0; } else { #print "Search string $diskid_searchstring not found\n"; $wrong_disk = 1; } close DISKID_FILE; } else { $wrong_disk = 0; } } else { #print "Can't find $::MNTCDROM/$diskref->{diskid_filename}. \nERRORS: $diskid_filename\n"; $wrong_disk = 1; } check_over: if ($wrong_disk) { if($first_disk==0) { foreach my $disc (@all_disks) { my $diskref = $disc->[0]; my $progref = $diskref->{diskid_searchprog}; my $progarg = $diskref->{diskid_searchargs}; if(&$progref($::MNTCDROM, $progarg)) { @disks = @$disc; goto move_on; } } } if ($::PLTFRM eq "AIX") { `$::UNMOUNT $::MNTCDROM 2>/dev/null 1>/dev/null`; } else { $cmd = "$::UNMOUNT $::MNTCDROM > /dev/null 2>&1"; NodeUtils->runcmd("$cmd", -1); } NodeUtils->message('W', 'EMsgWRONG_DISK', $diskname, $disknum); NodeUtils->message('I', 'IMsgINSERT_DISK', $diskname, $disknum); NodeUtils->message('P', 'IMsgPRESS_ENTER_OR_FORCE'); # Get user input $junk = getc; if ($junk eq "F" or $junk eq "f") { #Force it to be the right disk # Mount the CD-ROM if ($::PLTFRM eq "AIX") { `$::UNMOUNT $::MNTCDROM 2>/dev/null 1>/dev/null`; InstallUtils->MountAixCdrom(); } else { $cmd = "$::MOUNT $::MNTCDROM"; NodeUtils->runcmd($cmd, -1); } $wrong_disk = 0; } else { # Try again next; } } } move_on: $first_disk++; # Determine the RPM architectures to search for on each platform # and determine the directory to search for RPMs on each CD. my @archs; my $arch = $::PREREQS_ATTR{'PkgArchitecture'}; if (!$arch) { $arch = $::ATTRS{'InstallPkgArchitecture'}; } if ($arch =~ /i.86/) { @archs = ('i?86', 'noarch'); if (($distro =~ /SLES/) && ($distro =~ /8\.1/)) { # See if this is the SLES disk (not the UnitedLinux disk) if ($disknum eq '1' and $diskname =~ /$my_DISTRO_NAME/) { $dir = "$::MNTCDROM/$my_DISTRO_RPMDIR/*"; } else { $dir = "$::MNTCDROM/UnitedLinux/*"; } } elsif (($distro =~ /SuSE/) || ($distro =~ /SLES/)) { $dir = "$::MNTCDROM/$my_DISTRO_RPMDIR/*"; } else { $dir = "$::MNTCDROM/$my_DISTRO_RPMDIR"; } } elsif ($arch =~ /ppc64/) { @archs = ($arch, 'ppc', 'noarch'); if (($distro =~ /SuSE/) || ($distro =~ /SLES/)) { $dir = "$::MNTCDROM/$my_DISTRO_RPMDIR/*"; } else { $dir = "$::MNTCDROM/$my_DISTRO_RPMDIR"; } } elsif ($arch =~ /x86_64/) { @archs = ($arch, 'i?86', 'noarch'); if (($distro =~ /SLES/) && ($distro =~ /8\.1/)) { # See if this is the SLES disk (not the UnitedLinux disk) if ($disknum eq '1' and $diskname =~ /$my_DISTRO_NAME/) { $dir = "$::MNTCDROM/$my_DISTRO_RPMDIR/*"; } else { $dir = "$::MNTCDROM/UnitedLinux/*"; } } elsif (($distro =~ /SuSE/) || ($distro =~ /SLES/)) { $dir = "$::MNTCDROM/$my_DISTRO_RPMDIR/*"; } else { $dir = "$::MNTCDROM/$my_DISTRO_RPMDIR"; } } elsif ($arch =~ /ia64/) { @archs = ($arch, 'i?86', 'noarch'); if (($distro =~ /SLES/) && ($distro =~ /8\.1/)) { # See if this is the SLES disk (not the UnitedLinux disk) if ($disknum eq '1' and $diskname =~ /$my_DISTRO_NAME/) { $dir = "$::MNTCDROM/my_DISTRO_RPMDIR/*"; } else { $dir = "$::MNTCDROM/UnitedLinux/*"; } } elsif (($distro =~ /SuSE/) || ($distro =~ /SLES/)) { $dir = "$::MNTCDROM/$my_DISTRO_RPMDIR/*"; } else { $dir = "$::MNTCDROM/$my_DISTRO_RPMDIR"; } } else # Any other unknown architectures. { @archs = ($arch, 'noarch'); $dir = "$::MNTCDROM/$my_DISTRO_RPMDIR"; } foreach $prereq (@notfound) { $my_prereq = ''; $path = ''; if (!length($prereq)) { next; } # already found that one NodeUtils->message('V', 'IMsgSEARCHING_FOR_PREREQ_ON_CD', $prereq, $disknum); foreach my $a (@archs) { if (!($path)) { $my_prereq = "${prereq}.$a.rpm"; $path = InstallUtils->findRpmInPath($my_prereq, $dir); if ( !($path) && ($::pkgdefs{DISTRO_NAME} =~ /Red Hat Enterprise Linux AS 3 PPC/) ) { my $updatesdir = "$::MNTCDROM/$::pkgdefs{DISTRO_UPDATESDIR}"; $path = InstallUtils->findRpmInPath($my_prereq, $updatesdir); } } else { last; } } if (defined($path)) { # Get the latest version of the file in the first location found #my $rpm_pre_file = NodeUtils->runcmd("$::LS -vr $path/$my_prereq | $::HEAD -1", -1); my $rpm_pre_file = InstallUtils->getRecentVersionRpm($path, $my_prereq); chomp $rpm_pre_file; my $rpmfile_basename; ($rpmfile_basename = $rpm_pre_file) =~ s:^.*/::g; #find the shortname my @parts = split /-/, $rpmfile_basename; my $shortname = shift @parts; my $p; SNAME: while ($p = shift @parts) { if ($p !~ m/^\d/) { #if it doesn't start with a digit $shortname .= "-$p"; } else { unshift @parts, $p; last SNAME; } } push @{$::temp_CmdLinePathVersionName{$path}}, $rpmfile_basename; $::Rpm_name_path{$shortname}{'BaseName'} = $rpmfile_basename; $::Rpm_name_path{$shortname}{'Location'} = $path; $::Rpm_name_path{$shortname}{'Destination'} = $destination; $prereq = ''; # so we do not search for it on the next cd } } # copy the rpm collected from the cd InstallUtils->create_rpm_list_to_copy(); my $nf = join(' ', @notfound); # this eliminates the ones we blanked out @notfound = split(' ', $nf); if (scalar(@::Rpms_not_found) >= 1) { @notfound = (@notfound, @::Rpms_not_found); } @::Rpms_not_found = (); InstallUtils->copy_rpm(); # return if all the packages are found if (!scalar(@notfound)) { last; } # do not need to go to the next cd $cmd = "$::UNMOUNT $::MNTCDROM > /dev/null 2>&1"; NodeUtils->runcmd("$cmd", -1); } # make sure to unmount cdrom after copying all the rpms $cmd = "$::UNMOUNT $::MNTCDROM > /dev/null 2>&1"; NodeUtils->runcmd("$cmd", -1); #NodeUtils->run_cmd($cmd, "W"); # Ignore all SIS packages my $rpm_temp; my (@ignore_temp); my (@notfound_temp); foreach $rpm_temp (@notfound) { my $short_rpm; my $my_rindex = rindex($rpm_temp, "*"); if ($my_rindex != -1) { $short_rpm = substr($rpm_temp, 0, $my_rindex); } #my @foo = grep(/$short_rpm/, @::sis_packages); #if (scalar(@foo)) { # push (@ignore_temp,$rpm_temp); #} #else { push(@notfound_temp, $rpm_temp); #} } if (scalar(@ignore_temp)) { NodeUtils->message('I', 'IMsgMissingRPM', join(", ", @ignore_temp)); } if (scalar(@notfound_temp)) { NodeUtils->message('E1', 'EMsgPREREQ_NOT_FOUND', join(", ", @notfound_temp)); } } elsif ($::PREREQS_ATTR{'OSName'} eq "AIX") { } } #-------------------------------------------------------------------------------- =head3 search_csm Search for rpms in the $::installms path and populate the $::Rpm_name_path and %::temp_CmdLinePathVersionName hash. If an rpm is not found, add it to the %::RpmsNotFoundInCmdPath hash. Arguments: none Returns: undefined Globals: $::Rpm_name_path %::RpmsNotFoundInCmdPath $::PREREQS_ATTR $::ATTRS @::csm_packages @::rsct_packages @::director_package @::PKGPATH $::INSTALLDIR_CSMPKG $::COPY_OPT_FLAG Error: undefined Example: ServerUtils->search_csm(); Comments: none =cut #-------------------------------------------------------------------------------- sub search_csm { if ( ($::PREREQS_ATTR{'OSName'} eq "Linux") || ($::ATTRS{'InstallOSName'} eq "Linux")) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgSearchingfor', "CSM, RSCT and Director" ); my @my_res_path = (); my ($rpmfile, $rpm, $path); # Determine the RPM architectures to search for on each platform. my @archs; my $arch = $::PREREQS_ATTR{'PkgArchitecture'}; if (!$arch) { $arch = $::ATTRS{'InstallPkgArchitecture'}; } if ($arch =~ /i.86/) { @archs = ('i?86', 'noarch'); } elsif ($arch =~ /ppc64/) { @archs = ($arch, 'ppc', 'noarch'); } elsif ($arch =~ /x86_64/) { @archs = ($arch, 'i?86', 'noarch'); } elsif ($arch =~ /ia64/) { @archs = ($arch, 'i?86', 'noarch'); } else # Any other unknown architectures. { @archs = ($arch, 'noarch'); } # Search RPMs from CSM distribution CD-ROM or directory to dirctory structure foreach $rpm (@::csm_packages, @::rsct_packages, @::director_packages) { $rpmfile = ''; $path = ''; foreach my $a (@archs) { if (!($path)) { $rpmfile = "${rpm}-*.$a.rpm"; $path = InstallUtils->findRpmInPath($rpmfile, @::PKGPATH); } else { last; } } if (!($path)) { # we take out the dash because the images, may not have them. foreach my $a (@archs) { if (!($path)) { $rpmfile = "${rpm}*.$a.rpm"; $path = InstallUtils->findRpmInPath($rpmfile, @::PKGPATH); } if ($path) { last; } } } if (defined($path)) { $rpmfile = InstallUtils->getRecentVersionRpm($path, $rpmfile); chomp $rpmfile; my $rpmfile_basename; ($rpmfile_basename = $rpmfile) =~ s:^.*/::g; #find the shortname my @parts = split /-/, $rpmfile_basename; my $shortname = shift @parts; my $p; SNAME: while ($p = shift @parts) { if ($p !~ m/^\d/) { #if it doesn't start with a digit $shortname .= "-$p"; } else { unshift @parts, $p; last SNAME; } } push @{$::temp_CmdLinePathVersionName{$path}}, $rpmfile_basename; $::Rpm_name_path{$shortname}{'BaseName'} = $rpmfile_basename; $::Rpm_name_path{$shortname}{'Location'} = $path; $::Rpm_name_path{$shortname}{'Destination'} = $::INSTALLDIR_CSMPKG; } else { #get the shortname of the rpm my @parts = split /-/, $rpm; my $shortname = shift @parts; my $p; SNAME: while ($p = shift @parts) { if ($p !~ m/^\d/) { #if it doesn't start with a digit $shortname .= "-$p"; } else { unshift @parts, $p; last SNAME; } } my $tmp_var1; my $my_rindex = rindex($shortname, "*"); if ($my_rindex != -1) { $tmp_var1 = substr($shortname, 0, rindex($shortname, "*")); } else { $tmp_var1 = $shortname; } $my_rindex = rindex($tmp_var1, "-"); if (($my_rindex + 1) == 0) { $shortname = $tmp_var1; } elsif (($my_rindex + 1) == length($tmp_var1)) { $shortname = substr($tmp_var1, 0, rindex($tmp_var1, "*")); } else { $shortname = $tmp_var1; } push(@::RpmsNotFoundInCmdPath, $shortname); } } if ($::COPY_OPT_FLAG) { if (scalar(@::RpmsNotFoundInCmdPath) > 0) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgNoRpmFound', join(", ", @::RpmsNotFoundInCmdPath)); } } } elsif ($::PREREQS_ATTR{'OSName'} eq "AIX") { } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E2', 'EMsgINVALID_OSTYPE'); } } #-------------------------------------------------------------------------------- =head3 search_opensrc_prereqs Search for the open source rpms required for csm. If found then populate $::temp_CmdLinePathVersionName. Arguments: none Returns: undefined Globals: $::Rpm_name_path %::RpmsNotFoundInCmdPath $::temp_CmdLinePathVersionName. $::PREREQS_ATTR $::ATTRS @::PKGPATH $::INSTALLDIR_CSMPKG $::COPY_OPT_FLAG Error: message E1 Example: ServerUtils->search_opensrc_prereqs(); Comments: none =cut #-------------------------------------------------------------------------------- sub search_opensrc_prereqs { # Append /reqs and /reqs/ to each PKGPATH element to search for pkgs my (@reqs_PKGPATH) = @::PKGPATH; # Used for AIX map { s/$/\/reqs/ } @reqs_PKGPATH; # Used for AIX my $distroname = ( $::PREREQS_ATTR{'DistributionName'} ? $::PREREQS_ATTR{'DistributionName'} : $::ATTRS{'InstallDistributionName'} ); my $distroversion = ( $::PREREQS_ATTR{'DistributionVersion'} ? $::PREREQS_ATTR{'DistributionVersion'} : $::ATTRS{'InstallDistributionVersion'} ); my $distro = $distroname . $distroversion; # Assemble the full_PKGPATH as follows: # path1/reqs/distro:path1/reqs:path1:path2/reqs/distro/path2/reqs:path2 my (@full_PKGPATH); foreach my $pkgpath (@::PKGPATH) { push(@full_PKGPATH, "$pkgpath/reqs/$distro"); push(@full_PKGPATH, "$pkgpath/reqs"); push(@full_PKGPATH, "$pkgpath"); } if ( ($::PREREQS_ATTR{'OSName'} eq "Linux") || ($::ATTRS{'InstallOSName'} eq "Linux")) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgSearchingfor', "Open Source"); my ($rpm_pre_file, $rpm_pre, $path); # Determine the RPM architectures to search for on each platform. my @archs; my $arch = $::PREREQS_ATTR{'PkgArchitecture'}; if (!$arch) { $arch = $::ATTRS{'InstallPkgArchitecture'}; } if ($arch =~ /i.86/) { @archs = ('i?86', 'noarch'); } elsif ($arch =~ /ppc64/) { @archs = ($arch, 'ppc', 'noarch'); } elsif ($arch =~ /x86_64/) { @archs = ($arch, 'i?86', 'noarch'); } elsif ($arch =~ /ia64/) { @archs = ($arch, 'i?86', 'noarch'); } else # Any other unknown architectures. { @archs = ($arch, 'noarch'); } # Search open source prereqs from CSM distribution CD-ROM or directory structure foreach $rpm_pre (@::opensrc_rpm_prereqs) { $rpm_pre_file = ''; $path = ''; # Process the IBMJava rpm begin..... if ($rpm_pre =~ /^IBMJava2-JRE/) { foreach my $a (@archs) { if (!($path)) { $rpm_pre_file = "${rpm_pre}-*.$a.rpm"; $path = InstallUtils->findRpmInPath_java($rpm_pre_file, @full_PKGPATH); } else { last; } } if (!($path)) { foreach my $a (@archs) { if (!($path)) { $rpm_pre_file = "${rpm_pre}*.$a.rpm"; $path = InstallUtils->findRpmInPath_java($rpm_pre_file, @full_PKGPATH); } if ($path) { last; } } } } else # Not IBMJava { foreach my $a (@archs) { if (!($path)) { $rpm_pre_file = "${rpm_pre}-*.$a.rpm"; $path = InstallUtils->findRpmInPath($rpm_pre_file, @full_PKGPATH); } else { last; } } if (!($path)) { foreach my $a (@archs) { if (!($path)) { $rpm_pre_file = "${rpm_pre}*.$a.rpm"; $path = InstallUtils->findRpmInPath($rpm_pre_file, @full_PKGPATH); } if ($path) { last; } } } } if (defined($path)) { # Get the latest version of the file in the first location found #my $rpm_pre_file = NodeUtils->runcmd("$::LS -vr $path/$rpm_pre_file | $::HEAD -1", -1); $rpm_pre_file = InstallUtils->getRecentVersionRpm($path, $rpm_pre_file); chomp $rpm_pre_file; my $rpmfile_basename; ($rpmfile_basename = $rpm_pre_file) =~ s:^.*/::g; #find the shortname my @parts = split /-/, $rpmfile_basename; my $shortname = shift @parts; my $p; SNAME: while ($p = shift @parts) { if ($p !~ m/^\d/) { #if it doesn't start with a digit $shortname .= "-$p"; } else { unshift @parts, $p; last SNAME; } } push @{$::temp_CmdLinePathVersionName{$path}}, $rpmfile_basename; $::Rpm_name_path{$shortname}{'BaseName'} = $rpmfile_basename; $::Rpm_name_path{$shortname}{'Location'} = $path; $::Rpm_name_path{$shortname}{'Destination'} = $::INSTALLDIR_CSMPKG; } else { #get the shortname of the rpm my @parts = split /-/, $rpm_pre; my $shortname = shift @parts; my $p; SNAME: while ($p = shift @parts) { if ($p !~ m/^\d/) { #if it doesn't start with a digit $shortname .= "-$p"; } else { unshift @parts, $p; last SNAME; } } my $tmp_var1; my $my_rindex = rindex($shortname, "*"); if ($my_rindex != -1) { $tmp_var1 = substr($shortname, 0, rindex($shortname, "*")); } else { $tmp_var1 = $shortname; } $my_rindex = rindex($tmp_var1, "-"); if (($my_rindex + 1) == 0) { $shortname = $tmp_var1; } elsif (($my_rindex + 1) == length($tmp_var1)) { $shortname = substr($tmp_var1, 0, rindex($tmp_var1, "*")); } else { $shortname = $tmp_var1; } push(@::RpmsNotFoundInCmdPath, $shortname); } } } elsif ($::PREREQS_ATTR{'OSName'} eq "AIX") { # Search open source prereqs from CSM distribution CD-ROM or directory structure foreach my $rpm_pre (@::opensrc_rpm_prereqs) { # check for the ppc rpm in path and path/reqs.... my $rpm_pre_file = "${rpm_pre}-*.ppc.rpm"; my $path = InstallUtils->findRpmInPath($rpm_pre_file, @::PKGPATH); if (!($path)) { $path = InstallUtils->findRpmInPath($rpm_pre_file, @reqs_PKGPATH); } #...If ppc not found in path then check for the noarch rpm .... if (!($path)) { $rpm_pre_file = "${rpm_pre}-*.noarch.rpm"; $path = InstallUtils->findRpmInPath($rpm_pre_file, @::PKGPATH); } if (!($path)) { $path = InstallUtils->findRpmInPath($rpm_pre_file, @reqs_PKGPATH); } if (!($path)) { $rpm_pre_file = "${rpm_pre}*.ppc.rpm"; $path = InstallUtils->findRpmInPath($rpm_pre_file, @::PKGPATH); if (!($path)) { $path = InstallUtils->findRpmInPath($rpm_pre_file, @reqs_PKGPATH); } #...If ppc not found in path then check for the noarch rpm .... if (!($path)) { $rpm_pre_file = "${rpm_pre}*.noarch.rpm"; $path = InstallUtils->findRpmInPath($rpm_pre_file, @::PKGPATH); } if (!($path)) { $path = InstallUtils->findRpmInPath($rpm_pre_file, @reqs_PKGPATH); } } # And finally exit if the rpm is not found else copy if (defined($path)) { # Get the latest version of the file in the first location found #my $rpmfile = NodeUtils->runcmd("$::LS $path/$rpm_pre_file | $::HEAD -1", -1); my $rpmfile = InstallUtils->getRecentVersionRpm($path, $rpm_pre_file); chomp $rpmfile; my $rpmfile_basename; ($rpmfile_basename = $rpmfile) =~ s:^.*/::g; ArchiveUtils->copyRpm($rpmfile_basename, $path, $::INSTALLDIR_CSMRPM); } else { NodeUtils->message('E1', 'EMsgCANT_FIND', $rpm_pre, join(':', @::PKGPATH)); } } } else { NodeUtils->message('E2', 'EMsgINVALID_OSTYPE'); } if ($::COPY_OPT_FLAG) { if (scalar(@::RpmsNotFoundInCmdPath) > 0) { my @rpm_ignored = (); my @rpm_not_ignored = (); foreach my $rpm_name (@::RpmsNotFoundInCmdPath) { if ( ($rpm_name =~ m/autoupdate/) || ($rpm_name =~ m/perl-libnet/) || ($rpm_name =~ m/perl-DBI/) || ($rpm_name =~ m/perl-XML-Parser/) || ($rpm_name =~ m/perl-XML-Simple/) || ($rpm_name =~ m/fping/) || ($rpm_name =~ m/perl-DB_File/)) { push(@rpm_ignored, $rpm_name); } else { push(@rpm_not_ignored, $rpm_name); } } @::RpmsNotFoundInCmdPath = @rpm_not_ignored; if (scalar(@rpm_ignored) > 0) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgMissingRPM', join(", ", @rpm_ignored)); } if (scalar(@::RpmsNotFoundInCmdPath) > 0) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgNoRpmFound', join(", ", @::RpmsNotFoundInCmdPath)); } } } } #-------------------------------------------------------------------------------- =head3 search_rpm_csminstall_path Search the /csminstall.. path for the rpms not found in the installms path. Valid ony if -c arg is not used while using installms and copycsmpkgs. Populate the $::temp_CmdLinePathVersionName and %::Rpm_name_path and if not found then populate the %::RpmsNotFoundInCmdPath Arguments: Array rpm Names Returns: none Globals: %::temp_CmdLinePathVersionName %::Rpm_name_path %::CmdLinePathVersionName @::Rpms_to_be_installed @::Rpms_already_installed @::Rpms_not_found @::RpmsNotFoundInCmdPath $::PREREQS_ATTR $::INSTALLDIR_CSMPKG $::INSTALLDIR_OS_NAME_RPMS Error: NodeUtils->message 'E2' Example: ServerUtils->search_rpm_csminstall_path(@::mgmtserver_open_srcrpms); Comments: none =cut #-------------------------------------------------------------------------------- sub search_rpm_csminstall_path { #Empty the the hashes already used %::temp_CmdLinePathVersionName = (); %::Rpm_name_path = (); %::CmdLinePathVersionName = (); @::Rpms_to_be_installed = (); @::Rpms_already_installed = (); @::Rpms_not_found = (); @::RpmsNotFoundInCmdPath = (); my ($class, @rpm_list) = @_; my (@my_path); if ($::PREREQS_ATTR{'OSName'} eq "Linux") { @my_path = ($::INSTALLDIR_CSMPKG, $::INSTALLDIR_OS_NAME_RPMS); my ($rpmfile, $rpm, $path); # Determine the RPM architectures to search for on each platform. my @archs; my $arch = $::PREREQS_ATTR{'PkgArchitecture'}; if (!$arch) { $arch = $::ATTRS{'InstallPkgArchitecture'}; } if ($arch =~ /i.86/) { @archs = ('i?86', 'noarch'); } elsif ($arch =~ /ppc64/) { @archs = ($arch, 'ppc', 'noarch'); } elsif ($arch =~ /x86_64/) { @archs = ($arch, 'i?86', 'noarch'); } elsif ($arch =~ /ia64/) { @archs = ($arch, 'i?86', 'noarch'); } else # Any other unknown architectures. { @archs = ($arch, 'noarch'); } # Search the RPMs from path foreach $rpm (@rpm_list) { $rpmfile = ''; $path = ''; # Process the IBMJava rpm begin..... if ($rpm =~ /^IBMJava2-JRE/) { foreach my $a (@archs) { if (!($path)) { $rpmfile = "${rpm}-*.$a.rpm"; $path = InstallUtils->findRpmInPath_java($rpmfile, @my_path); } else { last; } } if (!($path)) { # we take out the dash because the images, may not have them. foreach my $a (@archs) { if (!($path)) { $rpmfile = "${rpm}*.$a.rpm"; $path = InstallUtils->findRpmInPath_java($rpmfile, @my_path); } if ($path) { last; } } } } #Process the IBMJava rpm end..... else # Not IBMJava { foreach my $a (@archs) { if (!($path)) { $rpmfile = "${rpm}-*.$a.rpm"; $path = InstallUtils->findRpmInPath($rpmfile, @my_path); } else { last; } } if (!($path)) { # we take out the dash because the images, may not have them. foreach my $a (@archs) { if (!($path)) { $rpmfile = "${rpm}*.$a.rpm"; $path = InstallUtils->findRpmInPath($rpmfile, @my_path); } if ($path) { last; } } } } if (defined($path)) { $rpmfile = InstallUtils->getRecentVersionRpm($path, $rpmfile); chomp $rpmfile; my $rpmfile_basename; ($rpmfile_basename = $rpmfile) =~ s:^.*/::g; #find the shortname my @parts = split /-/, $rpmfile_basename; my $shortname = shift @parts; my $p; SNAME: while ($p = shift @parts) { if ($p !~ m/^\d/) { #if it doesn't start with a digit $shortname .= "-$p"; } else { unshift @parts, $p; last SNAME; } } push @{$::temp_CmdLinePathVersionName{$path}}, $rpmfile_basename; $::Rpm_name_path{$shortname}{'BaseName'} = $rpmfile_basename; $::Rpm_name_path{$shortname}{'Location'} = $path; } else { push(@::RpmsNotFoundInCmdPath, $rpm); } } } elsif ($::PREREQS_ATTR{'OSName'} eq "AIX") { NodeUtils->message("I", 'IMsgCOPYING_INSTALLP'); # Copy RPMs from CSM distribution CD-ROM or directory to dirctory structure foreach my $image (@::csm_packages) { my $file = "${image}"; my @images = InstallUtils->findImagesInPath($file, @::PKGPATH); foreach my $image (@images) { my $basename; ($basename = $image) =~ s:^.*/::g; my $path; ($path = $image) =~ s/$basename//g; ArchiveUtils->copyRpm($basename, $path, $::INSTALLDIR_CSMINSTLP); } } `inutoc $::INSTALLDIR_CSMINSTLP`; } else { NodeUtils->message('E2', 'EMsgINVALID_OSTYPE'); } } #-------------------------------------------------------------------------------- =head3 show_copy_progress Copy the entire contents of the Distro CD-ROMs Arguments: $command $destination Returns: none Globals: none Error: undefined Example: none Comments: This function is intended to be used by copyDistroCD subroutine. This function shows the progress of CD copy as %complete. It takes the 'tar' command which basically copies the files from CD to disk and the destination dir as the arguments. It pipes the output of the 'tar' command and takes the size of each file as it gets copied. Calculates the % value and displys it to the user as the files get copied. =cut #-------------------------------------------------------------------------------- sub show_copy_progress { my ($command, $target, $destination) = @_; my $totalSize = 0; my $total = 0; my $isLastFile = 0; my @output; my $mountPath = $target; my $command_tmp = "du -s " . $mountPath; @output = NodeUtils->runcmd($command_tmp); my ($max) = split(/\s+/, $output[0]); $max =~ s/^\s*//; # Remove any leading whitespace $max =~ s/\s*$//; # Remove any trailing whitespace $totalSize = $max; if (!$totalSize) { $totalSize = 1; } # To avoid problem if du -s returns 0 print("0% complete...\r"); #initial value my $firstFile = -1; my $file; my $lastFile; open(CMDOUT, "$command |") || NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgERROR_RUNNING_COMMAND', $command ); while () { if ($firstFile == -1) { $firstFile = 1; } chomp; my $file1 = $_; $file1 =~ s/\.\/(.+)/\1/; #example ./gcc-3.2.i386.rpm my $file = $destination . "/" . $file1; #whenever we get a new file, don't process it now. Save the file # and process the last file, hopefull by this time the last file is # fully copied to the disk. if ($file eq $lastFile) { next; } elsif ($firstFile) { $lastFile = $file; $firstFile = 0; next; } else { $total = &displayProgress($lastFile, $total, $totalSize, $isLastFile); $lastFile = $file; } } #end of whilea $isLastFile = 1; $total = &displayProgress($file, $total, $totalSize, $isLastFile); close(CMDOUT); } #-------------------------------------------------------------------------------- =head3 testVersion Compare version1 and version2 according to the operator and return True or False. Arguments: $version1 $operator $version2 $release1 $release2 Returns: True or False Globals: none Error: messageFromCat E11 Example: if (ArchiveUtils->testVersion ( $ins_ver, "<", $req_ver, $ins_rel, $req_rel)){ blah; } Comments: The return value is generated with the Require query of the rpm command. =cut #-------------------------------------------------------------------------------- sub testVersion { my ($class, $version1, $operator, $version2, $release1, $release2) = @_; # Note: perl seems to be able to handle really big integers, but if we run into a limit, we # can use the Math::BigInt pkg my @a1 = split(/\./, $version1); my @a2 = split(/\./, $version2); my $len = (scalar(@a1) > scalar(@a2) ? scalar(@a1) : scalar(@a2)); $#a1 = $len - 1; # make the arrays the same length before appending release $#a2 = $len - 1; push @a1, split(/\./, $release1); push @a2, split(/\./, $release2); $len = (scalar(@a1) > scalar(@a2) ? scalar(@a1) : scalar(@a2)); my $num1 = ''; my $num2 = ''; for (my $i = 0 ; $i < $len ; $i++) { my ($d1) = $a1[$i] =~ /^(\d*)/; # remove any non-numbers on the end my ($d2) = $a2[$i] =~ /^(\d*)/; my $diff = length($d1) - length($d2); if ($diff > 0) # pad d2 { $num1 .= $d1; $num2 .= ('0' x $diff) . $d2; } elsif ($diff < 0) # pad d1 { $num1 .= ('0' x abs($diff)) . $d1; $num2 .= $d2; } else # they are the same length { $num1 .= $d1; $num2 .= $d2; } } # Remove the leading 0s or perl will interpret the numbers as octal $num1 =~ s/^0+//; $num2 =~ s/^0+//; #SuSE Changes # if $num1="", the "eval '$num1 $operator $num2'" will fail. So MUSTBE be sure that $num1 is not a "". if (length($num1) == 0) { $num1 = 0; } if (length($num2) == 0) { $num2 = 0; } #End of SuSE Changes if (length($release1)) { $release1 = "-$release1"; } # this is just for error msgs if (length($release2)) { $release2 = "-$release2"; } # this is just for error msgs if ($operator eq '=') { $operator = '=='; } my $bool = eval "$num1 $operator $num2"; if (length($@)) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'W', 'EMsgVERSION_COMPARE_PROBLEM', "$version1$release1 $operator $version2$release2", $@ ); return undef; } if ($ENV{LANG} =~ /^(C|POSIX|en_US)/) { #this is a work around for NLS problems NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgCOMPARING_VERSION', "$version1$release1 $operator $version2$release2", ($bool ? 'true' : 'false') ); } return $bool; } #-------------------------------------------------------------------------------- =head3 update_rpm_packages_to_csminstall Copy all appropriate rpms to csminstall. Compare packages in PATH to /csminstall and only performa a copy if the files are more recent. Only prompt for CD's if file is not found in PATH or in /csminstall. Arguments: none Returns: none Globals: $::COPY_OPT_FLAG @::Rpms_not_found @::RpmsNotFoundInCmdPath Error: messageFromCat E11 Example: Comments: Dependancy on ServerUtils->create_directory_structure(). Use if (!$::DONT_COPY_RPMS) is true. =cut #-------------------------------------------------------------------------------- sub update_rpm_packages_to_csminstall { # get the version/release of the rpms in /csminstall directory ArchiveUtils->get_csminstall_pathVersion(); # Copy csm packages to /csminstall ArchiveUtils->search_csm(); # Copy open source packages to /csminstall ArchiveUtils->search_opensrc_prereqs(); if ($::COPY_OPT_FLAG) { # force copy flag (-f) - copies all remaining CSM, RSCT, # Director and Open Source rpms to /csminstall if (scalar(@::RpmsNotFoundInCmdPath) >= 1) { NodeUtils->message('E1', 'EMsgNoRpmFound', join(", ", @::RpmsNotFoundInCmdPath)); } else { ArchiveUtils->create_rpm_list_to_copy(); if (scalar(@::Rpms_not_found) >= 1) { NodeUtils->message('E1', 'EMsgNoRpmFound', join(", ", @::Rpms_not_found)); } else { NodeUtils->message('I', 'IMsgCopyingRpms', "CSM, RSCT, Director and Open Source"); ArchiveUtils->copy_rpm(); ServerUtils->post_csm_copy(); } } } else # ignores certain rpms during copy { ArchiveUtils->create_rpm_list_to_copy(); if (scalar(@::Rpms_not_found) >= 1) { #check for the rpms to be ignored my @rpm_ignored = (); my @rpm_not_ignored = (); foreach my $rpm_name (@::Rpms_not_found) { if ( ($rpm_name =~ m/autoupdate/) || ($rpm_name =~ m/perl-libnet/) || ($rpm_name =~ m/perl-DBI/) || ($rpm_name =~ m/perl-XML-Parser/) || ($rpm_name =~ m/perl-XML-Simple/) || ($rpm_name =~ m/fping/)) { push(@rpm_ignored, $rpm_name); } else { push(@rpm_not_ignored, $rpm_name); } } @::Rpms_not_found = @rpm_not_ignored; if (scalar(@rpm_ignored) >= 1) { NodeUtils->message('I', 'IMsgMissingRPM', join(", ", @rpm_ignored)); } if (scalar(@::Rpms_not_found) > 0) { NodeUtils->message('E1', 'EMsgNoRpmFound', join(", ", @::Rpms_not_found)); } NodeUtils->message('I', 'IMsgCopyingRpms', "CSM, RSCT, Director and Open Source"); ArchiveUtils->copy_rpm(); ServerUtils->post_csm_copy(); } else { NodeUtils->message('I', 'IMsgCopyingRpms', "CSM, RSCT, Director and Open Source"); ArchiveUtils->copy_rpm(); ServerUtils->post_csm_copy(); } } # Search for the distro rpms ArchiveUtils->search_copy_distro_rpms(); } #-------------------------------------------------------------------------------- =head3 unmount_iso_image Tries to unmount a file as an ISO image (a CD image as a file). Arguments: mount point (usually "/tmp_loop_mnt") Returns: $::OK if umount worked $::NOK if not Globals: none Error: none Example: my $rc = ArchiveUtils->unmount_iso_image($mount_pt}; Comments: none =cut #-------------------------------------------------------------------------------- sub unmount_iso_image { my ($class, $mount_point) = @_; my $cmd = "$::UMOUNT $mount_point"; NodeUtils->runcmd($cmd, -1); # no exit on error my $rc = $::RUNCMD_RC; if ($rc == 0) { return $::OK; } return $::NOK; } #-------------------------------------------------------------------------------- =head2 installp Support =cut #-------------------------------------------------------------------------------- =head3 get_pkgVersion AIX only routine. Returns the installp image version from Installp command which, looks into the .toc file. Arguments: $installpPackage Returns: AIX installp image version as a string Globals: $::PLTFRM $::INSTALLPCMD Error: messageFromCat E2 Example: not used outside ServerUtils Comments: none =cut #-------------------------------------------------------------------------------- sub get_pkgVersion { my ($class, $pkg) = @_; my ($cmd, $output, $version); if ($::PLTFRM eq "Linux") { $version = ""; return (length($version) ? $version : undef); } elsif ($::PLTFRM eq "AIX") { $cmd = qq($::INSTALLPCMD -L -d . | grep $pkg 2>&1); $output = NodeUtils->runcmd($cmd); chomp($output); (undef, undef, $version, undef) = split(/:/, $output); return (length($version) ? $version : undef); } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E2', 'EMsgINVALID_OSTYPE'); } } #-------------------------------------------------------------------------------- 1; to_copy k0PB$7uq@q@q@ ./opt/csm/pm/CLOG.pmtil$# IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2002,2003 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG package CLOG; =head1 NAME CLOG - Perl API to CSM CLOG logging system. =head1 SYNOPSIS use CLOG; =head1 DESCRIPTION Logging via CSM CLOG from Perl programs. All functions that take parameters use named parameters with either the "-name=>value" or "name=>value" styles, though the "-name=>value" is the standard. So, you can call these functions and pass the parameters in any order you choose. Rest assured that if any required parameters are not provided, you will get an error return code from the function. This class caches basic required data values needed in the CLOG C API and only requires the data specific to each message being recorded. For example, the message catalog name will not generally change, so that is set once in the constructor and this value is used for the life of the object. However, these values may be overridden at each logging request. Continuing with the our example, when the actual request to log an entry is made, a new value for the message catalog may be passed (as the -messageCatalog parameter) and this value will be in effect for this logging request only. =head1 EXPORTED CONTSTANTS =item B =item B - Error messages =item B - Warning messages =item B - Informational messages =item B - Value to indicate all message types =item B =item B - Error in the map file - see error message for details. =item B - The clogger command is bad or missing =item B - Bad parameter passed to function =item B - Bad parameter passed to function =item B - Clog function call was successful. =item B - Unable to allocate storage. =item B - Bad ct_clog_ptr or ct_clog_t. =item B - Bad or missing catalog name, or unable to open message catalog. =item B - Bad or missing message set. =item B - Bad or missing message id. =item B - Bad or missing component name. =item B - Bad or missing LPP name. =item B - Error in call to FFDC. =item B - Unable to connect to RMC. =item B - Denied permission by RMC. =item B - Other RMC error. =item B - Call to cu_get_node_id() failed =item B - Invalid or missing detail data. =item B - Detail data is too large (100 bytes max). =item B - Bad AIX template ID. =item B - Invalid message type. =item B - Bad or missing default message. =item B - Error logging is not enabled - call clog_set_error_log_info() first. =item B - Logging is not enabled for passed message type =item B - Some other error was found in the passed parameters. =item B - A true result value from CLOG. =item B - A false result value from CLOG. =item B - Internal error in CLOG API =head1 EXPORTED VARIABLES =item B - last error that occured in *module* =item B - last error that occured in *module* =cut BEGIN { $::csmpm = $ENV{'CSM_PM'} ? $ENV{'CSM_PM'} : '/opt/csm/pm'; } #for development use use lib $::csmpm; use NodeUtils(); use strict; # This tells perl to honor locale for sorting, dates, etc. # More info about locale.pm and perl handling of locales can be found in # /usr/lib/perl5/5.6.0/locale.pm and the man page for perllocale. use locale; use Carp; use vars qw($VERSION @ISA @EXPORT @EXPORT_OK %EXPORT_TAGS); # $AUTOLOAD); require Exporter; require AutoLoader; #require DynaLoader; @ISA = qw(Exporter); %EXPORT_TAGS = ( ); #@EXPORT = qw( ); #@EXPORT_OK = ( ); #@EXPORT_OK = ( @{ $EXPORT_TAGS{'all'} } ); # CLOGMessageTypes use constant CLOG_ALL_MSGS =>-1; # Value to indicate all message types use constant CLOG_ERROR_MSG => 1; # Error messages use constant CLOG_WARNING_MSG => 2; # Warning messages use constant CLOG_INFO_MSG => 4; # Informational messages use constant CLOG_LAST_MESSAGE_TYPE_VAL => 4; # Internal use only # CLOG Return codes use constant MAP_FILE_ERROR =>-13; # Error in the map file - see error message for details. use constant BAD_OR_MISSING_CLOGGER =>-12; # The clogger command is bad or missing use constant MISSING_PARAM =>-11; # Bad parameter passed to function use constant BAD_PARAM =>-10; # Bad parameter passed to function use constant CLOG_SUCCESS => 0; # Clog function call was successful. use constant CLOG_ALLOC_FAILURE => 1; # Unable to allocate storage. use constant CLOG_INVALID_ENV => 2; # Bad ct_clog_ptr or ct_clog_t. use constant CLOG_INVALID_CATALOG => 3; # Bad or missing catalog name, or unable to open message catalog. use constant CLOG_INVALID_MESSAGE_SET => 4; # Bad or missing message set. use constant CLOG_INVALID_MESSAGE_ID => 5; # Bad or missing message id. use constant CLOG_INVALID_COMP_ID => 6; # Bad or missing component name. use constant CLOG_INVALID_LPP_ID => 7; # Bad or missing LPP name. use constant CLOG_FFDC_ERROR => 8; # Error in call to FFDC. use constant CLOG_RMC_CONN_ERROR => 9; # Unable to connect to RMC. use constant CLOG_RMC_PERM_DENIED =>10; # Denied permission by RMC. use constant CLOG_RMC_ERROR =>11; # Other RMC error. use constant CLOG_BAD_NODE_ID =>12; # Call to cu_get_node_id() failed use constant CLOG_BAD_DETAIL_DATA =>13; # Invalid or missing detail data. use constant CLOG_DETAIL_DATA_OVERSIZE =>14; # Detail data is too large (100 bytes max). use constant CLOG_BAD_AIX_TEMP_ID =>15; # Bad AIX template ID. use constant CLOG_INVALID_MSG_TYPE =>16; # Invalid message type. use constant CLOG_INVALID_DEF_MSG =>17; # Bad or missing default message. use constant CLOG_ERROR_LOG_NOT_ENABLED =>18; # Error logging is not enabled - call clog_set_error_log_info() first. use constant CLOG_MSG_TYPE_NOT_ENABLED =>19; # Logging is not enabled for passed message type use constant CLOG_BAD_PARAMS =>20; # Some other error was found in the passed parameters. use constant CLOG_TRUE =>21; # A true result value from CLOG. use constant CLOG_FALSE =>22; # A false result value from CLOG. use constant CLOG_INTERNAL_ERROR =>23; # Internal error in CLOG API - see trace file for details of error. $VERSION = '1.0'; my $CLOGGER = "/opt/csm/csmbin/clogger"; # catalog name directory where map file is message set name my @CATALOG = ("IBM.CLOG.cat", "/opt/csm/msgmaps/", "Perl"); ################################################################################ # ;mash ################################################################################ sub mash { my $self = shift; my $str = shift; return NodeUtils->quote($str); # print "Before:$str\n"; # $str =~ s/\\/\\\\/sg; # replace single \ with \ # $str =~ s/\$/\\\$/sg; # replace $ with \$ # $str =~ s/\'/\\\'/sg; # replace ' with \' # $str =~ s/\"/\\\"/sg; # replace " with \" # print "After :$str\n"; # return "\"$str\""; } ################################################################################ # ;clear_errors ################################################################################ sub clear_errors { my $self = shift; $self->{error_message} = ""; $self->{error_code} = 0; } ################################################################################ # ;validate_args ################################################################################ sub validate_args { my $self = shift; my %input; my $match; my $required_match; my %match_words_not_seen; my $key; # $#_ returns last index of @_, so if its 6, then we really have 7 elements... if ( $#_ % 2 == 0 ) { $self->{error_code} = MISSING_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', ""); return MISSING_PARAM; } %input = @_; # print "input{_match}=[".$input{"_match"}."]\n"; if ( $input{"_match"} ne "" ) { $match = $input{"_match"}; delete $input{"_match"}; } else { $self->{error_code} = MISSING_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " _match"); return MISSING_PARAM; } if ( $input{"_required"} ne "" ) { $required_match = $input{"_required"}; delete $input{"_required"}; } else { $required_match = $match; } # store a hash of all match words for use later. my $word; foreach $word ( split(/\|/,$required_match) ) { $match_words_not_seen{$word}=1; } # this verifies that the key names are OK foreach $key ( keys %input ) { # print "validate_args. Checking [$key]\n"; $key =~ s/^-//; #remove starting dash if there is one if( $key !~ /($match)$/) { $self->{error_code} = BAD_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgInvalidParamError', $key); return BAD_PARAM; } } # and this verifies that the values are OK foreach $key ( keys %input ) { if( !$input{$key} ) { $self->{error_code} = MISSING_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " $key"); return MISSING_PARAM; } $key =~ s/^-//; delete $match_words_not_seen{$key}; } # finally, verify that we have seen each and every parameter in the match set foreach $key (keys %match_words_not_seen ) { if ( $match_words_not_seen{$key} == 1 ) { print "$key = $match_words_not_seen{$key}\n"; $self->{error_code} = MISSING_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " $key"); return MISSING_PARAM; } } return 0; } =head1 FUNCTIONS Note - each parameter is required to be present and non zero. If the parameter is within [brackets], then it is optional. =cut ################################################################################ ################################################################################ =item B Creates a CLOG object. =item PARAMETERS compID - Component ID lppID - Licenced Product ID messageCatalog - Message catalog file name messageSet - Message set name messageMapDir - Directory where Perl message map is for the message catalog =item RETURNS blessed reference to new object on success BAD_PARAM - bad parameter passed MISSING_PARAM - missing parameter =cut ################################################################################ # ;new ################################################################################ sub new { my $self = { error_code => "", # numeric return code of last action error_message => "", # string error of last action, if any. compID => "", lppID => "", messageCatalog => "", messageSet => "", messageMapDir => "", errorTemplate => "", detailedData => "", detailedDataSize => "", }; my %input; my $key; shift @_; #gets rid of the CLOG input # $#_ returns last index, so if its 6, then we really have 7 elements... if ( $#_ % 2 == 0 ) { $CLOG::ERROR_MESSAGE = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError',""); $CLOG::ERROR_CODE = MISSING_PARAM; return undef; } while(@_){ my ($name, $value) = (shift, shift); $name =~ s/^-//; #remove starting dash if there is one if( $name !~ /(compID|lppID|messageCatalog|messageSet|messageMapDir)$/ ) { $CLOG::ERROR_MESSAGE = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgInvalidParamError', $name); $CLOG::ERROR_CODE = BAD_PARAM; return BAD_PARAM; } else{ $input{$name} = $value; } } # ensure that if a parameter was passed, that its value is present foreach $key ( keys %input ) { if( !$input{$key} ) { $CLOG::ERROR_MESSAGE = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " $key"); $CLOG::ERROR_CODE = BAD_PARAM; return MISSING_PARAM; } } if ( $input{"compID"} ) { $self->{compID} = $input{"compID"}; } else { $CLOG::ERROR_MESSAGE = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " compID"); $CLOG::ERROR_CODE = BAD_PARAM; return MISSING_PARAM; } if ( $input{"lppID"} ) { $self->{lppID} = $input{"lppID"}; } else { $CLOG::ERROR_MESSAGE = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " lppID"); $CLOG::ERROR_CODE = BAD_PARAM; return MISSING_PARAM; } if ( $input{"messageCatalog"} ) { $self->{messageCatalog} = $input{"messageCatalog"}; } else { $CLOG::ERROR_MESSAGE = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " messageCatalog"); $CLOG::ERROR_CODE = BAD_PARAM; return MISSING_PARAM; } if ( $input{"messageSet"} ) { $self->{messageSet} = $input{"messageSet"}; } else { $CLOG::ERROR_MESSAGE = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " messageSet"); $CLOG::ERROR_CODE = BAD_PARAM; return MISSING_PARAM; } if ( $input{"messageMapDir"} ) { $self->{messageMapDir} = $input{"messageMapDir"}; } else { $CLOG::ERROR_MESSAGE = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " messageMapDir"); $CLOG::ERROR_CODE = BAD_PARAM; return MISSING_PARAM; } bless $self; $self->enable_msgs(-messageType => CLOG_ALL_MSGS); $self->clear_errors(); return $self; } ################################################################################ ################################################################################ =item B Returns a list containing the last return error code and last return error message. If the last operation did not return an error, then the error message will be a blank string and the error code will be 0. Note: the error message may not always be set even in cases where the error code is not 0. =item PARAMETERS none =item RETURNS ($ErrorCode, $ErrorMessage) =cut ################################################################################ # ;get_error ################################################################################ sub get_error { my $self = shift; return ($self->{error_code}, $self->{error_message}); } ################################################################################ ################################################################################ =item B Record a message. =item PARAMETERS messageType - one of the error type constants fileName - name of source file logging this entry lineNumber - line number in source file logging this entry sccsID - sccs ID of source file logging this entry messageID - message ID nmumonic from map file [fields] - reference to a list of substitutional field values [compID] - component ID for this entry only [lppID] - lpp ID for this entry only [messageCatalog] - message catalog for this entry only [messageSet] - message set for this entry only [messageMapDir] - message map directory for this entry only [errorTemplate] - AIX error template ID for this entry only [detailedData] - detailed data for this entry only [detailedDataSize] - detailed data size for this entry only =cut # ;clog_rec sub clog_rec { my $self = shift; my %input; my $options; if ( $self->validate_args(@_, _match=>"fileName|lineNumber|sccsID|messageMapDir|messageType|messageID|fields|". "compID|lppID|messageCatalog|messageSet|errorTemplate|detailedData|detailedDataSize", _required=>"fileName|lineNumber|sccsID|messageType|messageID") != 0 ) { return $self->{error_code}; } %input = @_; # Get all required data to be passed to clogger command. We allow any values passed to this # method to override temporarily those stored in this object. Some of these values are never # stored in the object (eg, lineNumber), but we do it this way since # 1) its clearer what we are doing # 2) it does no real harm other than minor run-time cost # 3) if we decide in the future to cache some data internally, this will still have the correct behavior. # basic stuff from constructor my $compID = $input{compID} ? $input{compID} : $self->{compID}; my $lppID = $input{lppID} ? $input{lppID} : $self->{lppID}; my $messageMapDir = $input{messageMapDir} ? $input{messageMapDir} : $self->{messageMapDir}; my $messageSet = $input{messageSet} ? $input{messageSet} : $self->{messageSet}; my $messageCat = $input{messageCatalog} ? $input{messageCatalog} : $self->{messageCatalog}; # AIX error log information my $detailedData = $input{detailedData} ? $input{detailedData} : $self->{detailedData}; my $detailedDataSize = $input{detailedDataSize} ? $input{detailedDataSize} : $self->{detailedDataSize}; my $errorTemplate = $input{errorTemplate} ? $input{errorTemplate} : $self->{errorTemplate}; # Specific to this error logging call my $fileName = $input{fileName} ? $input{fileName} : $self->{fileName}; my $lineNumber = $input{lineNumber} ? $input{lineNumber} : $self->{lineNumber}; my $sccsID = $input{sccsID} ? $input{sccsID} : $self->{sccsID}; my $messageID = $input{messageID} ? $input{messageID} : $self->{messageID}; my $messageType = $input{messageType} ? $input{messageType} : $self->{messageType}; if ( ! $self->is_enabled(-messageType=>$messageType) ) { $self->clear_errors(); return CLOG_SUCCESS; } # print "messageID=$messageID\n"; # print "messageMapDir=$messageMapDir\n"; # print "messageSet=$messageSet\n"; # print "messageCat=$messageCat\n"; # be sure $CLOGGER is runnable if ( ! -x $CLOGGER ) { $self->{error_code} = BAD_OR_MISSING_CLOGGER; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsg_Missing_Clogger'); return BAD_OR_MISSING_CLOGGER; } %input = @_; #formulate the command string my @CommandArgs; # messageMapDir if ( $messageMapDir eq "" ) { $self->{error_code} = MISSING_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " messageMapDir"); return MISSING_PARAM; } # messageSet if ( $messageSet eq "" ) { $self->{error_code} = MISSING_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " messageSet"); return MISSING_PARAM; } # messageCat if ( $messageCat eq "" ) { $self->{error_code} = MISSING_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " messageCat"); return MISSING_PARAM; } # messageID if ( $messageID eq "" ) { $self->{error_code} = MISSING_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " messageID"); return MISSING_PARAM; } push (@CommandArgs," -I0"); push (@CommandArgs," -S0"); push (@CommandArgs," -CIBM.CLOG.cat"); my $field; my @fields; foreach $field ( @{$input{fields}} ) { push (@fields,$self->mash($field)); } # verify that the message can be fetched. my ($msgnum, $msgset, $defaultmsg) = NodeUtils->getmsgmap($messageMapDir, $messageSet, $messageCat, $messageID); # print "getmsgmap() returned = ($msgnum, $msgset, [$defaultmsg] )\n"; if ( $msgnum == -1 ) { $self->{error_code} = MAP_FILE_ERROR; $self->{error_message} = $defaultmsg; return MAP_FILE_ERROR; } # Now fetch the message from the users catalog with any substitution already done. my $FullMessage = NodeUtils->getMessageFromCat($messageCat, $messageMapDir, $messageSet, $messageID, @fields ); push (@CommandArgs," -M".$self->mash($FullMessage)); # compID if ( $compID ) { push(@CommandArgs," -c".$self->mash($compID)); } else { $self->{error_code} = MISSING_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " compID"); return MISSING_PARAM; } # lppID if ( $lppID ) { push(@CommandArgs," -l".$self->mash($lppID)); } else { $self->{error_code} = MISSING_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " lppID"); return MISSING_PARAM; } # messageType if ( $messageType ) { push(@CommandArgs," -t$messageType"); } else { $self->{error_code} = MISSING_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " messageType"); return MISSING_PARAM; } if ( $messageType == CLOG_ERROR_MSG || $messageType == CLOG_WARNING_MSG ) { # detailedData if ( $detailedData ) { push(@CommandArgs," -D".$self->mash($detailedData)); } else { $self->{error_code} = MISSING_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " detailedData"); return MISSING_PARAM; } # detailedDataSize # if ( $detailedDataSize ) { # push(@CommandArgs," -d".$self->mash($detailedDataSize); # } # else { # $self->{error_code} = MISSING_PARAM; # $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, # 'EMsgMissingParamError', " detailedDataSize"); # return MISSING_PARAM; # } # errorTemplate if ( $errorTemplate ) { push(@CommandArgs," -A".$self->mash($errorTemplate)); } else { $self->{error_code} = MISSING_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " errorTemplate"); return MISSING_PARAM; } } # fileName if ( $fileName ) { push(@CommandArgs," -f".$self->mash($fileName)); } else { $self->{error_code} = MISSING_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " fileName"); return MISSING_PARAM; } # lineNumber if ( $lineNumber ) { push(@CommandArgs," -n$lineNumber"); } else { $self->{error_code} = MISSING_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " lineNumber"); return MISSING_PARAM; } # sccsID if ( $sccsID ) { push(@CommandArgs," -s".$self->mash($sccsID)); } else { $self->{error_code} = MISSING_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgMissingParamError', " sccsID"); return MISSING_PARAM; } my $command = "LC_ALL=C $CLOGGER @CommandArgs"; # print "Command = [$command]\n"; # run the command, capture output my $output = `$command`; chomp($output); my $ret = ($? >> 8); # print "$CLOGGER return code was [$ret]\n"; # print "$CLOGGER output was [$output]\n"; $self->clear_errors(); $self->{error_code} = $ret; if ( $self->{error_code} != 0 ) { $self->{error_message} = $output; } return $self->{error_code}; } =item B Enables logging of the passed message type. =item PARAMETERS -messageType : the message type to disnable. =item RETURNS CLOG::CLOG_SUCCESS on success An error code on error - see get_error() =cut ################################################################################ # ;enable_msgs ################################################################################ sub enable_msgs { my $self = shift; my %input; if ( $self->validate_args(@_, _match=>"messageType", _required=>"messageType" ) != 0 ) { return $self->{error_code}; } %input = @_; my $message_type = $input{"messageType"} ? $input{"messageType"} : $input{"-messageType"}; if( $message_type != CLOG_ALL_MSGS && $message_type != CLOG_ERROR_MSG && $message_type != CLOG_WARNING_MSG && $message_type != CLOG_INFO_MSG ) { $self->{error_code} = BAD_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgInvalidParamError', "messageType"); return BAD_PARAM; } if ( $message_type == CLOG_ALL_MSGS ) { $self->{message_mask} = (CLOG_LAST_MESSAGE_TYPE_VAL*2)-1; } else { $self->{message_mask} |= $message_type; } $self->clear_errors(); return CLOG_SUCCESS; } =item B Disables the logging of the passed message type. =item PARAMETERS -messageType : the message type to enable. =item RETURNS CLOG_SUCCESS on success An error code on error - see get_error() =cut ################################################################################ # ;disable_msgs ################################################################################ sub disable_msgs { my $self = shift; my %input; if ( $self->validate_args(@_, _match=>"messageType", _required=>"messageType" ) != 0 ) { return $self->{error_code}; } %input = @_; my $message_type = $input{"messageType"} ? $input{"messageType"} : $input{"-messageType"}; if( $message_type != CLOG_ALL_MSGS && $message_type != CLOG_ERROR_MSG && $message_type != CLOG_WARNING_MSG && $message_type != CLOG_INFO_MSG ) { $self->{error_code} = BAD_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgInvalidParamError', "messageType"); return BAD_PARAM; } if ( $message_type == CLOG_ALL_MSGS ) { $self->{message_mask} = 0; } else { $self->{message_mask} &= ~$message_type; } $self->clear_errors(); return CLOG_SUCCESS; } =item B Checks if the passed message type is enabled. =item PARAMETERS -messageType : the message type to check. =item RETURNS CLOG_TRUE : message type is enabled CLOG_FALSE : message type is not enabled An error code on error - see get_error() =cut ################################################################################ # ;is_enabled ################################################################################ sub is_enabled { my $self = shift; my %input; if ( $self->validate_args(@_, _match=>"messageType", _required=>"messageType" ) != 0 ) { return $self->{error_code}; } %input = @_; my $message_type = $input{"messageType"} ? $input{"messageType"} : $input{"-messageType"}; if( $message_type != CLOG_ERROR_MSG && $message_type != CLOG_WARNING_MSG && $message_type != CLOG_INFO_MSG ) { $self->{error_code} = BAD_PARAM; $self->{error_message} = NodeUtils->getMessageFromCat(@CATALOG, 'EMsgInvalidParamError', "messageType"); return BAD_PARAM; } $self->clear_errors(); if ( $self->{message_mask} & $message_type ) { return CLOG_TRUE; } else { return CLOG_FALSE; } } =item B Sets the LPP ID. =item PARAMETERS -lppID : the LPP ID to set. =item RETURNS CLOG_SUCCESS : success An error code on error - see get_error() =cut ################################################################################ # ;set_lpp_id ################################################################################ sub set_lpp_id { my $self = shift; my %input; if ( $self->validate_args(@_, _match=>"lppID", _required=>"lppID") != 0 ) { return $self->{error_code}; } %input = @_; $self->{lppID} = $input{"lppID"} ? $input{"lppID"} : $input{"-lppID"}; $self->clear_errors(); return CLOG_SUCCESS; } =item B Sets the message catalog. =item PARAMETERS -messageCatalog : the message catalog name. =item RETURNS CLOG_SUCCESS : success An error code on error - see get_error() =cut ################################################################################ # ;set_message_catalog ################################################################################ sub set_message_catalog { my $self = shift; my %input; if ( $self->validate_args(@_, _match=>"messageCatalog" ) != 0 ) { return $self->{error_code}; } %input = @_; $self->{messageCatalog} = $input{"messageCatalog"} ? $input{"messageCatalog"} : $input{"-messageCatalog"}; $self->clear_errors(); return CLOG_SUCCESS; } =item B Sets the message set. =item PARAMETERS -messageSet : the message set numonic (requires message map file) see new() =item RETURNS CLOG_SUCCESS : success An error code on error - see get_error() =cut ################################################################################ # ;set_message_set ################################################################################ sub set_message_set { my $self = shift; my %input; if ( $self->validate_args(@_, _match=>"messageSet",_required=>"messageSet" ) != 0 ) { return $self->{error_code}; } %input = @_; $self->{messageSet} = $input{"messageSet"} ? $input{"messageSet"} : $input{"-messageSet"}; $self->clear_errors(); return CLOG_SUCCESS; } =item B Sets both the message catalog and message set. =item PARAMETERS -messageCatalog : the message catalog name -messageSet : the message set numonic (requires message map file) see new() =item RETURNS CLOG_SUCCESS : success An error code on error - see get_error() =cut ################################################################################ # ;set_catalog_and_set ################################################################################ sub set_catalog_and_set { my $self = shift; my %input; if ( $self->validate_args(@_, _match=>"messageSet|messageCatalog" ) != 0 ) { return $self->{error_code}; } %input = @_; my $messageCat = $input{"messageCatalog"} ? $input{"messageCatalog"} : $input{"-messageCatalog"}; my $ret = $self->set_message_catalog(messageCatalog=>$messageCat); if ( $ret != CLOG_SUCCESS ) { return $ret; } my $messageSet = $input{"messageSet"} ? $input{"messageSet"} : $input{"-messageSet"}; $ret = $self->set_message_set(messageSet=>$messageSet); if ( $ret != CLOG_SUCCESS ) { return $ret; } $self->clear_errors(); return CLOG_SUCCESS; } =item B Sets the component ID. =item PARAMETERS -compID : the component name. =item RETURNS CLOG_SUCCESS : success An error code on error - see get_error() =cut ################################################################################ # ;set_component_id ################################################################################ sub set_component_id { my $self = shift; my %input; if ( $self->validate_args(@_,_match=>"compID",_required=>"compID" ) != 0 ) { return $self->{error_code}; } %input = @_; $self->{compID} = $input{"compID"} ? $input{"compID"} : $input{"-compID"}; $self->clear_errors(); return CLOG_SUCCESS; } =item B Sets the field required to log messages via FFDC, specifically, AIX error log template information. =item PARAMETERS -errorTemplate : -detailedData : -detailedDataSize : =item RETURNS CLOG_SUCCESS : success An error code on error - see get_error() =cut ################################################################################ # ;set_error_log_info ################################################################################ sub set_error_log_info { my $self = shift; my %input; if ( $self->validate_args(@_, _match=>"errorTemplate|detailedData|detailedDataSize", _required=>"errorTemplate|detailedData|detailedDataSize") != 0 ) { return $self->{error_code}; } %input = @_; $self->{errorTemplate} = $input{"errorTemplate"} ? $input{"errorTemplate"} : $input{"-errorTemplate"}; $self->{detailedData} = $input{"detailedData"} ? $input{"detailedData"} : $input{"-detailedData"}; $self->{detailedDataSize} = $input{"detailedDataSize"} ? $input{"detailedDataSize"} : $input{"-detailedDataSize"}; $self->clear_errors(); return CLOG_SUCCESS; } ################################################################################ ################################################################################ sub DESTROY{ my $self = shift; # print "DESTROY called\n"; # if($self =~ "CLOG=HASH"){ # print "FOOEY\n"; # c_destroy($self->{clogptr}); # } } ################################################################################ # _dump ################################################################################ sub _dump { my $self = shift; my $key; print "CLOG environment dump:\n"; printf ("%-20s\t%s\n","Name","Value"); print "----------------------------------------\n"; foreach $key ( sort keys %{$self} ) { printf ("%-20s\t%s\n",$key,$self->{$key}); } print "----------------------------------------\n"; } 1; __END__ =back =head1 AUTHOR Anthony Pioli (cluster@us.ibm.com) =cut = klQ0PB7uAq@Aq@Aq@ ./opt/csm/pm/CSMDefs.pm# IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG ##################################################################### # # # Module: CSMDefs.pm # # # # # # Description: This module contains definitions used by CSM # # commands. These are definitions of CSM # # directories and commands. These definitions # # are not specific to any operating system or # # distribution. # # # # Subroutines: None # # # # Notes: # # # ##################################################################### # @(#)46 1.39 src/csm/install/CSMDefs.pm.perl, setup, csm_rveg, rveg0414a 2/20/04 15:06:17 package CSMDefs; BEGIN { use File::Basename; # - this gives us the path of the command ($::Bin) = dirname($0); # - for this command we assume the modules and # message maps are in the same place } use lib "$::Bin"; use NodeUtils; #------------------------------------------------------------------- # Global Definitions #------------------------------------------------------------------- #--Default Values-- $::MS_INSTALL_SERVER =1; #management server is an install server (by default) $::SERVER_DIRECTORY = "/csmserver"; #directory used to store CSM repository on Install servers $::NOK=1; $::OK=0; # The string that indicates a "Lite" node $::CSMLITE = 'MinManaged'; # To disable CSMLITE, uncomment the following line. #$::CSMLITE = `/bin/date`; $::LCSEXT = "true"; # LCS extension rpms on CSM CD? $::ITDAGENT = "true"; # ITDAgent rpm on CSM CD? # CSM and RSCT Directories $::CSMTOP = "/opt/csm"; $::CSMREQS = $::CSMTOP . "/reqs"; $::CSMBIN = $::CSMTOP . "/bin"; $::CSMCSMBIN = $::CSMTOP . "/csmbin"; $::OPTCSMINSTALL = $::CSMTOP . "/install"; $::RSCTBIN = "/usr/sbin/rsct/bin"; $::TFTPBOOT = "/tftpboot"; $::PXELINUX_CFG_DIR = "/tftpboot/pxelinux.cfg"; $::CSMSTATUSDIR = "/csminstall/csm/status"; $::CSMINSTDIR = "/csminstall"; $::CSMCFGDIR = $::CSMINSTDIR . "/csm/config/"; #$::CSMSTATUSLINK = $::CSMINSTDIR . "/csm/status"; #obsolete $::CSMCLIENTMNTDIR = "/var/opt/csm/mnt"; # CSM Files $::NODEMAP_FILE = "$::CSMCFGDIR/nodemap"; $::CFGINFOFILE = "/opt/csm/install/configinfo"; # CSM and RSCT Commands $::ADDLCSEXT = $::CSMBIN . "/addlcsext"; $::CFORCE = $::CSMBIN . "/cfmupdatenode"; $::CHHWDEV = $::CSMBIN . "/chhwdev"; $::CHNODE = $::CSMBIN . "/chnode"; $::CREATEDHCP = $::CSMCSMBIN . "/createdhcp"; $::CREATEHWDEV = $::CSMCSMBIN . "/createhwdev"; $::CREATENODE = $::CSMCSMBIN . "/createnode"; $::CSM2NIMGRPS = $::CSMBIN . "/csm2nimgrps"; $::CSM2NIMNODES = $::CSMBIN . "/csm2nimnodes"; $::DSH = $::CSMBIN . "/dsh"; $::GETMACS = $::CSMBIN . "/getmacs"; $::HWDEVGRP = $::CSMBIN . "/hwdevgrp"; $::LSCONDRESP = $::RSCTBIN . "/lscondresp"; $::LSHWDEV = $::CSMBIN . "/lshwdev"; $::LSNODE = $::CSMBIN . "/lsnode"; $::MGMTSVR = $::CSMBIN . "/mgmtsvr"; $::MKGETMACRD = $::CSMCSMBIN . "/mkgetmacrd"; $::MONITORINSTALL = $::CSMBIN . "/monitorinstall"; $::NODEGRP = $::CSMBIN . "/nodegrp"; $::REMOTESHELL_EXPECT = $::CSMCSMBIN . "/remoteshell.expect"; $::RMCONDRESP = $::RSCTBIN . "/rmcondresp"; $::RMHWDEV = $::CSMBIN . "/rmhwdev"; $::RMLCSEXT = $::CSMBIN . "/rmlcsext"; $::RMNODE = $::CSMBIN . "/rmnode"; $::RPOWER = $::CSMBIN . "/rpower"; $::SMSUPDATENODE = $::CSMBIN . "/smsupdatenode"; $::STARTCONDRESP = $::RSCTBIN . "/startcondresp"; $::UPDATEDHCP = $::CSMCSMBIN . "/updatedhcp"; $::UPDATENODE = $::CSMBIN . "/updatenode"; # Logfiles $::LOGFILE_HANDLE = undef; $::CSMLOG = "/var/log/csm"; $::CSMSETUPKS_LOG = $::CSMLOG . "/csmsetupks.log"; $::CSMSETUPYAST_LOG = $::CSMLOG . "/csmsetupyast.log"; $::INSTALLNODE_LOG = $::CSMLOG . "/installnode.log"; $::MAKENODE_LOG = $::CSMLOG . "/makenode.log"; $::UPDATENODE_LOG = $::CSMLOG . "/updatenode.log"; $::CSMPREREBOOT_LOG = $::CSMLOG . "/csmprereboot.log"; $::CSMFIRSTBOOT_LOG = $::CSMLOG . "/csmfirstboot.log"; $::INSTALLMSLOG = $::CSMLOG . "/installms.log"; $::CSMSETUPSIS_LOG = $::CSMLOG . "/csmsetupsis.log"; $::COPYSISRPMS_LOG = $::CSMLOG . "/copysisrpms.log"; $::MKSIIMAGE_LOG = $::CSMLOG . "/mksiimage.log"; $::HAMS_LOG = $::CSMLOG . "/hams/hams.log"; $::INSTALL_LOG = "/var/log/csm/install.log"; $::GETADAPTERS_LOG = $::CSMLOG . "/getadapters/getadapters.log"; # locations of OS and package definition files $::OSDEFS = $::OPTCSMINSTALL . "/defs"; $::PKGDEFS = $::OPTCSMINSTALL . "/pkgdefs"; # locations of user-provided customization scripts and data files $::SCRIPTDIR = "/csminstall/csm/scripts"; $::PREINSTALLDIR = "$::SCRIPTDIR/installprereboot"; $::POSTINSTALLDIR = "$::SCRIPTDIR/installpostreboot"; $::UPDATEDIR = "$::SCRIPTDIR/update"; $::SCRIPTDATADIR = "$::SCRIPTDIR/data"; #$::PLTFRM = InstallUtils->get_OSName(); if(NodeUtils->isLinux()==1){ $::PLTFRM = "Linux"; } elsif(NodeUtils->isAIX()==1){ $::PLTFRM = "AIX"; } # These variables are required to determine which .pm files to load # They are used by get_DistributionVersion, get_PkgArchitecture & get_CSMVersion if ($::PLTFRM eq "AIX") { $::UNAME = "/bin/uname"; $::RPMCMD = "/bin/rpm"; $::LSLPP = "/bin/lslpp"; } elsif ($::PLTFRM eq "Linux") { $::UNAME = "/bin/uname"; $::RPMCMD = "/bin/rpm"; } $::DISTRIBUTION= NodeUtils->distribution(); # List of supported distributions @::VALID_DISTROS = ( 'RedHat 7.2', 'RedHat 7.3', 'RedHatAS 2.1', 'RedHatEL-ES 2.1', 'RedHatEL-WS 2.1', 'RedHatEL-AS 3', 'RedHatEL-ES 3', 'RedHatEL-WS 3', 'RedHat 8.0', 'RedHat 9', 'SuSE 8.0', 'SuSE 8.1', 'SuSE 8.2', 'SLES 7.2', 'SLES 8.1', ); @::VALID_AIX_DISTROS = ( 'AIX5.1', 'AIX5.1.0', 'AIX5.2', 'AIX5.2.0', ); @::VALID_CSM_DISTROS = ( '1.1.0', '1.1.1', '1.1.2', '1.1.3', '1.2.0', '1.3.0', '1.3.1', '1.3.2', '1.3.3', ); $::DISTRO = ""; @::valid_powermethod=(); @::valid_console=(); 1; CO k0PB7uxAq@Aq@Aq@ x./opt/csm/pm/InstallDefs.pmmts# IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2002,2003 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG k90PB7uvdq@dq@dq@ v./opt/csm/pm/InstallKRB5Utils.pmr.mapp#!/usr/bin/perl # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG #"@(#)37 1.33 src/csm/krb5/cmds/InstallKRB5Utils.pm.perl, setup, csm_rveg, rveg0414a 3/9/04 09:25:25" #------------------------------------------------------------------------------ =head1 InstallKRB5Utils =head2 Package Description This program module file supplies a set of utility programs for setting up and enabling Kerberos Remote Commands for CSM. If adding to this file, please take a moment to ensure that: 1. Your contrib has a readable pod header describing the purpose and use your contrib. 2. Your contrib is under the correct heading and is in alphabetical order under that heading. 3. You test your contribution by running from the command line: pod2html --verbose --title=NodeUtils NodeUtils.pm.perl --outfile=NodeUls.html and examining the ./NodeUtils.html file in a browser. =cut #------------------------------------------------------------------------------ package InstallKRB5Utils; use strict; use File::Basename; use File::Path; # Provides mkpath() # # Subroutines # #$KRB5::MSGMAPPATH = '/opt/csm/msgmaps'; my $csmroot = $ENV{'CSM_ROOT'} ? $ENV{'CSM_ROOT'} : '/opt/csm'; if (defined $::MSGMAPPATH) { $KRB5::MSGMAPPATH = $ENV{'CSM_ROOT'} ? "$csmroot/msgmaps" : $::MSGMAPPATH; } else { $KRB5::MSGMAPPATH = "$csmroot/msgmaps"; } #------------------------------------------------------------------------------ =head3 setupKRB5server This routine will setup a KRB5 AIX server using the NAS function supplied by AIX. This will only run on an AIX Management Server Input (None) =cut #------------------------------------------------------------------------------ # If /etc/krb5/krb5.conf exists then there is no need to setup the server # exit with message # else # if AIX # if NAS KRB5 installed (config.krb5) exists # prompt user for admin id # if cannot figure out the domain name # prompt user for domain name # realm name is built from domain name (uppercase) # run config.krb5 -S -a admin id -d domain name -r realm name # else # Message need to install NAS KRB5 # else # Message only runs on AIX # Copy the krb5.conf file in the /csminstall/csm/krb5 directory ########################################################### sub setupKRB5server { my $pname = "setupKRB5server"; my $rc = $::OK; my $rc2; my $NASCONFILE = "/etc/krb5/krb5.conf"; my $KRB5CONF = "/usr/krb5/sbin/config.krb5"; my $time; my $mkservercmd; my $nodename; my $cmd; my ($ms_hostname, $ms_ipaddr); my $ms_realm = ""; my $ms_domain = ""; my $ms_adminid = ""; $time = scalar localtime(); chop($nodename = `/bin/hostname`); # get the local hostname NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'LI', 'IMsgStartup', $pname, $time) ; # start message # check for AIX if (NodeUtils->isAIX()) { # check to see if the KRB5 server is aleady installed, /etc/krb5/krb5.conf exists if (!-e $NASCONFILE) { # if it does not exist then proceed to setup server if (-e $KRB5CONF) { # check to see if NAS KRB5 is installed # # prompt the user for the admin id # while ($ms_adminid eq "") { # Prompt for admin id NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'lI', 'IMsgKRB5EnterAdminName') ; #specify the principal name chop($ms_adminid = ); if ($ms_adminid eq "") { NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'lI', 'IMsgKRB5NULLName'); # NULL invalid } } # Form the realm and domain names while ($ms_domain eq "") { # NULL realm and domain, must prompt NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'lI', 'IMsgKRB5EnterDomain') ; # Enter Domain Name chop($ms_domain = ); if ($ms_domain eq "") { NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'lI', 'IMsgKRB5NULLName'); #Null invalid } } $ms_realm = uc($ms_domain); # realm name is upper case of domain $mkservercmd = "$KRB5CONF -S -a $ms_adminid -d $ms_domain -r $ms_realm "; NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgKRB5CMD', $mkservercmd) ; #Record command run #################################### # Now do the work, make the server #################################### system "$mkservercmd"; # run the setup server command if ($? > 0) { $rc = $? / 256; NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgNASError', $KRB5CONF, $rc) ; # Record error return $rc = $::NOK; } } else { # NAS executable missing NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgNASMissing', $KRB5CONF) ; # Record error missing config.kr5 $rc = $::NOK; } } else { InstallKRB5Utils->copyKRB5cfg; # go ahead and copy it in the install # directory NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgKRB5ConfigFileExists', $pname, $NASCONFILE ); # /etc/krb5/krb5.conf exists $rc = $::OK; # This just a warning, must have run the script twice. } # # and copy /etc/krb5.conf into it for the nodes. # InstallKRB5Utils->copyKRB5cfg; } else { # not AIX NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgNotAIXError', $pname); # Not AIX error $rc = $::NOK; } $time = scalar localtime(); NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'LI', 'IMsgEnd', $pname, $time, $rc); #end message return $rc; } ################## end of setupKRB5server################# #------------------------------------------------------------------------------ =head3 setupKRB5client This routine sets up a Kerberos V5 client input \@attrvalues - reference to list of values of the SetupKRB5 attribute =cut #------------------------------------------------------------------------------ # If values indicate KRB5 client setup # If Linux # call processLinuxKRB5file # If AIX # call processAIXKRB5file # (csm principal generated) # Call popk5login to update the .k5login file with the # principal name ########################################################### sub setupKRB5client { my ($class, $attrvalue_list) = @_; my @attrvaluelist = @$attrvalue_list; my $pname = "setupKRB5client"; my $rc = $::OK; my $time; my $n; my $cmd; my $setuprcmd = 0; my $setupclient = 0; my $CONFILE = "/etc/krb5.conf"; my $CONFILESAVE = "/etc/krb5.conf.save"; my $KRB5DIR = "/etc/krb5"; my $NASCONFILE = "/etc/krb5/krb5.conf"; my $NASCONFILESAVE = "/etc/krb5/krb5.conf.save"; my $CONFILEFROMSERVER = "$::CSMCLIENTMNTDIR/csm/krb5.conf"; $time = scalar localtime(); NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'LI', 'IMsgStartup', $pname, $time) ; # start message # determine setup remote command and setup client settings foreach my $n (@attrvaluelist) { if ( ($n == 4) || ($n == 5) || ($n == 6) || ($n == 7) || ($n == 12) || ($n == 13) || ($n == 14) || ($n == 15)) { $setuprcmd = 1; } if ( ($n == 2) || ($n == 3) || ($n == 6) || ($n == 7) || ($n == 10) || ($n == 11) || ($n == 14) || ($n == 15)) { $setupclient = 1; } } # check to see if any work to do # if (($setuprcmd == 0) && ($setupclient == 0)) { NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgKRB5NoClientSetup', $pname); # No client setup requested } # # Check Do we setup the clients? # if ($setupclient) { # if setup KV5 client # copy the /etc/krb5.conf file from /mnt/csminstall/.. NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgKRB5SetupClient', $pname); # setup client message # if Linux and the /etc/krb5.conf does not exist then update it umask(0133); # ensure file perms are 644 if (NodeUtils->isLinux()) { InstallKRB5Utils->processLinuxKRB5file; } else { # node is AIX InstallKRB5Utils->processAIXKRB5file; # check and copy } } # end setupclient # # Check Do we setup the remote commands # if ($setuprcmd) { # if a CSM principal was generated NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgKRB5SetupRemoteCmds', $pname); # setup remote command message $rc = `$::CSMCSMBIN/popk5login`; # populate the .k5login with it if ($? != 0) { # error updating .k5login $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgUpdtk5loginError', $rc); # popk5login error $rc = $::NOK; } else { NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgk5loginUpdated', $pname ); # k5login file updated $rc = $::OK; } } # end setuprcmd $time = scalar localtime(); NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'LI', 'IMsgEnd', $pname, $time, $rc); #end message return $rc; } ################## end of setupKRB5client################# #------------------------------------------------------------------------------ =head3 setupKRB5rcmdprincs Sets up a Kerberos V5 remote command principal input \@attrvalueslist - value of the SetupKRB5 attribute input \@node_list - reference to list of managed nodes, null indicates =cut #------------------------------------------------------------------------------ # all managed nodes # Check attrvalues list to see if we are going to create CSM principal and/or # host principals, if not get out # Determine Management Server name # if add CSM principal requested or add Host principal requested # Build a list of principals to create in the addprincipals.tmp file # if Heimdal Kerberos not installed then # call add_KRB5principals # else tell then they must manually create the principals and keys ########################################################### sub setupKRB5rcmdprincs { my ($class, $attrvalue_list, $node_list) = @_; my @attrvaluelist = @$attrvalue_list; my @nodelist = @$node_list; my $pname = "setupKRB5rcmdprincs"; my $rc = $::OK; my $time; my $n; my $n1; my $cmd; my $createcsmprincipal; my $createhostprincipal; my $principalname = ""; my $CSMKEYTAB = "/var/ct/IW/sec/krb5/csm/k5keytabs/ctsrcmdp"; my $KRB5DIR = "/var/ct/IW/sec/krb5"; my $SECDIR = "/var/ct/IW/sec"; my $KRB5CSMDIR = "/var/ct/IW/sec/krb5/csm"; my $KEYTABDIR = "/var/ct/IW/sec/krb5/csm/k5keytabs"; my $PRINCIPALNAMEFILE = "/var/ct/IW/sec/krb5/csm/k5keytabs/CSMprincipalname"; my $tmpfile = "/var/ct/IW/sec/krb5/csm/k5keytabs/addprincipals.tmp"; my $nodekeytab = ""; my $index = 1; my $principalcreated = 1; my $csmkeytabfile = ""; my $csmkeytab = ""; my $keytab = "keytab"; my $LS_INFO = ""; my $msname = ""; my $msname1 = ""; my $msip = ""; my $localhost; my $heimdal; my $DUMMYKEY; my $CSMPRINCIPALFILE; my $ADDPRINC = "add_KRB5principal"; my (@DestNode, @lsnode_info, @empty_array); # # Start message # $time = scalar localtime(); $heimdal = 0; NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'LI', 'IMsgStartup', $pname, $time) ; # start message # # determine create csm principal and create host principal settings # # Determine the Management Server node id $msname1 = NodeUtils->getRSCThostname; $msname = lc($msname1); # force to lower case # # foreach my $n (@attrvaluelist) { if ( ($n == 4) || ($n == 5) || ($n == 6) || ($n == 7) || ($n == 12) || ($n == 13) || ($n == 14) || ($n == 15)) { $createcsmprincipal = 1; } if ( ($n == 8) || ($n == 9) || ($n == 10) || ($n == 11) || ($n == 12) || ($n == 13) || ($n == 14) || ($n == 15)) { $createhostprincipal = 1; } } # if there is work to do # Get the CSM principal name # if createcsmprincipal # Call add_KRB5principals and create the CSM principal # if createhostprincipal # for each node # Call add_KRB5principals and create the host principal # if ($createcsmprincipal == 0 && $createhostprincipal == 0) { # nothing to do $rc = $::OK; NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgKRB5NoPrincipalSetup', $pname); #No principals requested $time = scalar localtime(); NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'LI', 'IMsgEnd', $pname, $time, $rc); #end message return $rc; } # # setup the required directories to store keytabs # # if (!(-e $SECDIR)) { # if the sec directory does not exist `$::MKDIR -m 600 -p $SECDIR >/dev/null 2>&1`; if ($? != 0) { # if error $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgmkdirError', $SECDIR, $rc ); # Error from mkdir $time = scalar localtime(); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'LI', 'IMsgEnd', $pname, $time, $rc ); #end message return $rc; } } if (!(-e $KRB5DIR)) { # if the directory does not exist `$::MKDIR -m 600 -p $KRB5DIR >/dev/null 2>&1`; if ($? != 0) { # if error $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgmkdirError', $KRB5DIR, $rc ); # Error from mkdir $time = scalar localtime(); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'LI', 'IMsgEnd', $pname, $time, $rc ); #end message return $rc; } } if (!(-e $KRB5CSMDIR)) { # if the directory does not exist `$::MKDIR -m 600 -p $KRB5CSMDIR >/dev/null 2>&1`; if ($? != 0) { # if error $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgmkdirError', $KRB5CSMDIR, $rc ); # Error from mkdir $time = scalar localtime(); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'LI', 'IMsgEnd', $pname, $time, $rc ); #end message return $rc; } } if (!(-e $KEYTABDIR)) { # if the directory does not exist `$::MKDIR -m 755 -p $KEYTABDIR >/dev/null 2>&1`; if ($? != 0) { # if error $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgmkdirError', $KEYTABDIR, $rc ); # Error from mkdir $time = scalar localtime(); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'LI', 'IMsgEnd', $pname, $time, $rc ); #end message return $rc; } } # open the temp file to build for add_principals routine # /var/ct/IW/sec/krb5/csm/k5keytabs/addprincipals.tmp # if (open(PRINCIPALLIST, ">$tmpfile") == 0) { # open the file NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgKRB5OpenFailed', $tmpfile); $rc = $::NOK; return $rc; } $cmd = "$::CHMOD 600 $tmpfile"; $rc = system("$cmd"); if ($rc >> 8) { NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgCHMOD', $rc) ; # chmod error $rc = $::OK; } # # if CSM principal key already exist, then ignore request to generate a new # CSM principal # else # create the CSM principal and keytab # Create the principal name ctsrcmdp. # Store it in the var/ct/IW/sec/krb5/csm/CSMprincipalname file. # Also put the name in the addprincipals.tmp file for add_principal # if ($createcsmprincipal == 1) { # if requested if ((-e "$CSMKEYTAB.$msname.keytab") && !(-z "$CSMKEYTAB.$msname.keytab")) { # if exist and not empty don't create principal $createcsmprincipal = 0; # don't need to NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgPrincipalExists', $pname, "ctsrcmdp.$msname" ); # principal already exists } } if ($createcsmprincipal == 1) { # create a CSM remote command principal requested $principalname = "ctsrcmdp.$msname"; if (open(CSMPRINCIPALFILE, ">$PRINCIPALNAMEFILE") != 0) { # open the file print CSMPRINCIPALFILE $principalname; print CSMPRINCIPALFILE "\n"; close(CSMPRINCIPALFILE); $cmd = "$::CHMOD 600 $PRINCIPALNAMEFILE"; $rc = system("$cmd"); if ($rc >> 8) { NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgCHMOD', $rc); # chmod error $rc = $::OK; } # add the CSM principal and keytab name to file for add_KRB5principals $csmkeytab = "$KEYTABDIR/$principalname.keytab"; # csm keytab file name print PRINCIPALLIST $principalname; print PRINCIPALLIST "\n"; print PRINCIPALLIST $csmkeytab; print PRINCIPALLIST "\n"; } else { NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgKRB5OpenFailed', $PRINCIPALNAMEFILE ); $rc = $::NOK; return $rc; } } # end createcsmprincipal # # Now build list of all the principals for the managed nodes # if ($createhostprincipal == 1) { # create the host remote command principal if (!@nodelist) { # NULL indicates do all managed nodes # get list of all nodes my $ref_lsnode_info = NodeUtils->listNodeAttrs([], "Hostname"); my @lsnode_info = @$ref_lsnode_info; foreach my $hostname (@lsnode_info) { chomp $hostname; push @nodelist, $hostname; } } # end null node list # # if it does not already exist # add the principal to the file for add_KRB5principals # # Determine managment server name my $msnode = InstallUtils->determineMS(\@nodelist); foreach my $n1 (@nodelist) { # for each node create a principal $n = lc($n1); $principalname = "host/$n"; # construct the host principal name $nodekeytab = "$KEYTABDIR/$n.keytab"; # Create the keytab file name if (!(-e $nodekeytab) || (-z $nodekeytab)) { # if the key does not exist # or zero length NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgKRB5CreateNodePrinc', $pname, $n1); # add Node principal(s) print PRINCIPALLIST $principalname; print PRINCIPALLIST "\n"; # # if the node is the Management Server then # add the key to the default krb5.keytab file # my $msnodelower = lc($msnode); if ($n eq $msnodelower) { # put key in default keytable print PRINCIPALLIST "defaultkeytable"; print PRINCIPALLIST "\n"; } else { # put keytab in host keytab file print PRINCIPALLIST $nodekeytab; print PRINCIPALLIST "\n"; } # If create CSM principal was requested # If MS then update # call popk5login to update the .k5login file if ($createcsmprincipal == 1) { if ($n eq $msname) { # if Management server is a managed node $rc = `/opt/csm/csmbin/popk5login` ; #populate the .k5login with it if ($? != 0) { # error updating .k5login $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgUpdtk5loginError', $rc); # popk5login error $rc = $::NOK; } else { NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgk5loginUpdated', $pname) ; # k5login file updated $rc = $::OK; } } # end if CSM principal create request } # end if MS } # end check exists } # end foreach node } # end create host principal if (fileno(PRINCIPALLIST)) { close(PRINCIPALLIST); } # If not Linux with Heimdal installed # call add_KRB5principals to do all the work # create the principal and keys # Else # Tell them must create principals and keys manually. if (!(-z $tmpfile)) { # if there are some principals to add if (NodeUtils->isLinux()) { $cmd = "$::RPMCMD -qa | $::GREP heimdal"; $rc = system("$cmd"); if ($rc == 0) { NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgNonSupportedKRB5', $pname, $time) ; # non supported Heimdal $heimdal = 1; } $rc = $::OK; } if ($heimdal == 0) { `/opt/csm/csmbin/add_KRB5principals ` ; #create the principals and keys if ($? != 0) { # error creating principals $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgUnableToCreatePrincipal'); NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgKRB5ChkaddKRB5'); $rc = $::NOK; } } } else { NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgNoPrincipals', $pname); # no principals to create } # End message # $time = scalar localtime(); NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'LI', 'IMsgEnd', $pname, $time, $rc); #end message return $rc; } # ################## end of setupKRB5rcmdprincs################# #------------------------------------------------------------------------------ =head3 getKRB5tgt Checks for KRB5 enabled and gets KRB5 ticket-granting-ticket =cut #------------------------------------------------------------------------------ # Message need to install NAS KRB5 # else # Message only runs on AIX ########################################################### sub getKRB5tgt { my $KRB5CCNAME; $KRB5CCNAME = ""; if (($ENV{'KRB5CCNAME'}) eq "") { if ($< == 0) { # I am root chop($KRB5CCNAME = `$::CSMCSMBIN/k5rcmdtgt`); } } return ($KRB5CCNAME); } #------------------------------------------------------------------------------ =head3 xferKRB5Keys Initiates the KRB5 key transfer =cut #------------------------------------------------------------------------------ ########################################################### sub xferKRB5keys { my ($class, $node_list) = @_; my @nodes = @$node_list; my $SENDKEYTAB = $::CSMCSMBIN . "/sendkeytab"; my $rc = 0; if (@nodes) { foreach my $node (@nodes) { my $cmd = "$SENDKEYTAB -n $node"; $rc = `$cmd`; if ($? != 0) { # error NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E ', 'EMsgKRB5XFERKEYError', $node); } } } return ($rc); } #------------------------------------------------------------------------------ =head3 copyKRB5cfg Copies the KRB5 config file to the install directory =cut #------------------------------------------------------------------------------ ########################################################### sub copyKRB5cfg { my $NASCONFILE = "/etc/krb5/krb5.conf"; my $KRB5CONFILE = "/etc/krb5.conf"; my $CONFILE; my $rc = 0; my $rc2 = 0; # # Create the /csminstall/csm directory if it doesn't exist # and copy /etc/krb5.conf into it for the nodes. # my $INSTALLDIR_CSM = "/csminstall/csm"; if (!-d "$INSTALLDIR_CSM") { mkpath($INSTALLDIR_CSM, $::VERBOSE, 0755); } if (-e "$NASCONFILE") { $CONFILE = $NASCONFILE; } else { if (-e "$KRB5CONFILE") { $CONFILE = $KRB5CONFILE; } } if ($CONFILE) { # found one my $NEWCONFILE = "$INSTALLDIR_CSM/krb5.conf"; $rc2 = `/bin/cp $CONFILE $NEWCONFILE >/dev/null`; if ($? != 0) { # error updating /etc/krb5.conf $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgKRB5CopyConfigError', $NEWCONFILE ); # error on copy $rc = $::NOK; } } return ($rc); } ################## end of copyKRB5cfg################# #------------------------------------------------------------------------------ =head3 processLinuxKRB5file This routine copies the krb5.conf file on Linux input none =cut #------------------------------------------------------------------------------ # If the /etc/krb5.conf file does not exist then # copy /mnt/csminstall/csm/krb5/krb5.conf file to /etc (0644) # else # diff the two files and if they are different then # copy the one on the node to krb5.conf.save # copy /mnt/csminstall/csm/krb5/krb5.conf file to /etc (0644) # put out a warning that made backup of krb5.conf #------------------------------------------------------------------------------ sub processLinuxKRB5file { my $pname = "setupKRB5client"; my $rc = $::OK; my $time; my $n; my $cmd; my $setuprcmd = 0; my $setupclient = 0; my $CONFILE = "/etc/krb5.conf"; my $CONFILESAVE = "/etc/krb5.conf.save"; my $KRB5DIR = "/etc/krb5"; my $NASCONFILE = "/etc/krb5/krb5.conf"; my $NASCONFILESAVE = "/etc/krb5/krb5.conf.save"; my $CONFILEFROMSERVER = "$::CSMCLIENTMNTDIR/csm/krb5.conf"; # make the /etc/krb5 directory if it does not exist if (!(-e $KRB5DIR)) { # if the sec directory does not exist `$::MKDIR -m 755 -p $KRB5DIR >/dev/null 2>&1`; if ($? != 0) { # if error $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgmkdirError', $KRB5DIR, $rc ); # Error from mkdir $time = scalar localtime(); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'LI', 'IMsgEnd', $pname, $time, $rc ); #end message return $rc; } } if (!-e $CONFILE) { # if /etc/krb5.conf it does not exist then proceed $rc = `/bin/cp $CONFILEFROMSERVER $CONFILE >/dev/null`; if ($? != 0) { # error updating /etc/krb5.conf $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgCopyKRB5ConfigError', $CONFILEFROMSERVER, $CONFILE, $rc ); # copy fail $rc = $::NOK; } else { # copy successful NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgKRB5CfgCreated', $pname, $CONFILE ); # /etc/krb5.conf created $rc = $::OK; } } else { # it exists on Linux # check to see if different than the one from the MS # if different copy node krb5.conf file to backup # copy MS krb5.conf file to node # warn the admin `/usr/bin/diff $CONFILEFROMSERVER $CONFILE `; if ($? != 0) { # differences found # make backup $rc = `/bin/cp $CONFILE $CONFILESAVE >/dev/null`; if ($? != 0) { # error saving $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgCopyKRB5ConfigError', $CONFILE, $CONFILESAVE, $rc); $rc = $::NOK; return $rc; } else { # tell the admin saving NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgMadeKRB5Save', $pname, $CONFILE, $CONFILESAVE); # copy fail } # copy MS to node $rc = `/bin/cp $CONFILEFROMSERVER $CONFILE >/dev/null`; if ($? != 0) { # error updating /etc/krb5.conf $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgCopyKRB5ConfigError', $CONFILEFROMSERVER, $CONFILE, $rc ); # copy fail $rc = $::NOK; return $rc; } else { # tell copying the krb5.conf file to the node NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgKRB5CfgCreated', $pname, $CONFILE); # /etc/krb5.conf created $rc = $::OK; } } } # end diff found return ($rc); } ################## end of processLinuxKRB5file################# #------------------------------------------------------------------------------ =head3 processAIXKRB5file This routine copies the krb5.conf file on AIX input none =cut #------------------------------------------------------------------------------ # If the /etc/krb5.conf and /etc/krb5/krb5.conf file does not exist then # copy /mnt/csminstall/csm/krb5/krb5.conf file to # /etc/krb5/krb5.conf (644) and link it to /etc/krb5.conf # If the /etc/krb5.conf and /etc/krb5/krb5.conf file both exist then # diff the two files and if they are different then # copy the one on the node to krb5.conf.save # copy /mnt/csminstall/csm/krb5/krb5.conf file to /etc/krb5/krb5.conf(0644) # put out a warning that made backup of krb5.conf # If the /etc/krb5.conf exists and /etc/krb5/krb5.conf file does not exist # copy /mnt/csminstall/csm/krb5/krb5.conf file to /etc/krb5/krb5.conf # record existence of /etc/krb5 # If the /etc/krb5.conf does not exist and /etc/krb5/krb5.conf file # does exist, record a warning message but do nothing. # If values indicate KRB5 remote command setup #------------------------------------------------------------------------------ sub processAIXKRB5file { my $pname = "setupKRB5client"; my $rc = $::OK; my $time; my $n; my $cmd; my $setuprcmd = 0; my $setupclient = 0; my $CONFILE = "/etc/krb5.conf"; my $CONFILESAVE = "/etc/krb5.conf.save"; my $KRB5DIR = "/etc/krb5"; my $NASCONFILE = "/etc/krb5/krb5.conf"; my $NASCONFILESAVE = "/etc/krb5/krb5.conf.save"; my $CONFILEFROMSERVER = "$::CSMCLIENTMNTDIR/csm/krb5.conf"; # make the /etc/krb5 directory if it does not exist if (!(-e $KRB5DIR)) { # if the sec directory does not exist `$::MKDIR -m 755 -p $KRB5DIR >/dev/null 2>&1`; if ($? != 0) { # if error $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgmkdirError', $KRB5DIR, $rc ); # Error from mkdir $time = scalar localtime(); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'LI', 'IMsgEnd', $pname, $time, $rc ); #end message return $rc; } } # if /etc/krb5.conf and /etc/krb5/krb5.conf do not exist then # update /etc/krb5/krb5.conf and link to /etc/krb5.conf if ((!-e $CONFILE) && (!-e $NASCONFILE)) { $rc = `/bin/cp $CONFILEFROMSERVER $NASCONFILE >/dev/null`; if ($? != 0) { # error updating /etc/krb/krb5.conf $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgCopyKRB5ConfigError', $CONFILEFROMSERVER, $NASCONFILE, $rc ); # copy fail $rc = $::NOK; return $rc; } else { # copy successful NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgKRB5CfgCreated', $pname, $NASCONFILE ); # /etc/krb5/krb5.conf created $rc = $::OK; } if ($rc == $::OK) { # if copy good, then link it to /etc/krb5.conf $rc = `/bin/ln -s $NASCONFILE $CONFILE > /dev/null`; if ($? != 0) { # error linking $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgLinkKRB5ConfigError', $NASCONFILE, $CONFILE, $rc); $rc = $::NOK; return $rc; } else { # link successful NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgKRB5CfgCreated', $pname, $CONFILE); # /etc/krb5.conf created $rc = $::OK; } } } else { # /etc/krb5.conf and /etc/krb5/krb5.conf exist # diff to see if different from MS krb5.conf # if different # copy the node krb5.conf to krb5.conf.save # copy the MS krb5.conf to krb5.conf # warn the admin if ((-e $CONFILE) && (-e $NASCONFILE)) { # if both exist check to see if different from MS `/usr/bin/diff $CONFILEFROMSERVER $NASCONFILE `; if ($? != 0) { # differences found $rc = `/bin/cp $NASCONFILE $NASCONFILESAVE>/dev/null`; if ($? != 0) { # error saving $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgCopyKRB5ConfigError', $NASCONFILE, $NASCONFILESAVE, $rc ); # copy fail $rc = $::NOK; return $rc; } else { # tell the admin saving NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgMadeKRB5Save', $pname, $NASCONFILE, $NASCONFILESAVE ); # copy fail } # copy the MS krb5.conf file on the node $rc = `/bin/cp $CONFILEFROMSERVER $NASCONFILE >/dev/null`; if ($? != 0) { # error updating /etc/krb5.conf $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgCopyKRB5ConfigError', $CONFILEFROMSERVER, $NASCONFILE, $rc ); # copy fail $rc = $::NOK; return $rc; } else { # tell copying the krb5.conf file to the node NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgKRB5CfgCreated', $pname, $NASCONFILE); # /etc/krb5.conf created $rc = $::OK; } } # end if difference found } else { #if /etc/krb5.conf exists and /etc/krb5/krb5.conf does not # update only /etc/krb5/krb5.conf if ((-e $CONFILE) && (!-e $NASCONFILE)) { # log that /etc/krb5.conf exist NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgKRB5ClientCfgExists', $pname, $CONFILE, $CONFILE); # copy to /etc/krb5/krb5.conf $rc = `/bin/cp $CONFILEFROMSERVER $NASCONFILE >/dev/null`; if ($? != 0) { # error updating /etc/krb/krb5.conf $rc = ($? < 256 ? $? : ($? / 256)); NodeUtils->messageFromCat( 'csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgCopyKRB5ConfigError', $CONFILEFROMSERVER, $NASCONFILE, $rc ); # copy fail $rc = $::NOK; return $rc; } else { # copy successful NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'I', 'IMsgKRB5CfgCreated', $pname, $NASCONFILE); # /etc/krb5/krb5.conf created $rc = $::OK; } } else { # /etc/krb5 does not exist and /etc/krb5/krb5.conf does put out a # warning in the log NodeUtils->messageFromCat('csmKRB5p.cat', $KRB5::MSGMAPPATH, 'csmKRB5p_msg', 'E', 'EMsgKRB5ConfigError', $NASCONFILE, $CONFILE); # missing /etc/krb5.conf $rc = $::OK; } } return ($rc); } } ################## end of processAIXKRB5file################# 1; k"0PB7u$n"q@"q@"q@ $n./opt/csm/pm/InstallUtils.pm.pm#!/usr/bin/perl # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2001,2003 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # @(#)91 1.358 src/csm/core/pm/InstallUtils.pm.perl, setup, csm_rveg, rveg0414a 12/18/03 13:01:52 # #-------------------------------------------------------------------------------- package InstallUtils; # please refer the to the package descriptions at the link below: # http://www.pok.ibm.com/afs/aix.kingston.ibm.com/project/csm/www/home.html#Development # this will get you started with the idea and intention of these changed packages. use strict; use Fcntl qw(:flock); use File::Basename; use File::Find; use File::Path; # Provides mkpath() use ArchiveUtils; use MessageUtils; use NodeUtils; use NetworkUtils; use ServerUtils; #-------------------------------------------------------------------------------- =head1 InstallUtils.pm.perl =head2 Package Description This is a deprecated program module, please do not add to this file. Every entry in this file is a wrapper to a routine in another package. All are a part of the CSM/install product. This work was done to give order to the contents of the InstallUils.pm.perl package, which had grown beyond a managable size. This file is useful for finding the new location of InstallUtils.pm.perl subroutines. Note that in some instances, the package name and the subroutine name have both been changed, but this is not the norm; typically just the package name has been changed. Please don't use these wrappers in your code - instead use the new names, so that we can eventually retire this file. It would also be useful if, as you encounter old "InstallUtils->" subroutines in existing code, you replaced the calls with the new names - assuming you have time to do so. =cut #-------------------------------------------------------------------------------- =head2 Packages use strict; =cut #-------------------------------------------------------------------------------- =head1 Redirected Subroutines =head2 Alphabetical list =head3 CreateRandomName ServerUtils->CreateRandomName =cut sub CreateRandomName { shift; return ServerUtils->CreateRandomName(@_); } #-------------------------------------------------------------------------------- =head3 MountAixCdrom ArchiveUtils->MountAixCdrom =cut sub MountAixCdrom { shift; return ArchiveUtils->MountAixCdrom(@_); } #-------------------------------------------------------------------------------- =head3 SetAllowRequest NodeUtils->SetAllowRequest =cut sub SetAllowRequest { shift; return NodeUtils->SetAllowRequest(@_); } #-------------------------------------------------------------------------------- =head3 SetControlFlag NodeUtils->SetControlFlag =cut sub SetControlFlag { shift; return NodeUtils->SetControlFlag(@_); } #-------------------------------------------------------------------------------- =head3 SetMode NodeUtils->SetMode =cut sub SetMode { shift; return NodeUtils->SetMode(@_); } #-------------------------------------------------------------------------------- =head3 append_logging MessageUtils->append_logging =cut sub append_logging { shift; return MessageUtils->append_logging(@_); } #-------------------------------------------------------------------------------- =head3 backup_logfile MessageUtils->backup_logfile =cut sub backup_logfile { shift; return MessageUtils->backup_logfile(@_); } #-------------------------------------------------------------------------------- =head3 chPerm NetworkUtils->chPerm =cut sub chPerm { shift; return NetworkUtils->chPerm(@_); } #-------------------------------------------------------------------------------- =head3 checkDistroCopied ArchiveUtils->checkDistroCopied =cut sub checkDistroCopied { shift; return ArchiveUtils->checkDistroCopied(@_); } #-------------------------------------------------------------------------------- =head3 checkForNotFound NodeUtils->checkForNotFound =cut sub checkForNotFound { shift; return NodeUtils->checkForNotFound(@_); } #-------------------------------------------------------------------------------- =head3 checkHOMEforSSHperm NetworkUtils->checkHOMEforSSHperm =cut sub checkHOMEforSSHperm { shift; return NetworkUtils->checkHOMEforSSHperm(@_); } #-------------------------------------------------------------------------------- =head3 checkRPMInstall ArchiveUtils->checkRPMInstall =cut sub checkRPMInstall { shift; return ArchiveUtils->checkRPMInstall(@_); } #-------------------------------------------------------------------------------- =head3 checkRSReachability NetworkUtils->checkRSReachability =cut sub checkRSReachability { shift; return NetworkUtils->checkRSReachability(@_); } #-------------------------------------------------------------------------------- =head3 check_valid_install_distros ArchiveUtils->check_valid_install_distros =cut sub check_valid_install_distros { shift; ArchiveUtils->check_valid_install_distros(@_); } #-------------------------------------------------------------------------------- =head3 chkethup NetworkUtils->chkethup =cut sub chkethup { shift; return NetworkUtils->chkethup(@_); } #-------------------------------------------------------------------------------- =head3 close_delete_file ServerUtils->close_delete_file =cut sub close_delete_file { shift; return ServerUtils->close_delete_file(@_); } #-------------------------------------------------------------------------------- =head3 configureTftp NetworkUtils->configureTftp =cut sub configureTftp { shift; return NetworkUtils->configureTftp(@_); } #-------------------------------------------------------------------------------- =head3 configureTftp_inetd NetworkUtils->configureTftp_inetd =cut sub configureTftp_inetd { shift; return NetworkUtils->configureTftp_inetd(@_); } #-------------------------------------------------------------------------------- =head3 copyBinaries ServerUtils->copyBinaries =cut sub copyBinaries { shift; return ServerUtils->copyBinaries(@_); } #-------------------------------------------------------------------------------- =head3 copyDistroCD ArchiveUtils->copyDistroCD =cut sub copyDistroCD { shift; return ArchiveUtils->copyDistroCD(@_); } #-------------------------------------------------------------------------------- =head3 copyDistroPKGPATH ArchiveUtils->copyDistroPKGPATH =cut sub copyDistroPKGPATH { shift; return ArchiveUtils->copyDistroPKGPATH(@_); } #-------------------------------------------------------------------------------- =head3 copy_csm_scripts ServerUtils->copy_csm_scripts =cut sub copy_csm_scripts { shift; return ServerUtils->copy_csm_scripts(@_); } #-------------------------------------------------------------------------------- =head3 copy_rpm ArchiveUtils->copy_rpm =cut sub copy_rpm { shift; return ArchiveUtils->copy_rpm(@_); } #-------------------------------------------------------------------------------- =head3 cpSSHFiles NetworkUtils->cpSSHFiles =cut sub cpSSHFiles { shift; return NetworkUtils->cpSSHFiles(@_); } #-------------------------------------------------------------------------------- =head3 createRPMList ArchiveUtils->createRPMList =cut sub createRPMList { shift; return ArchiveUtils->createRPMList(@_); } #-------------------------------------------------------------------------------- =head3 createRPMSdir ArchiveUtils->createRPMSdir =cut sub createRPMSdir { shift; return ArchiveUtils->createRPMSdir(@_); } #-------------------------------------------------------------------------------- =head3 createRPMVersionListAlreadyInstalled ArchiveUtils->createRPMVersionListAlreadyInstalled =cut sub createRPMVersionListAlreadyInstalled { shift; ArchiveUtils->createRPMVersionListAlreadyInstalled(@_); } #-------------------------------------------------------------------------------- =head3 createSMSConfig ServerUtils->createSMSConfig =cut sub createSMSConfig { shift; return ServerUtils->createSMSConfig(@_); } #-------------------------------------------------------------------------------- =head3 createTftpUser NetworkUtils->createTftpUser =cut sub createTftpUser { shift; return NetworkUtils->createTftpUser(@_); } #-------------------------------------------------------------------------------- =head3 create_nodemap_file ServerUtils->create_nodemap_file =cut sub create_nodemap_file { shift; return ServerUtils->create_nodemap_file(@_); } #-------------------------------------------------------------------------------- =head3 create_rpm_list_to_copy ArchiveUtils->create_rpm_list_to_copy =cut sub create_rpm_list_to_copy { shift; ArchiveUtils->create_rpm_list_to_copy(@_); } #-------------------------------------------------------------------------------- =head3 create_rpm_list_to_install ArchiveUtils->create_rpm_list_to_install =cut sub create_rpm_list_to_install { shift; ArchiveUtils->create_rpm_list_to_install(@_); } #-------------------------------------------------------------------------------- =head3 determineMS NetworkUtils->determineMS =cut sub determineMS { shift; return NetworkUtils->determineMS(@_); } #-------------------------------------------------------------------------------- =head3 display_opensrcLicence ArchiveUtils->display_opensrcLicence =cut sub display_opensrcLicence { shift; return ArchiveUtils->display_opensrcLicence(@_); } #-------------------------------------------------------------------------------- =head3 export_csminstall NetworkUtils->export_csminstall =cut sub export_csminstall { shift; return NetworkUtils->export_csminstall(@_); } #-------------------------------------------------------------------------------- =head3 findImagesInPath ArchiveUtils->findImagesInPath =cut sub findImagesInPath { shift; return ArchiveUtils->findImagesInPath(@_); } #-------------------------------------------------------------------------------- =head3 findRpm ArchiveUtils->findRpm =cut sub findRpm { shift; return ArchiveUtils->findRpm(@_); } #-------------------------------------------------------------------------------- =head3 findRpmInPath ArchiveUtils->findRpmInPath =cut sub findRpmInPath { shift; return ArchiveUtils->findRpmInPath(@_); } #-------------------------------------------------------------------------------- =head3 findRpmInPath_java ArchiveUtils->findRpmInPath_java =cut sub findRpmInPath_java { shift; return ArchiveUtils->findRpmInPath_java(@_); } #-------------------------------------------------------------------------------- =head3 genHex NetworkUtils->genHex =cut sub genHex { shift; return NetworkUtils->genHex(@_); } #-------------------------------------------------------------------------------- =head3 getBaseDir ServerUtils->getBaseDir =cut sub getBaseDir { shift; return ServerUtils->getBaseDir(@_); } #-------------------------------------------------------------------------------- =head3 getBladeStatus NodeUtils->getBladeStatus =cut sub getBladeStatus { shift; return NodeUtils->getBladeStatus(@_); } #-------------------------------------------------------------------------------- =head3 get_CSMVersion NodeUtils->get_CSMVersion =cut sub get_CSMVersion { shift; return NodeUtils->get_CSMVersion(@_); } #-------------------------------------------------------------------------------- =head3 get_DistributionName NodeUtils->get_DistributionName =cut sub get_DistributionName { shift; return NodeUtils->get_DistributionName(@_); } #-------------------------------------------------------------------------------- =head3 get_DistributionVersion NodeUtils->get_DistributionVersion =cut sub get_DistributionVersion { shift; return NodeUtils->get_DistributionVersion(@_); } #-------------------------------------------------------------------------------- =head3 getInstallDir ServerUtils->getInstallDir =cut sub getInstallDir { shift; return ServerUtils->getInstallDir(@_); } #-------------------------------------------------------------------------------- =head3 get_OSDefs ServerUtils->get_OSDefs =cut sub get_OSDefs { shift; return ServerUtils->get_OSDefs(@_); } #-------------------------------------------------------------------------------- =head3 get_OSName NodeUtils->get_OSName =cut sub get_OSName { shift; return NodeUtils->get_OSName(@_); } #-------------------------------------------------------------------------------- =head3 get_PkgArchitecture ArchiveUtils->get_PkgArchitecture =cut sub get_PkgArchitecture { shift; return ArchiveUtils->get_PkgArchitecture(@_); } #-------------------------------------------------------------------------------- =head3 getRPMSDir ArchiveUtils->getRPMSDir =cut sub getRPMSDir { shift; return ArchiveUtils->getRPMSDir(@_); } #-------------------------------------------------------------------------------- =head3 getRPMVersionRelease ArchiveUtils->getRPMVersionRelease =cut sub getRPMVersionRelease { shift; return ArchiveUtils->getRPMVersionRelease(@_); } #-------------------------------------------------------------------------------- =head3 getRealRPMSDir ArchiveUtils->getRealRPMSDir =cut sub getRealRPMSDir { shift; return ArchiveUtils->getRealRPMSDir(@_); } #-------------------------------------------------------------------------------- =head3 getRecentVersionRpm ArchiveUtils->getRecentVersionRpm =cut sub getRecentVersionRpm { shift; return ArchiveUtils->getRecentVersionRpm(@_); } #-------------------------------------------------------------------------------- =head3 getRemoteShell NetworkUtils->getRemoteShell =cut sub getRemoteShell { shift; return NetworkUtils->getRemoteShell(@_); } #-------------------------------------------------------------------------------- =head3 getReqsNotSatisfied ArchiveUtils->getReqsNotSatisfied =cut sub getReqsNotSatisfied { shift; return ArchiveUtils->getReqsNotSatisfied(@_); } #-------------------------------------------------------------------------------- =head3 getRequiredRpms ArchiveUtils->getRequiredRpms =cut sub getRequiredRpms { shift; return ArchiveUtils->getRequiredRpms(@_); } #-------------------------------------------------------------------------------- =head3 getRootHomeDir NetworkUtils->getRootHomeDir =cut sub getRootHomeDir { shift; return NetworkUtils->getRootHomeDir(@_); } #-------------------------------------------------------------------------------- =head3 getSetupRemoteShell NetworkUtils->getSetupRemoteShell =cut sub getSetupRemoteShell { shift; return NetworkUtils->getSetupRemoteShell(@_); } #-------------------------------------------------------------------------------- =head3 getSetupKRB5 NodeUtils->getSetupKRB5 =cut sub getSetupKRB5 { shift; return NodeUtils->getSetupKRB5(@_); } #-------------------------------------------------------------------------------- =head3 getUpdateDir ServerUtils->getUpdateDir =cut sub getUpdateDir { shift; return ServerUtils->getUpdateDir(@_); } #-------------------------------------------------------------------------------- =head3 get_common_attrs NodeUtils->get_common_attrs =cut sub get_common_attrs { shift; return NodeUtils->get_common_attrs(@_); } #-------------------------------------------------------------------------------- =head3 get_csminstall_pathVersion ArchiveUtils->get_csminstall_pathVersion =cut sub get_csminstall_pathVersion { shift; ArchiveUtils->get_csminstall_pathVersion(@_); } #-------------------------------------------------------------------------------- =head3 get_definition_version ArchiveUtils->get_definition_version =cut sub get_definition_version { shift; return ArchiveUtils->get_definition_version(@_); } #-------------------------------------------------------------------------------- =head3 get_lock ServerUtils->get_lock =cut sub get_lock { shift; return ServerUtils->get_lock(@_); } #-------------------------------------------------------------------------------- =head3 getmacs_via_dsh NetworkUtils->getmacs_via_dsh =cut sub getmacs_via_dsh { shift; return NetworkUtils->getmacs_via_dsh(@_); } #-------------------------------------------------------------------------------- =head3 get_management_server NetworkUtils->get_management_server =cut sub get_management_server { shift; return NetworkUtils->get_management_server(@_); } #-------------------------------------------------------------------------------- =head3 get_osdefs_files ServerUtils->get_osdefs_files =cut sub get_osdefs_files { shift; return ServerUtils->get_osdefs_files(@_); } #-------------------------------------------------------------------------------- =head3 get_pkgVersion ArchiveUtils->get_pkgVersion =cut sub get_pkgVersion { shift; return ArchiveUtils->get_pkgVersion(@_); } #-------------------------------------------------------------------------------- =head3 get_pkgdefs ServerUtils->get_pkgdefs =cut sub get_pkgdefs { shift; return ServerUtils->get_pkgdefs(@_); } #-------------------------------------------------------------------------------- =head3 get_pkgdefs_files ServerUtils->get_pkgdefs_files =cut sub get_pkgdefs_files { shift; return ServerUtils->get_pkgdefs_files(@_); } #-------------------------------------------------------------------------------- =head3 get_script_list ServerUtils->get_script_list =cut sub get_script_list { shift; return ServerUtils->get_script_list(@_); } #-------------------------------------------------------------------------------- =head3 get_target_nodes NodeUtils->get_target_nodes =cut sub get_target_nodes { shift; return NodeUtils->get_target_nodes(@_); } #-------------------------------------------------------------------------------- =head3 get_uniqu_arry_elemnts ServerUtils->get_uniqu_arry_elemnts =cut sub get_uniqu_arry_elemnts { shift; return ServerUtils->get_uniqu_arry_elemnts(@_); } #-------------------------------------------------------------------------------- =head3 groupNFSnodes NetworkUtils->groupNFSnodes =cut sub groupNFSnodes { shift; return NetworkUtils->groupNFSnodes(@_); } #-------------------------------------------------------------------------------- =head3 inc_ip NetworkUtils->inc_ip =cut sub inc_ip { shift; return NetworkUtils->inc_ip(@_); } #-------------------------------------------------------------------------------- =head3 initialize_status MessageUtils->initialize_status =cut sub initialize_status { shift; return MessageUtils->initialize_status(@_); } #-------------------------------------------------------------------------------- =head3 installRequiredRpms ArchiveUtils->installRequiredRpms =cut sub installRequiredRpms { shift; return ArchiveUtils->installRequiredRpms(@_); } #-------------------------------------------------------------------------------- =head3 installSSHFiles NetworkUtils->installSSHFiles =cut sub installSSHFiles { shift; return NetworkUtils->installSSHFiles(@_); } #-------------------------------------------------------------------------------- =head3 invokeLAP ArchiveUtils->invokeLAP =cut sub invokeLAP { shift; return ArchiveUtils->invokeLAP(@_); } #-------------------------------------------------------------------------------- =head3 isAutoupdateInstalled ServerUtils->isAutoupdateInstalled =cut sub isAutoupdateInstalled { shift; return ServerUtils->isAutoupdateInstalled(@_); } #-------------------------------------------------------------------------------- =head3 makeSyncHash ServerUtils->makeSyncHash =cut sub makeSyncHash { shift; return ServerUtils->makeSyncHash(@_); } #-------------------------------------------------------------------------------- =head3 make_config_file ServerUtils->make_config_file =cut sub make_config_file { shift; return ServerUtils->make_config_file(@_); } #-------------------------------------------------------------------------------- =head3 make_node_list_file ServerUtils->make_node_list_file =cut sub make_node_list_file { shift; return ServerUtils->make_node_list_file(@_); } #-------------------------------------------------------------------------------- =head3 make_script_lists ServerUtils->make_script_lists =cut sub make_script_lists { shift; return ServerUtils->make_script_lists(@_); } #-------------------------------------------------------------------------------- =head3 name2list ServerUtils->name2list =cut sub name2list { shift; return ServerUtils->name2list(@_); } #-------------------------------------------------------------------------------- =head3 nfsprobe NetworkUtils->nfsprobe =cut sub nfsprobe { shift; return NetworkUtils->nfsprobe(@_); } #-------------------------------------------------------------------------------- =head3 parseRequire ArchiveUtils->parseRequire =cut sub parseRequire { shift; return ArchiveUtils->parseRequire(@_); } #-------------------------------------------------------------------------------- =head3 post_csm_copy ServerUtils->post_csm_copy =cut sub post_csm_copy { shift; return ServerUtils->post_csm_copy(@_); } #-------------------------------------------------------------------------------- =head3 release_lock ServerUtils->release_lock =cut sub release_lock { shift; return ServerUtils->release_lock(@_); } #-------------------------------------------------------------------------------- =head3 restartTftp NetworkUtils->restartTftp =cut sub restartTftp { shift; return NetworkUtils->restartTftp(@_); } #-------------------------------------------------------------------------------- =head3 returnSubdirectory ServerUtils->returnSubdirectory =cut sub returnSubdirectory { shift; return ServerUtils->returnSubdirectory(@_); } #-------------------------------------------------------------------------------- =head3 rmNodesKnownHosts NetworkUtils->rmNodesKnownHosts =cut sub rmNodesKnownHosts { shift; return NetworkUtils->rmNodesKnownHosts(@_); } #-------------------------------------------------------------------------------- =head3 search_copy_distro_rpms ArchiveUtils->search_copy_distro_rpms =cut sub search_copy_distro_rpms { shift; ArchiveUtils->search_copy_distro_rpms(@_); } #-------------------------------------------------------------------------------- =head3 search_csm ArchiveUtils->search_csm =cut sub search_csm { shift; return ArchiveUtils->search_csm(@_); } #-------------------------------------------------------------------------------- =head3 search_opensrc_prereqs ArchiveUtils->search_opensrc_prereqs =cut sub search_opensrc_prereqs { shift; return ArchiveUtils->search_opensrc_prereqs(@_); } #-------------------------------------------------------------------------------- =head3 search_rpm_csminstall_path ArchiveUtils->search_rpm_csminstall_path =cut sub search_rpm_csminstall_path { shift; ArchiveUtils->search_rpm_csminstall_path(@_); } #-------------------------------------------------------------------------------- =head3 secureFilePermissions NetworkUtils->secureFilePermissions =cut sub secureFilePermissions { shift; return NetworkUtils->secureFilePermissions(@_); } #-------------------------------------------------------------------------------- =head3 setupAIXRSH NetworkUtils->setupAIXRSH =cut sub setupAIXRSH { shift; return NetworkUtils->setupAIXRSH(@_); } #-------------------------------------------------------------------------------- =head3 setupLinuxRSH NetworkUtils->setupLinuxRSH =cut sub setupLinuxRSH { shift; return NetworkUtils->setupLinuxRSH(@_); } #-------------------------------------------------------------------------------- =head3 setupRemoteShellforFullInstall NetworkUtils->setupRemoteShellforFullInstall =cut sub setupRemoteShellforFullInstall { shift; NetworkUtils->setupRemoteShellforFullInstall(@_); } #-------------------------------------------------------------------------------- =head3 start_logging MessageUtils->start_logging =cut sub start_logging { shift; return MessageUtils->start_logging(@_); } #-------------------------------------------------------------------------------- =head3 start_nfs NetworkUtils->start_nfs =cut sub start_nfs { shift; return NetworkUtils->start_nfs(@_); } #-------------------------------------------------------------------------------- =head3 stop_logging MessageUtils->stop_logging =cut sub stop_logging { shift; return MessageUtils->stop_logging(@_); } #-------------------------------------------------------------------------------- =head3 subnet NetworkUtils->subnet =cut sub subnet { shift; return NetworkUtils->subnet(@_); } #-------------------------------------------------------------------------------- =head3 supportedSSHversion NetworkUtils->supportedSSHversion =cut sub supportedSSHversion { shift; return NetworkUtils->supportedSSHversion(@_); } #-------------------------------------------------------------------------------- =head3 syncServers ServerUtils->syncServers =cut sub syncServers { shift; return ServerUtils->syncServers(@_); } #-------------------------------------------------------------------------------- =head3 testVersion ArchiveUtils->testVersion =cut sub testVersion { shift; return ArchiveUtils->testVersion(@_); } #-------------------------------------------------------------------------------- =head3 testvalidconsole NodeUtils->testvalidconsole =cut sub testvalidconsole { shift; return NodeUtils->testvalidconsole(@_); } #-------------------------------------------------------------------------------- =head3 testvalidpowermethod NodeUtils->testvalidpowermethod =cut sub testvalidpowermethod { shift; return NodeUtils->testvalidpowermethod(@_); } #-------------------------------------------------------------------------------- =head3 unexport_csminstall NetworkUtils->unexport_csminstall =cut sub unexport_csminstall { shift; return NetworkUtils->unexport_csminstall(@_); } #-------------------------------------------------------------------------------- =head3 verifyTftp NetworkUtils->verifyTftp =cut sub verifyTftp { shift; return NetworkUtils->verifyTftp(@_); } #-------------------------------------------------------------------------------- =head3 verify_dhcp NetworkUtils->verify_dhcp =cut sub verify_dhcp { shift; return NetworkUtils->verify_dhcp(@_); } #-------------------------------------------------------------------------------- =head3 write_status MessageUtils->write_status =cut sub write_status { shift; return MessageUtils->write_status(@_); } #-------------------------------------------------------------------------------- 1; sea k00PBm7u"q@"q@"q@ ./opt/csm/pm/MessageUtils.pm.pmm#!/usr/bin/perl # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # @(#)29 1.4 src/csm/core/pm/MessageUtils.pm.perl, setup, csm_rveg, rveg0414a 2/20/04 17:15:20 # ##################################################################### package MessageUtils; use strict; # locale tells perl to honor locale for sorting, dates, etc. # more info about locale.pm and perl handling of locales can be found # in /usr/lib/perl5/5.6.0/locale.pm and the man page for perllocale. use locale; use Socket; use File::Path; my $msgs; my $distro; my $useTranslatedMsg; my %catHashes; my $csmroot; my ($MSGCAT, $MSGMAPPATH, $MSGSET); my $NO_NODERANGES; my $NODEGROUPEXPMEM_WARNING = 1; # $NodeUtils::NO_MESSAGES; # Set this to 1 if you do not want NodeUtils to # print any error msgs # $NodeUtils::errno; # Will be set if an error occurs. You must zero # this out before calling a NodeUtils function, # if you want to check it afterwards. BEGIN { # This enables us to redirect where it looks for other CSM files during development $csmroot = $ENV{'CSM_ROOT'} ? $ENV{'CSM_ROOT'} : '/opt/csm'; $MSGCAT = 'nodecmds.cat'; if (defined $::MSGMAPPATH) { $MSGMAPPATH = $ENV{'CSM_ROOT'} ? "$csmroot/msgmaps" : $::MSGMAPPATH; } else { $MSGMAPPATH = "$csmroot/msgmaps"; } $MSGSET = 'NodeUtils'; } umask(0022); # This sets umask for all CSM files so that group and world only # have read permissions. # To change it, simply use the umask call in your script, after # the "use NodeUtils;" line #-------------------------------------------------------------------------------- =head1 MessageUtils =head2 Package Description This program module file, supports the CSM/install messaging and status dependencies. If adding to this file, please take a moment to ensure that: 1. Your contrib has a readable pod header describing the purpose and use of your contrib. 2. Your contrib is under the correct heading and is in alphabetical order under that heading. 3. You test your contribution by running from the command line: pod2html --verbose --title=MessageUtils MessageUtils.pm.perl --outfile=MessageUtils.html and examining the ./MessageUtils.html file in a browser. =cut #-------------------------------------------------------------------------------- =head2 Package Dependancies use strict; use Fcntl qw(:flock); use File::Basename; use File::Find; use File::Path; # Provides mkpath() =cut =cut #-------------------------------------------------------------------------------- =head1 Subroutines by Functional Group =cut #-------------------------------------------------------------------------------- =head2 Messaging =cut #-------------------------------------------------------------------------------- =head3 getMessage Returns a msg from a catalog. Arguments: Input arguments are: msg id and then the values to be plugged into the msg. Returns: A msg from a catalog. Globals: $::MSGCAT $::MSGMANPATH $::MSGSET Error: Internal error message. Example: MessageUtils->getMessageFromCat ( $::MSGCAT, $::MSGMAPPATH, $::MSGSET, @_); Comments: This function also uses the same global vars as message(). =cut #-------------------------------------------------------------------------------- sub getMessage { shift; # get rid of the class name if (!defined($::MSGCAT) || !defined($::MSGMAPPATH)) { return NodeUtils->programName() . ": Internal globabl variable MSGCAT or MSGMAPPATH not defined on call to NodeUtils::getMessage().\n"; } return MessageUtils->getMessageFromCat($::MSGCAT, $::MSGMAPPATH, $::MSGSET, @_); } #-------------------------------------------------------------------------------- =head3 getMessageFromCat Returns a message without relying on the global variables for msg catalog, msg map path, and msg set parameters. Arguments: The arguments are: msg catalog, msg map path, msg set, and then the same args as getMessage(). Returns: Multiple posible message strings. Globals: $::MSGCAT $::MSGMAPPATH $::MSGSET Error: Multiple posible message strings. Example: MessageUtils->getMessageFromCat( $::MSGCAT, $::MSGMAPPATH, $::MSGSET, @_); Comments: none =cut #-------------------------------------------------------------------------------- sub getMessageFromCat { # Process the arguments shift; # get rid of the class name my $msgcat = shift; my $msgmappath = shift; my $msgset = shift; my $msgid = shift; # the rest are the values to be plugged into the msg. They are in @_ if (!length($msgset)) { $msgset = NodeUtils->programName(); } my ($msgnum, $msgsetnum, $defaultmsg) = MessageUtils->getmsgmap($msgmappath, $msgset, $msgcat, $msgid); # Check the NLS related env vars to determine if we really have to get the msg from a # translated catalog, or if we can just use the default msg from the msg map, because # the latter is much faster (does not have to fork a process for each msg). if (!MessageUtils->useTranslatedMsg() ) # just display default msg from msg map { #print "(using default msg...)\n"; $defaultmsg =~ s/^\'(.*)\'$/$1/s; # remove the surrounding single quotes if (NodeUtils->isLinux()) { $defaultmsg =~ s/^(\s*%\d\$s:\s*|\s*)\d{4}-\d{3}\s*/$1/; } # on linux remove the error number $defaultmsg = MessageUtils->substituteValues($defaultmsg, @_); $defaultmsg = MessageUtils->processNewlines($defaultmsg); return $defaultmsg; } else # use translated msg from catalog via dspmsg { #print "(using translated msg via dspmsg...)\n"; # We have to quote the values if they have embedded blanks and other funny # chars. my @values = @_; # have to make a copy because @_ is readonly foreach my $v (@values) { $v = NodeUtils->quote(MessageUtils->processNewlines($v)); } # Build the command string and invoke dspmsg my $cmd = "/usr/bin/dspmsg -s $msgsetnum $msgcat $msgnum $defaultmsg " . join(' ', @values) . ' 2>&1'; #print "$cmd\n"; my $msg = `$cmd`; my $rc = $? >> 8; if ($rc) { return NodeUtils->programName() . ": Error running dspmsg to display a message. Exit code from dspmsg is $rc. Command: $cmd\nMessage from command: $msg\n"; } return $msg; } } #-------------------------------------------------------------------------------- =head3 getmsg Get and return a msg from a msg hash ref. Used in a similar way to the msg() function, except w/o the severity code. Arguments: $msg catalog, $msg ID Returns: a message string Globals: none Error: warining Example: $msg = MessageUtils->getmsg($msgcat, $msgid, @_); Comments: none =cut #-------------------------------------------------------------------------------- sub getmsg { my $class = shift; my $msgcat = shift; my $msgid = shift; # Find the msg and substitute the values left in @_ into the msg my $m = $$msgcat{$msgid}; if (!defined($m)) { $m = NodeUtils->programName() . ": Can not find message $msgid in the message hash variable.\n"; } if (NodeUtils->isLinux()) { $m =~ s/^(\s*%\d\$s:\s*)\d{4}-\d{3}\s*/$1/; } # on linux remove the error number $m = MessageUtils->substituteValues($m, @_); $m = MessageUtils->processNewlines($m); return $m; } #-------------------------------------------------------------------------------- =head3 getmsgmap The perl equivalent of the ctdspmsg command. It finds a msg mnemonic and the corresponding msg set, msg number, and default msg in a msg map file. Arguments: $msgpath, $msgset, $msgcat, $msgid Returns: a tuple: msg set, msg number and default msg as an array. Globals: _ Error: (-1, -1, $message or progam name); Example: my ($msgnum, $msgsetnum, $defaultmsg) = MessageUtils->getmsgmap($msgmappath, $msgset, $msgcat, $msgid); Comments: none =cut #-------------------------------------------------------------------------------- sub getmsgmap { my ($class, $msgpath, $msgset, $msgcat, $msgid) = @_; my ($catbase) = $msgcat =~ /(.+)\.cat$/; my $mapname = "$msgpath/$catbase.$msgset.map"; # If we have not read the msg map yet, do that my $catHash = $catHashes{$mapname}; # this gets a reference to the msg set hash if (!defined($catHash)) { #print "Opening $mapname...\n"; if (!open(CATFILE, $mapname)) { my $m = NodeUtils->programName() . ": Can not open message map file $mapname to retrieve message $msgid.\n"; return (-1, -1, $m); } $catHash = {}; # create the hash and save the reference to it $catHashes{$mapname} = $catHash; while () # this puts the next line into $_ { my ($mnemonic, $msgnum, $msgset, $defaultmsg) = split(' ', $_, 4); chomp($defaultmsg); $$catHash{$mnemonic} = [$msgnum, $msgset, $defaultmsg]; } } # Find the msg in the hash and display it my $msgref = $$catHash{$msgid}; if (!defined($msgref)) { my $m = NodeUtils->programName() . ": Can not find message $msgid in message map file $mapname.\n"; return (-1, -1, $m); } return @$msgref; # msgnum, msgset, defaultmsg } #-------------------------------------------------------------------------------- =head3 msg Display a msg from a hash reference. The 1st arg is the hash reference and the rest of the args are the same as message(). The msgs in the hash should be similar in format to msgs in a catalog. This means the following: - it should use %1$s for substitution instead of %s - it should include a newline on the end, if desired - if the msg is a warning or error, it should have %1$s: at the beginning to have the program name plugged in - it can have a msg number, but doesn't have to Arguments: see intro above Returns: nothing Globals: none Error: none Example: MessageUtils->msg($::MSGS,'E2','OPERATION_FAILED',$var); Comments: none =cut #-------------------------------------------------------------------------------- sub msg { my $class = shift; my $msgcat = shift; MessageUtils->messageFromCat($msgcat, '', '', @_); } #-------------------------------------------------------------------------------- =head3 message Display a msg from a msg catalog to stdout, stderr, or a log file. This function is primarily meant for commands and other code that is sending output directly to the user. Even the log is really a capture of this interactive output. The CLOG API should be used by daemons to log important events. Arguments: The arguments of the message() function are: - severity_code - A string containing 1 or 2 characters indicating the severity or type of message, then some optional digits containing an exit code. Here's the meaning of the 1st character: I - informational W - warning. This type of message will be sent to stderr. The program name will be plugged into the 1st argument in the msg. E - error. This type of message will be sent to stderr. The program name will be plugged into the 1st argument in the msg. P - prompt string. If you don't want the newline at the end of the prompt, don't put it in the message in the catalog. O - program output. V - verbose. This message should only be displayed if $::VERBOSE is set. If $::LOG_FILE_HANDLE is set, the message goes to both the screen and that log file. (Verbose msgs will be sent to the log file even if $::VERBOSE is not set.) Optionally, an L can be put before any of the above characters meaning send this message only to the log file handle in $::LOG_FILE_HANDLE. Also, a lowercase L can be put before any of the above characters to mean do NOT send this to the log file, even if $::LOG_FILE_HANDLE is set. - msg_id The message to display out of the catalog. The messages in the catalog should have the newline at the end (if appropriate) and the error message number in it (if an error). - The rest of the arguments are values to substitute for %s in the msg. Returns: none Globals: MSGCAT - the name of the message catalog containing the messages MSGMAPPATH - the path of the message map containing the messages MSGSET - the name of the msg set withing the catalog. If not set, it will default to the program name. Error: _none Example: $::MSGCAT = 'csmserver.cat'; $::MSGMAPPATH = '/opt/csm/msgmaps'; blah; MessageUtils->message('E2', 'EMsgOPERATION_FAILED', $value1, $value2); Comments: For debugging purposes, if you set the undocumented environment variable CSM_MESSAGE_DEBUG, it will prefix each msg with the msg mnemonic. =cut #-------------------------------------------------------------------------------- sub message { shift; # get rid of the class name if (!defined($::MSGCAT) || !defined($::MSGMAPPATH)) { # Make this msg go through the normal msg processing so we send it to the log file, # if appropriate, and we exit with the right rc, if appropriate. my $m = NodeUtils->programName() . ": Internal globabl variable MSGCAT or MSGMAPPATH not defined on call to NodeUtils::message().\n"; my $hashref = {M => $m}; MessageUtils->messageFromCat($hashref, '', '', $_[0], 'M'); return; } MessageUtils->messageFromCat($::MSGCAT, $::MSGMAPPATH, $::MSGSET, @_); } #-------------------------------------------------------------------------------- =head3 messageFromCat Prints a msg w/o relying on the global vars for the msg catalog, msg map path, and msg set. Arguments: $msg catalog, $msg map path, $msg set, then the same args as message(). Returns: none Globals: none Error: none Example: MessageUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); Comments: none =cut #-------------------------------------------------------------------------------- sub messageFromCat { # Process the arguments shift; # get rid of the class name my $msgcat = shift; my $msgmappath = shift; my $msgset = shift; my $sevcode = shift; if ( $sevcode =~ /V/ && !$::VERBOSE && (!defined($::LOG_FILE_HANDLE) || $sevcode =~ /l/)) { return; } my $msgid = shift; # the rest are the values to be plugged into the msg. They are in @_ # Parse the severity code my $i = 1; my $logonly = 0; my $nolog = 0; my $sev = substr($sevcode, 0, 1); # should be I, W, E, P, O, V, L, or l if ($sev eq 'L' || $sev eq 'l') { if ($sev eq 'L') { $logonly = 1; } else { $nolog = 1; } $i = 2; # logically shift everything by 1 char $sev = substr($sevcode, 1, 1); } if (!($sev =~ /[WEPVO]/)) { $sev = 'I'; } my $code = substr($sevcode, $i); # optional exit code if ($sev =~ /[WE]/) { unshift @_, NodeUtils->programName(); } # only warnings and errors should have the program name prepended my $stdouterrf = \*STDOUT; my $stdouterrd = ''; if ($sev =~ /[WE]/) { $stdouterrf = \*STDERR; $stdouterrd = '1>&2'; } my $msg; # If they pass in a hash reference instead of a msg catalog name, we will # get the msg from the hash ref. if (ref($msgcat) eq 'HASH') { $msg = MessageUtils->getmsg($msgcat, $msgid, @_); } else { $msg = MessageUtils->getMessageFromCat($msgcat, $msgmappath, $msgset, $msgid, @_); } # If there is a problem with getMessageFromCat() it returns the error as the msg # This is used for debugging if ($ENV{'CSM_MESSAGE_DEBUG'}) { $msg = "$msgid: $msg"; } if (!$logonly && !($sev eq 'V' && !$::VERBOSE)) { print $stdouterrf $msg; } if (defined($::LOG_FILE_HANDLE) && !$nolog) { print $::LOG_FILE_HANDLE $msg; } if (length($code)) { if (defined($::LOG_FILE_HANDLE)) { close $::LOG_FILE_HANDLE; undef $::LOG_FILE_HANDLE; } exit $code; } } #-------------------------------------------------------------------------------- =head3 processNewlines Process the new lines in a message. Arguments: message string Returns: message string with processed \n's Globals: none Error: undefined Example: $defaultmsg = MessageUtils->processNewlines($defaultmsg); Comments: none =cut #-------------------------------------------------------------------------------- sub processNewlines { my ($class, $msg) = @_; # For some reason, the presence of $ and @ makes this eval erase the msg, so we # must escape them. #if ($msg =~ /%\d\$s/) { return $msg; } # return it unprocessed $msg =~ s/([\$\@])/\\$1/sg; $msg = 'qq(' . $msg . ')'; # surround with qq() so we can eval it $msg = eval $msg; # this processes the \n correctly return $msg; } #-------------------------------------------------------------------------------- =head3 substituteValues Substitue values in a msg string. Arguments: msg string substitute values Returns: altered msg string Globals: none Error: undefined Example: $defaultmsg = MessageUtils->substituteValues($defaultmsg, @_); Comments: none =cut #-------------------------------------------------------------------------------- sub substituteValues { shift @_; # get rid of the class argument my $msg = shift @_; # the rest of the arguments are values to be substituted # Have to substitute the values in the correct order my $i = 1; foreach my $v (@_) { $msg =~ s/%$i\$s/$v/; $i++; } return $msg; } #-------------------------------------------------------------------------------- =head3 useTranslatedMsg Check the NLS related env vars to determine if we really have to get the msg from a translated catalog, or if we can just use the default msg from the msg map. Arguments: none Returns: 0 - use translated msg. 1 - don't use translated msg.d Globals: none Error: none Example: if (!MessageUtils->useTranslatedMsg()) { blah; } Comments: not clear which is true: 1 or 0. =cut #-------------------------------------------------------------------------------- sub useTranslatedMsg { if (!defined($useTranslatedMsg)) # cache the result { if (!(-x '/usr/bin/dspmsg')) { $useTranslatedMsg = 0; } elsif ($ENV{CSM_USE_DSPMSG}) { $useTranslatedMsg = 1; } elsif (defined($ENV{LC_ALL}) && length($ENV{LC_ALL})) { if ($ENV{LC_ALL} =~ /^(C|POSIX|en_US)$/) { $useTranslatedMsg = 0; } else { $useTranslatedMsg = 1; } } elsif (defined($ENV{LC_MESSAGES}) && length($ENV{LC_MESSAGES})) { if ($ENV{LC_MESSAGES} =~ /^(C|POSIX|en_US)$/) { $useTranslatedMsg = 0; } else { $useTranslatedMsg = 1; } } elsif (defined($ENV{LANG}) && length($ENV{LANG})) { if ($ENV{LANG} =~ /^(C|POSIX|en_US)$/) { $useTranslatedMsg = 0; } #RedHat 8.0 changes else { NodeUtils->distribution(); if ($distro =~ /RedHat\s*8\.0/ && $ENV{LANG} =~ /^en_US.UTF-8$/) { $useTranslatedMsg = 0; } else { $useTranslatedMsg = 1; } } #RedHat 8.0 changes } } # The only part of this decision we shouldn't cache is whether dspmsg is available, # because that can change as we are installing RSCT. if (!(-x '/usr/bin/dspmsg')) { return 0; } else { return $useTranslatedMsg; } } #-------------------------------------------------------------------------------- =head2 Server Logging Routines =cut #-------------------------------------------------------------------------------- =head3 append_logging Append logging messages to a logfile. Return the log file handle so it can be used to close the file when done logging. Arguments: $logFileName $quiet_flag Returns: $::LOG_FILE_HANDLE Globals: $::LOG_FILE_HANDLE Error: $::NOK Example: ServerUtils->append_logging($::INSTALL_LOG); Comments: It is the responsibility of the caller to close the log file; this is best done with stop_logging(). =cut #-------------------------------------------------------------------------------- sub append_logging { my ($class, $logfile, $quiet_flag) = @_; my ($cmd, $rc); if (!$quiet_flag) { $quiet_flag = 0; } # create the log directory if it's not already there if (!-d $::CSMLOG) { $cmd = "$::MKDIR -m 644 -p $::CSMLOG"; $rc = system("$cmd"); if ($rc >> 8) { MessageUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgNO_CreateDir', $::CSMLOG); return ($::NOK); } } # # get log file ready # if (!-e $logfile) { # create the log file if not already there # open the log file unless (open(LOGFILE, ">$logfile")) { # Cannot open file MessageUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgCANT_WRITE_FILE', $logfile); return $::NOK; } } else { # it's there so just append unless (open(LOGFILE, ">>$logfile")) { MessageUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgCANT_WRITE_FILE', $logfile); return $::NOK; } } $::LOG_FILE_HANDLE = \*LOGFILE; # Print the date to the top of the logfile my $sdate = `/bin/date`; chomp $sdate; my $program = NodeUtils->programName(); if ($quiet_flag != 1) { MessageUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgWRITING_LOGFILE', $program, $logfile ); MessageUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "LI", 'IMsgSTART_LOGGING', $sdate); MessageUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "LI", 'IMsgShow_Output', $::command_line ); } return ($::LOG_FILE_HANDLE); } #-------------------------------------------------------------------------------- =head3 backup_logfile Backup the current logfile. Move logfile to logfile.1. Shift all other logfiles (logfile.[1-3]) up one number. The original logfile.4 is removed as in a FIFO. Arguments: $logFileName Returns: $::OK Error: undefined Example: MessageUtils->backup_logfile($logfile); Comments: Never used outside of ServerUtils. =cut #-------------------------------------------------------------------------------- sub backup_logfile { my ($class, $logfile) = @_; my ($logfile1) = $logfile . ".1"; my ($logfile2) = $logfile . ".2"; my ($logfile3) = $logfile . ".3"; my ($logfile4) = $logfile . ".4"; if (-f $logfile) { rename($logfile3, $logfile4) if (-f $logfile3); rename($logfile2, $logfile3) if (-f $logfile2); rename($logfile1, $logfile2) if (-f $logfile1); rename($logfile, $logfile1); } return $::OK; } #-------------------------------------------------------------------------------- =head3 start_logging Start logging messages to a logfile. Return the log file handle so it can be used to close the file when done logging. Arguments: $logFile $quiet_flag Returns: $::LOG_FILE_HANDLE Globals: $::LOG_FILE_HANDLE $::CSMLOG Error: $::NOK Example: ServerUtils->start_logging($::CSMSETUPKS_LOG); Comments: Common method for logging script runtime output. =cut #-------------------------------------------------------------------------------- sub start_logging { my ($class, $logfile, $quiet_flag) = @_; my ($cmd, $rc); if (!$quiet_flag) { $quiet_flag = 0; } MessageUtils->backup_logfile($logfile); # create the log directory if it's not already there if (!-d $::CSMLOG) { $cmd = "$::MKDIR -m 644 -p $::CSMLOG"; $rc = system("$cmd"); if ($rc >> 8) { MessageUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgNO_CreateDir', $::CSMLOG); return ($::NOK); } } # open the log file unless (open(LOGFILE, ">>$logfile")) { # Cannot open file MessageUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgCANT_WRITE_FILE', $logfile ); return $::NOK; } $::LOG_FILE_HANDLE = \*LOGFILE; # Print the date to the top of the logfile my $sdate = `/bin/date`; chomp $sdate; my $program = NodeUtils->programName(); if ($quiet_flag != 1) { MessageUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgWRITING_LOGFILE', $program, $logfile ); MessageUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "LI", 'IMsgSTART_LOGGING', $sdate); MessageUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "LI", 'IMsgShow_Output', $::command_line ); } return ($::LOG_FILE_HANDLE); } #-------------------------------------------------------------------------------- =head3 stop_logging Turn off message logging. Routine expects to have a file handle passed in via the global $::LOG_FILE_HANDLE. Arguments: $quiet_flag Returns: $::OK Globals: $::LOG_FILE_HANDLE Error: none Example: ServerUtils->append_logging($::INSTALL_LOG); Comments: closes the logfile and undefines $::LOG_FILE_HANDLE even on error. =cut #-------------------------------------------------------------------------------- sub stop_logging { my ($class, $quiet_flag) = @_; if (!$quiet_flag) { $quiet_flag = 0; } if (defined($::LOG_FILE_HANDLE)) { # Print the date at the bottom of the logfile if ($quiet_flag != 1) { my $date = `/bin/date`; chomp $date; MessageUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "LI", 'IMsgSTOP_LOGGING', $date); } close($::LOG_FILE_HANDLE); undef $::LOG_FILE_HANDLE; } return $::OK; } #-------------------------------------------------------------------------------- =head2 Node Installation Status Routines =cut #-------------------------------------------------------------------------------- =head3 initialize_status The status directory is used to collect the installation status of nodes that are getting full installs. Each node contains a separate file in the status directory with the name of the node's hostname. Create the /csminstall/csm/status directory and make it world writable so that the node can write to it with the atftp command. Also, create initial files for each node to be installed. Arguments: reference to an array of Node Names Returns: number of errors encounter across node list Globals: $::CSMSTATUSDIR $::CSMSTATUSLINK Error: number of errors encournterd Example: $rc = ServerUtils->initialize_status(\@NODELIST); Comments: none =cut #-------------------------------------------------------------------------------- sub initialize_status { my ($class, $nodes) = @_; my ($mode, $rc); my ($errors) = 0; unlink($::CSMSTATUSDIR); mkpath($::CSMSTATUSDIR, $::VERBOSE, 0110); $mode = "0110"; NodeUtils->runcmd("$::CHMOD $mode $::CSMSTATUSDIR"); if ($::RUNCMD_RC) { MessageUtils->message('W', 'EMsgCANT_CHMOD', $::CSMSTATUSDIR, $mode); $errors++; } #symlink ($::CSMSTATUSDIR, $::CSMSTATUSLINK); foreach my $node (@$nodes) { my $statusfile = "$::CSMSTATUSDIR/$node"; unlink($statusfile); NodeUtils->runcmd("$::TOUCH $statusfile"); if ($::RUNCMD_RC) { MessageUtils->message('W', 'EMsgCANT_CREATE', $statusfile); $errors++; } $mode = "0440"; NodeUtils->runcmd("$::CHMOD $mode $statusfile"); if ($::RUNCMD_RC) { MessageUtils->message('W', 'EMsgCANT_CHMOD', $statusfile, $mode); $errors++; } } return ($errors); } #-------------------------------------------------------------------------------- =head3 write_status Write an entry in the node install status file at /csminstall/csm/status/ Arguments: node - The hostname of the node msg - The message to add to the status file status - (optional) The status of the operation dateReference - an empty array reference to get the time the message was written. Returns: none Globals: none Error: csmInstall.cat E2 Example: ServerUtils->write_status($node, $msg, $rc); Comments: none =cut #-------------------------------------------------------------------------------- sub write_status { my ($class, $node, $msg, $status, $dateReference) = @_; my $statusfile = "$::CSMSTATUSDIR/$node"; open(STATUSFILE, ">>$statusfile") || MessageUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E2', 'EMsgCANT_WRITE_FILE', $statusfile ); my $date = `date`; chomp $date; push(@$dateReference, $date); chomp $msg; if ($status) { print STATUSFILE "$date: $msg: status=$status\n"; } else { print STATUSFILE "$date: $msg\n"; } close(STATUSFILE); } #-------------------------------------------------------------------------------- 1; kw0PB7uHӄAӄAӄA H./opt/csm/pm/NetworkUtils.pm.pm#!/usr/bin/perl # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # # @(#)31 1.38 src/csm/core/pm/NetworkUtils.pm.perl, setup, csm_rveg, rvegs005a 6/25/04 11:36:15 # ##################################################################### package NetworkUtils; use strict; # locale tells perl to honor locale for sorting, dates, etc. # More info about locale.pm and perl handling of locales can be found in # /usr/lib/perl5/5.6.0/locale.pm and the man page for perllocale. use locale; use Socket; use File::Find; my $msgs; my $distro; my $useTranslatedMsg; my %catHashes; my $csmroot; my ($MSGCAT, $MSGMAPPATH, $MSGSET); my $NO_NODERANGES; my $NODEGROUPEXPMEM_WARNING = 1; # $NodeUtils::errno; # Will be set if an error occurs. You must zero # this out before calling a NodeUtils function, # if you want to check it afterwards. BEGIN { # This enables us to redirect where it looks for other CSM files during development $csmroot = $ENV{'CSM_ROOT'} ? $ENV{'CSM_ROOT'} : '/opt/csm'; $MSGCAT = 'nodecmds.cat'; if (defined $::MSGMAPPATH) { $MSGMAPPATH = $ENV{'CSM_ROOT'} ? "$csmroot/msgmaps" : $::MSGMAPPATH; } else { $MSGMAPPATH = "$csmroot/msgmaps"; } $MSGSET = 'NodeUtils'; } umask(0022); # This sets umask for all CSM files so that group and world only # have read permissions. # To change it, simply use the umask call in your script, after # the "use NetworkUtils;" line #-------------------------------------------------------------------------------- =head1 NetworkUtils This program module file, supports the CSM/install networking dependencies; from datalink to session layers. If adding to this file, please take a moment to ensure that: 1. Your contrib has a readable pod header describing the purpose and use of the subroutine. 2. Your contrib is under the correct heading and is in alphabetical order under that heading. 3. You have run tidypod on your this file and copied NetworkUtils.pm.perl.tdy to NetworkUtils.pm.perl before checking in you can examine the pod output in NetworkUtils.pm.perl.html file in a browser. 4. Copy the new ./NetworkUtils.pm.perl.html to /project/csm/www, to update the pod. for the team. =cut #-------------------------------------------------------------------------------- =head2 DHCP Support =cut #-------------------------------------------------------------------------------- =head3 verify_dhcp Check that dhcp is up and running. Arguments: none Returns: 0 - dhcp is running numErrors from attempt to start dhcp Globals: none Error: numErrors from attempt to start dhcp Example: $rc = NetworkUtils->verify_dhcp(); Comments: Right now we don't check the /etc/dhcpd.conf file, since that should have been verified when it was created. This function is just for extremely paranoid peopole. =cut #-------------------------------------------------------------------------------- sub verify_dhcp { my $errors = 0; my @output; my $cmd; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgDhcpCheck'); unless (-f "/var/lib/dhcp/dhcpd.leases") { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgDhcpMissing'); unless (-d "var/lib/dhcp") { NodeUtils->runcmd("$::MKDIR -p /var/lib/dhcp"); } NodeUtils->runcmd("$::TOUCH /var/lib/dhcp/dhcpd.leases"); } # SuSE Change #$cmd = "$::SERVICE dhcpd status"; $cmd = NodeUtils->service("dhcpd", "status"); chomp(@output = `$cmd`); my @line = split(" ", @output); if (grep /running/, @output) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgDhcpOutput', @output); } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgDhcpOutput', @output); NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgDhcpProblemRestart', @output); # SuSE Change #`$::SERVICE dhcpd start`; #$cmd = "$::SERVICE dhcpd status"; $cmd = NodeUtils->service("dhcpd", "start"); `$cmd`; $cmd = NodeUtils->service("dhcpd", "status"); chomp(@output = `$cmd`); if (grep /running/, @output) { #print "dhcp: @output\n" if $::VERBOSE; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgDhcpOutput', @output); } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgDhcpNotWorking'); $errors++; } } return $errors; } #-------------------------------------------------------------------------------- =head2 Ethernet Support =cut #-------------------------------------------------------------------------------- =head3 chkethup Ensure that the eth0 is up and running Arguments: none Returns: none Globals: none Error: messageFromCat E1 Example: NetworkUtils->chkethup(); Comments: none =cut #-------------------------------------------------------------------------------- sub chkethup { my $cmd = "$::NETSTAT -rn | $::GREP eth0"; unless (`$cmd`) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgEth0NotUp'); } return; } #-------------------------------------------------------------------------------- =head2 IP Address Support =cut #-------------------------------------------------------------------------------- =head3 genHex Generates a hex representation of an ip address: for example, 9.114.133.193 --> 097285C1 Takes in a list of hosts and returns a hash where the key is the hostname and the value is the IP in hex form. Arguments: @hostNames Returns: Hash of hostName / IP address (in hex) pairs. Globals: none Error: undefined Example: %hex = NetworkUtils->genHex(@::nodes); Comments: none =cut #-------------------------------------------------------------------------------- sub genHex { shift; my $host; my $uno; my $dos; my $tres; my $cuatro; my $hex; my %hex; foreach $host (@_) { my $ip = NodeUtils->getHost($host); # Get ip address ($uno, $dos, $tres, $cuatro) = split(/\./, $ip); # Split by the . $hex = sprintf("%02X", $uno); # put formatted into hex $hex .= sprintf("%02X", $dos); $hex .= sprintf("%02X", $tres); $hex .= sprintf("%02X", $cuatro); $hex{$host} = $hex; } return %hex; } #-------------------------------------------------------------------------------- =head3 inc_ip Increment an IP address by 1, carrying to the previous octet as required. This code originally appeared in the LUI product (luiapi.pm) Arguments: $IPaddress Returns: IP address as a string Globals: none Error: csmInstall.cat E Example: $node = NetworkUtils->inc_ip($ipaddr); Comments: none =cut #-------------------------------------------------------------------------------- sub inc_ip { my $ip = $_[1]; my ($a, $b, $c, $d); ($a, $b, $c, $d) = split(/\./, $ip); $d++; if ($d > 255) { $d = $d - 256; $c++; if ($c > 255) { $c = $c - 256; $b++; if ($b > 255) { $b = $b - 256; $a++; if ($a > 255) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgIPADDR_ERROR', "$a.$b.$c.$d"); #printf "Error - ip address out of valid range.\n"; return 1; } } } } return $a . "\." . $b . "\." . $c . "\." . $d; } #-------------------------------------------------------------------------------- =head3 isIpaddr returns 1 if parameter is has a valid IP address form. Arguments: dot qulaified IP address: e.g. 1.2.3.4 Returns: 1 - if legal IP address 0 - if not legal IP address. Globals: none Error: none Example: if (NetworkUtils->isIpaddr( $ipAddr )) { blah; } Comments: Doesn't test if the IP address is on the network, just tests its form. =cut #-------------------------------------------------------------------------------- sub isIpaddr { my ($class, $addr) = @_; #print "addr=$addr\n"; if ($addr =~ /^[0-9]{1,3}\.[0-9]{1,3}\.[0-9]{1,3}\.[0-9]{1,3}$/) { return 1; } else { return 0; } } #-------------------------------------------------------------------------------- =head3 subnet Returns the subnet in dot format Arguments: $hostName $netmask Returns: subnet for $hostName Globals: none Error: none Example: never used. Comments: never used??? =cut #-------------------------------------------------------------------------------- sub subnet { my ($class, $host, $netmask) = @_; #$host = `hostname` if (!$host); #$netmask = '255.255.255.0' if (!$netmask); chomp $host; chomp $netmask; #print "INPUT: $host $netmask\n"; my ($hostname, $ipaddr) = NodeUtils->getHost($host); my ($ia, $ib, $ic, $id) = split('\.', $ipaddr); my ($na, $nb, $nc, $nd) = split('\.', $netmask); # Convert to integers so the bitwise and (&) works correctly. int $ia; int $ib; int $ic; int $id; int $na; int $nb; int $nc; int $nd; my $sa = ($ia & $na); my $sb = ($ib & $nb); my $sc = ($ic & $nc); my $sd = ($id & $nd); my $subnet = "$sa.$sb.$sc.$sd"; #print "IPADDR = $ia.$ib.$ic.$id\n"; #print "NETMSK = $na.$nb.$nc.$nd\n"; #print "SUBNET = $subnet\n"; return $subnet; } #-------------------------------------------------------------------------------- =head2 MAC Address Support =cut #-------------------------------------------------------------------------------- =head3 getmacs_via_dsh Gathers MAC addresses for an array of node Names. Arguments: referance to an array of Node Names Returns: Array of unreachable node names Globals: none Error: none Example: unused Comments: unused??? =cut #-------------------------------------------------------------------------------- sub getmacs_via_dsh { my ($class, $ref_nodelist) = @_; my @nodelist = @$ref_nodelist; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgGETTING_MACS_VIA_DSH'); my $dshcmd = '/sbin/ifconfig eth0 | /bin/grep HWaddr | /bin/awk "{print \$5}"'; my $RemoteShell = InstallUtils->getRemoteShell(); my @new_getmacslist; my @unreach_nodes = (); my @reach = (); my $node_file = InstallUtils->make_node_list_file(\@nodelist) ; #put all dest nodes in tmp file my $cmd = "$::REMOTESHELL_EXPECT -d $node_file"; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "V", 'IMsgRUN_CMD', $cmd); my @output = `$cmd 2>&1`; InstallUtils->close_delete_file($::NODE_LIST_FILE, $node_file) ; #delete node file my %out; foreach my $line (@output) { chomp $line; my @parts = split ":", $line; if ($parts[1] =~ m/test.success/) { #this node is reachable $out{$parts[0]} = 1; } } foreach my $n (@nodelist) { if (!$out{$n}) { push @unreach_nodes, $n; } else { #it is reachable push @reach, $n; } } if (@unreach_nodes) { my $node_str = join ', ', @unreach_nodes; NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'W', 'EMsgDSHCannotConnect', $RemoteShell, $node_str ); push @new_getmacslist, @unreach_nodes; } if (@reach) { #we can theoretically reach it with DSH $node_file = InstallUtils->make_node_list_file(\@reach) ; #put all dest nodes in tmp file $ENV{'DSH_LIST'} = $node_file; my $output = NodeUtils->runcmd("$::DSH '$dshcmd'", -1, 1); InstallUtils->close_delete_file($::NODE_LIST_FILE, $node_file) ; #delete node file my %macs; foreach my $line (@$output) { chomp $line; my ($nodename, $macaddr) = split(': ', $line); if ($macaddr =~ /(..:..:..:..:..:..)/) { $macs{$nodename} = $macaddr; } } foreach my $node (@reach) { if ($macs{$node}) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgFOUND_MACADDR', $node, $macs{$node}); NodeUtils->runcmd( "$::CHNODE $node InstallAdapterMacaddr=$macs{$node}"); } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgCANT_DSH_NODE', $node); push(@new_getmacslist, $node); } } } return (@new_getmacslist); } #-------------------------------------------------------------------------------- =head2 NFS Support =cut #-------------------------------------------------------------------------------- =head3 cacheEtcHosts This subroutine caches /etc/hosts to improve performance for large clusters. Arguments: none Returns: none Globals: none Error: none Example: none Comments: This routine is only called if more than 15 nodes are used. =cut #-------------------------------------------------------------------------------- sub cacheEtcHosts { if (defined $NodeUtils::cacheetchosts) { return; } else { $NodeUtils::cacheetchosts = 1; #so we don't do this again } my $cache = 0; if (NodeUtils->isLinux()) { #On linux you can tell if /etc/hosts is used by looking at the /etc/host.conf my $file = "/etc/host.conf"; if (open(CONF, $file)) { while () { my $line = $_; chomp $line; if ($line =~ m/^\s*order\s+hosts/) { $cache = 1; last; } } close(CONF); } else { return; } } elsif (NodeUtils->isAIX()) { #there is an environement variable if (defined $ENV{'NSORDER'} && length($ENV{'NSORDER'})) { if ($ENV{'NSORDER'} =~ m/^local/) { $cache = 1; } else { $cache = 0; } } else { #On AIX -- look at /etc/netsvc.conf my $file = "/etc/netsvc.conf"; if (-e "/etc/irs.conf" && !-e "/etc/netsvc.conf") { $file = "/etc/irs.conf"; } if (open(CONF, $file)) { my $line; while ($line = ) { chomp $line; if ($line !~ m/^\#/ && $line =~ m/^\s*hosts/) { #if it doesn't start with a commnet if ($line =~ m/^\s*hosts\s*=\s*local/) { $cache = 1; } last; } } close(CONF); } } } if ($cache == 0) { return; } my $file = "/etc/hosts"; if (open(HOSTS, $file)) { #print "CACHING ETC HOSTS\n"; my $line; while ($line = ) { chomp $line; my ($before, $after) = split "#", $line; if ($before) { my ($ip, $longhost, $shorthost) = split /\s+/, $before; #print "IP =|$ip|\tlonghost =|$longhost|\tshorthost =|$shorthost|\n"; if (length($longhost) && length($ip)) { $NodeUtils::Hosts{'Hostname'}{$longhost}{'Name'} = $longhost; $NodeUtils::Hosts{'Hostname'}{$longhost}{'IP'} = $ip; $NodeUtils::Hosts{'IP'}{$ip} = $longhost; if (length($shorthost)) { $NodeUtils::Hosts{'Hostname'}{$shorthost}{'Name'} = $longhost; $NodeUtils::Hosts{'Hostname'}{$shorthost}{'IP'} = $ip; } } } } close(HOSTS); } } #-------------------------------------------------------------------------------- =head3 determineMS Get the name of the localhost from an array of node names. Arguments: reference to a list of nodeNames Returns: Name of the local host Globals: $::PLTFRM Error: undefined Example: :$::MS_NODE = InstallUtils->determineMS(\@::NODELIST); Comments: none =cut #-------------------------------------------------------------------------------- sub determineMS { my ($class, $refnodes) = @_; my @nodes = @$refnodes; my ($localnode, $ifconfig, $label, $separator, $address, @ipaddrs, %localhostnames); if ($::PLTFRM eq "AIX") { $ifconfig = "/usr/sbin/ifconfig -a"; # format is: "inet xxx.xxx.xxx.xxx $label = "inet"; $separator = " "; } else { #Linux $ifconfig = "/sbin/ifconfig -a"; # format is: "inet addr:xxx.xxx.xxx.xxx $label = "inet addr"; $separator = ":"; } NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $ifconfig); my @ips = `$ifconfig 2>&1`; my $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $ifconfig, $rc); } foreach (@ips) { if ($_ =~ /$label$separator((\d{1,3}?\.){3}(\d){1,3})\s/o) { #print "found \"$1\" in \"$_\"\n"; push @ipaddrs, $1; } } foreach my $addr (@ipaddrs) { #see what it resolves to $localhostnames{NodeUtils->tryHost($addr)} = 1; } FINDMS: foreach my $name (@nodes) { my $rn = NodeUtils->tryHost($name); if ($localhostnames{$rn}) { #there should only be one ManagedNode that maps to the localhost $localnode = $name; last FINDMS; } } return $localnode; } #-------------------------------------------------------------------------------- =head3 export_csminstall NFS Export the /csminstall directory on the Management Server Arguments: $dir_to_be_exported Returns: $::OK $::NOK Globals: $::PLTFRM %::MS_INSTALL_SERVER %::INSTALL_SERVERS Error: $::NOK Example: if(NetworkUtils->export_csminstall('/csminstall/csm') != 0) { blah; } Comments: none =cut #-------------------------------------------------------------------------------- sub export_csminstall { my ($class, $dir_to_be_exported) = @_; my $cmd; my $rc = 0; #my $PLTFRM = `uname`; chomp $PLTFRM; #using $::PLTFRM instead if ($::MS_INSTALL_SERVER) { #the MS is serving NFS files if (-d $dir_to_be_exported) { if ($::PLTFRM eq "AIX") { #$cmd = "$::EXPORTFS -i -o ro /csminstall"; $cmd = "$::EXPORTFS -i -o ro $dir_to_be_exported"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); $rc = system($cmd) >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } } else { #$cmd = "$::EXPORTFS -o ro,no_root_squash \*:/csminstall"; $cmd = "$::EXPORTFS -o ro,no_root_squash \*:$dir_to_be_exported"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); $rc = system($cmd) >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCommandFailed', $cmd, $rc); } } } else { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'W', 'EMsgNo_Dir_Export', $dir_to_be_exported ); $rc = 1; } } #determine AIX and Linux install servers my %AIX; my %Linux; foreach my $key (keys %::INSTALL_SERVERS) { foreach my $server (keys %{$::INSTALL_SERVERS{$key}}) { my $os = $::INSTALL_SERVERS{$key}{$server}{'OS'}; my $dir = $::INSTALL_SERVERS{$key}{$server}{'dir'}; if ($os eq "AIX") { $AIX{$dir}{$server} = 1; } elsif ($os eq "Linux") { $Linux{$dir}{$server} = 1; } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgINVALID_OSTYPE'); } } } foreach my $dir (keys %AIX) { #there are AIX install servers, this code will be done in rigel my $list = join ",", keys %{$AIX{$dir}}; my $real_dir = $dir_to_be_exported; #check to see if $dir is already exported $cmd = "$::DSH -n $list \"$::EXPORTFS | $::GREP $dir\" 2>&1"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); my @output = `$cmd`; my @unexport; foreach my $line (@output) { chomp $line; my ($hostname, $line) = split ':', $line; if ($line =~ m/$dir/) { push @unexport, $hostname; } } $real_dir =~ s/^\/csminstall/$dir/; if (@unexport) { $cmd = "$::DSH -n $list '$::EXPORTFS -i -u $real_dir'"; NodeUtils->runcmd($cmd, 0); } $cmd = "$::DSH -n $list '$::EXPORTFS -i -o ro $real_dir\'"; NodeUtils->runcmd($cmd, 0); } foreach my $dir (keys %Linux) { my $list = join ",", keys %{$Linux{$dir}}; my $real_dir = $dir_to_be_exported; #check to see if $dir is already exported $cmd = "$::DSH -n $list \"$::EXPORTFS | $::GREP $dir\" 2>&1"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); my @output = `$cmd`; my @unexport; foreach my $line (@output) { chomp $line; my ($hostname, $line) = split ':', $line; if ($line =~ m/$dir/) { push @unexport, $hostname; } } $real_dir =~ s/^\/csminstall/$dir/; if (@unexport) { $cmd = "$::DSH -n $list '$::EXPORTFS -u \*:$real_dir'"; NodeUtils->runcmd($cmd, 0); } $cmd = "$::DSH -n $list \"$::EXPORTFS -o ro,no_root_squash \*:$real_dir\""; NodeUtils->runcmd($cmd, 0); } return ($rc); } #-------------------------------------------------------------------------------- =head3 getHost Return primary hostname and ip address for the given hostname or ip address and die if hostname resolution fails. Arguments: A string: either an Ip Address or a HostName. Returns: ($nodename, $nodeip) as strings Globals: $NodeUtils::errno $NodeUtils::Hosts Error: returns 0; sets NodeUtils::errno. Example: my ($nodename, $nodeip) = NetworkUtils->getHost($node); Comments: none =cut #-------------------------------------------------------------------------------- sub getHost { my ($class, $arg, $live) = @_; #print "arg=$arg\n"; my ($hostname, $ipaddr); if (!$NodeUtils::gethost{$arg}) { #not cached if (NetworkUtils->isIpaddr($arg)) { if (defined $NodeUtils::Hosts{'IP'}{$arg}) { #cached from /etc/hosts $hostname = $NodeUtils::Hosts{'IP'}{$arg}; #print "using cached IP: $arg\n"; } else { $ipaddr = $arg; my $packedaddr = inet_aton($ipaddr); $hostname = gethostbyaddr($packedaddr, AF_INET); if (!length($hostname) && $live) { MessageUtils->messageFromCat($MSGCAT, $MSGMAPPATH, $MSGSET, "E27", 'EMsgBAD_IPADDR', $ipaddr); } if (!length($hostname)) { MessageUtils->messageFromCat($MSGCAT, $MSGMAPPATH, $MSGSET, "E27", 'EMsgBAD_IPADDR', $ipaddr); } #print "hostname=$hostname\n"; } } else # they specified a hostname { if (defined $NodeUtils::Hosts{'Hostname'}{$arg}) { $hostname = $NodeUtils::Hosts{'Hostname'}{$arg}{'Name'}; $ipaddr = $NodeUtils::Hosts{'Hostname'}{$arg}{'IP'}; #print "using cached Hostname: $arg\n"; } else { $hostname = $arg; # this may be a short hostname my ($name, $aliases, $addrtype, $length, @addrs) = gethostbyname($hostname); if (!length($name) && $live) { MessageUtils->messageFromCat($MSGCAT, $MSGMAPPATH, $MSGSET, "E28", 'EMsgBAD_HOSTNAME', $hostname); } if (!length($name)) { MessageUtils->messageFromCat($MSGCAT, $MSGMAPPATH, $MSGSET, "E28", 'EMsgBAD_HOSTNAME', $hostname); } #print "name=$name, # of addrs=$#addrs.\n"; my $packedaddr = $addrs[0]; $ipaddr = inet_ntoa($packedaddr); $hostname = $name; # they may have specified a shorter or non-primary name #print "ipaddr=$ipaddr, hostname=$hostname\n"; } } $NodeUtils::gethost{$arg}{'Name'} = $hostname; #cache this for later $NodeUtils::gethost{$arg}{'IP'} = $ipaddr; #cache this for later } else { #cached $hostname = $NodeUtils::gethost{$arg}{'Name'}; $ipaddr = $NodeUtils::gethost{$arg}{'IP'}; } return ($hostname, $ipaddr); } #-------------------------------------------------------------------------------- =head3 getHost_rveg NOTE: This is a last minute correction for the rveg release, which will be distributed to CSM as a whole during rbac. Description: Returns primary hostname and ip address for a node. Either an IP address or a Hostname will be accepted as the single parameter. Uses a runcmd style error code and message string to return status. Status should be checked before accessing the return values, which will both be undef if the command failed. Arguments: One scalar parameter: either an Ip Address or a HostName. Returns: ($host_name, $ip_addr) - the hostname and ip address for parameter $::GETHOST_RC - $::OK on success - this is zero $::GETHOST_MSG - could contain a warning message on success but currently doesn't. Globals: $::GETHOST_RC @::GETHOST_MSG Error: Sets $::GETHOST_RC to: 27 # - E27 bad ip address 28 # - E28 bad host_name 0 # - $::OK on success Sets @::GETHOST_MSG to one of: 'EMsgBAD_IPADDR' 'EMsgBAD_HOSTNAME' Example: my $node = $something; # either ip addres or hostname my ($host_name, $ip_address) = NetworkUtils->getHost($node); # if you're not concerned with status and just want to know # if things worked out, use something like this: # retun values are undef on error if ( $::GETHOST_RC != $::OK ) { next; } # otherwise the $nodename and $nodeip are good. Comments: none =cut #-------------------------------------------------------------------------------- sub getHost_rveg { my ($class, $arg) = @_; my ($hostname, $ipaddr, $packedaddr); # glob status $::GETHOST_RC = $::OK; # reassigned on error $::GETHOST_MSG = undef; # reassigned on error if ($NodeUtils::gethost{$arg}) { # print "returning cached values \n"; $hostname = $NodeUtils::gethost{$arg}{'Name'}; $ipaddr = $NodeUtils::gethost{$arg}{'IP'}; return ($hostname, $ipaddr); } # do the IP address parameter if (NetworkUtils->isIpaddr($arg)) { $ipaddr = $arg; if (defined $NodeUtils::Hosts{'IP'}{$arg}) { # print "returning cached IP: $ipaddr\n"; $hostname = $NodeUtils::Hosts{'IP'}{$ipaddr}; return ($hostname, $ipaddr); } # IP not cached $packedaddr = inet_aton($ipaddr); $hostname = gethostbyaddr($packedaddr, AF_INET); if (!$hostname) # return on error { $::GETHOST_RC = 27; $::GETHOST_MSG = 'EMsgBAD_IPADDR'; return (undef, undef); } # cache the values $NodeUtils::gethost{$arg}{'Name'} = $hostname; $NodeUtils::gethost{$arg}{'IP'} = $ipaddr; return ($hostname, $ipaddr); } # do the hostname parameter $hostname = $arg; if (defined $NodeUtils::Hosts{'Hostname'}{$hostname}) { # print "using cached Hostname: $hostname\n"; return ($hostname, $ipaddr); } # high overhead call... my ($name, $aliases, $addrtype, $length, @addrs) = gethostbyname($hostname); if (!$name) # return on error { $::GETHOST_RC = 28; $::GETHOST_MSG = 'EMsgBAD_HOSTNAME'; return (undef, undef); } # print "found name=$name, and addrs=$#addrs.\n"; $packedaddr = $addrs[0]; $ipaddr = inet_ntoa($packedaddr); $hostname = $name; # may be a short name # cache the values $NodeUtils::gethost{$hostname}{'Name'} = $hostname; $NodeUtils::gethost{$hostname}{'IP'} = $ipaddr; return ($hostname, $ipaddr); } #-------------------------------------------------------------------------------- =head3 get_management_server Get the hostname of the management server. Arguments: $node_hostname Returns: ($hostname, $ipaddr) or $hostname, depending on the value of wantarray (?) Globals: $::GETSOURCEIP2TARGET Error: undefined Example: ($ms_hostname, $ipaddr) = NetworkUtils->get_management_server_by_hostname; Comments: Since the nodes might need to contact the management server through a different address than its primary hostname, we cannot just use the output of the hostname command here. Use the getSourceIP2Target command instead. If we cannot determine the route to the node via getSourceIP2Target just return nothing. This indicates that there is no way to get to the node. Note: caller is reponsible for verifying return values. =cut #-------------------------------------------------------------------------------- sub get_management_server { my ($class, $node_hostname) = @_; my $ipaddr = ""; my $hostname = ""; # Move this to InstallDefs.pm.perl $::GETSOURCEIP2TARGET = "/opt/csm/csmbin/getSourceIP2Target"; my $cmd = "$::GETSOURCEIP2TARGET $node_hostname"; my @output = NodeUtils->runcmd($cmd, 0); my $rc = $::RUNCMD_RC; if (!$rc) # If no errors { $ipaddr = $output[0]; if ($ipaddr) { $hostname = NodeUtils->tryHost($ipaddr); } } if (wantarray) { return ($hostname, $ipaddr); } else { return $hostname; } } #-------------------------------------------------------------------------------- =head3 getRSCThostname This routine is used to always return the same hostname regardless of hostname resolution settings. It returns the RSCT node id of the current machine. Since the RSCT node id is unchangable by the user, the only way this could change is if RSCT is uninstalled, and reinstalled. Arguments: none Returns: $ref from lsrsrc-api call. Globals: none Error: none Example: none Comments: none =cut #-------------------------------------------------------------------------------- sub getRSCThostname { #my $outref = NodeUtils->runcmd('CT_MANAGEMENT_SCOPE=1 /usr/bin/lsrsrc-api -s IBM.Host::::NodeNameList'); #$outref =~ s/{|}//g; #now using the RSCT node id because the NodeNameList changes when the output of hostname changes my $outref = NodeUtils->runcmd("/usr/sbin/rsct/bin/lsnodeid"); return $outref; } #-------------------------------------------------------------------------------- =head3 groupNFSnodes I wonder ... Arguments: \%DestNodeHash - InstallServer must be an attr of each node in hash. Fanout value \@nodeArray - If caller is the only dsh to a select group Returns: I wonder... Globals: none Error: none Example: my $fan = NetworkUtils->groupNFSnodes( \%nodeHash, $csmFanout ); Comments: none =cut #-------------------------------------------------------------------------------- sub groupNFSnodes { my ($class, $DestNodeHash, $fanout, $nodes) = @_; #put nodes into hashes based on install server my %is; my @norm; my @slist; if ($nodes) { foreach my $node (@$nodes) { my $server = $$DestNodeHash{$node}{'InstallServer'}; if ($server) { #there is an install server for this node #$is{$server}{$node}=1; if (!exists $is{$server}) { #haven't scene this one before push @slist, $server; } push @{$is{$server}}, $node; } else { #just uses the ms as an install server #$norm{$node}=1; push @norm, $node; #print "pushed node $node onto norm\n"; } } } else { #using the entire hash of nodes foreach my $node (keys %$DestNodeHash) { my $server = $$DestNodeHash{$node}{'InstallServer'}; if ($server) { #there is an install server for this node #$is{$server}{$node}=1; if (!exists $is{$server}) { #haven't scene this one before push @slist, $server; } push @{$is{$server}}, $node; } else { #just uses the ms as an install server #$norm{$node}=1; push @norm, $node; #print "pushed node $node onto norm\n"; } } } my %dsh; my $num_servers = (scalar @slist) + 1; my $num_nodes; if ($nodes) { $num_nodes = scalar @$nodes; } else { $num_nodes = scalar keys %$DestNodeHash; } #print "the number of install servers is $num_servers -1\nthe number of nodes is $num_nodes\nthe fanout is $fanout\n"; my $count = 0; my $group = 0; my $fancount = 0; GROUPNODES: while ($num_nodes) { #print "in GROUPNODES list: count=$count\tgroup=$group\tnum_nodes=$num_nodes\n"; if ($fancount == $fanout) { #we are done with one list $fancount = 0; $group++; } if ($count > $num_servers) { $count = 0; } if ($count == $num_servers) { $count = 0; } if ($count == 0) { #grab one from the normal list if any are left if (@norm) { #print "pushing onto group $group\n"; push @{$dsh{$group}}, shift @norm; $num_nodes--; $fancount++; $count++; next GROUPNODES; } } while (!@{$is{$slist[$count - 1]}}) { #none in this array #print "server $slist[$count] is not defined\n"; #print "incrementing count $count\n"; $count++; if ($count == $num_servers || !($slist[$count - 1])) { next GROUPNODES; } } push @{$dsh{$group}}, shift @{$is{$slist[$count - 1]}}; $fancount++; $num_nodes--; $count++; } my %fan = (); foreach my $g (keys %dsh) { @{$fan{$g}{'ALL'}} = @{$dsh{$g}}; foreach my $node (@{$dsh{$g}}) { my $server = $$DestNodeHash{$node}{'InstallServer'}; my ($s_hostname, $dir) = split(/:/, $server); if (!$server) { $server = $$DestNodeHash{$node}{'ManagementServer'}; } else { #server exists if ($server !~ m/:/) { #doesn't have a directory $server .= ":$::SERVER_DIRECTORY"; } if ($$DestNodeHash{$node}{'ManagementServer'} eq $$DestNodeHash{$node}{'Hostname'}) { #this node is also the MS $server = $$DestNodeHash{$node}{'ManagementServer'}; } elsif ($s_hostname eq $$DestNodeHash{$node}{'ManagementServer'}) { $server = $$DestNodeHash{$node}{'ManagementServer'}; } } push @{$fan{$g}{'Server'}{$server}}, $node; } my @s = keys %{$fan{$g}{'Server'}}; #print "group $g has nodes @{$dsh{$g}}\tand servers @s \n"; } return (\%fan); } #-------------------------------------------------------------------------------- =head3 nfsprobe Probe NFS status like the "nfs probe" command on redhat Arguments: none Returns: NFS service command (e.g. start, restart or reload). Globals: none Error: retCode from NodeUils->service("nfs","probe"); Example: $serviceCmd = NetworkUtils->nfsprobe(); Comments: none =cut #-------------------------------------------------------------------------------- sub nfsprobe { my $CHECKPROC = "/sbin/checkproc"; my $PIDOF = "/sbin/pidof"; my $NFSD = "nfsd"; my $MOUNTD = "/usr/sbin/rpc.mountd"; my $EXPORTS = "/etc/exports"; my $ETAB = "/var/lib/nfs/etab"; my ($nfsd_status, $mountd_status); my $cmd = NodeUtils->service("nfs", "probe"); #my $output=NodeUtils->runcmd($cmd,0); my $output = `$cmd 2>&1`; if (!$?) { return $output; } NodeUtils->runcmd("$CHECKPROC -n $NFSD", -1); $nfsd_status = $::RUNCMD_RC; NodeUtils->runcmd("$CHECKPROC $MOUNTD", -1); $mountd_status = $::RUNCMD_RC; #either nfsd and mountd are not start if ($nfsd_status || $mountd_status) { return "start"; } NodeUtils->runcmd("$PIDOF $NFSD", -1); $nfsd_status = $::RUNCMD_RC; NodeUtils->runcmd("$PIDOF $MOUNTD", -1); $mountd_status = $::RUNCMD_RC; if ($nfsd_status == 1 || $mountd_status == 1) { return "restart"; } my $exports_mtime = (stat($EXPORTS))[9]; my $etab_mtime = (stat($ETAB))[9]; if ($exports_mtime > $etab_mtime) { return "reload"; } return "status"; } #-------------------------------------------------------------------------------- =head3 service Send a service request to an init script. Arguments: $service - a service name such as 'inetd','xinetd' $svcarg - arguments for the service such as 'start', 'stop' or 'status'. Returns: A full cli for the service script. Globals: none Error: none Example: none Comments: none =cut #-------------------------------------------------------------------------------- sub service { my ($class, $service, $svcarg) = @_; my $cmd; my $SVCCLI = "/sbin/service"; my $SVCDIR = "/etc/init.d"; my $distro = NodeUtils->distribution(); # On SuSE, nfs server script is "nfsserver". if ($distro =~ /(SuSE)|(SLES)/ && $service eq "nfs") { $service = "nfsserver"; } if (-f $SVCCLI) { $cmd = "$SVCCLI $service $svcarg "; } else { $cmd = "$SVCDIR/$service $svcarg"; } return $cmd; } #-------------------------------------------------------------------------------- =head3 start_nfs Starts NFS services on the managment server Arguments: none Returns: $::OK $::NOK Globals: $::PLTFRM $::SERVICE %::INSTALL_SERVERS Error: $::NOK Example: if (NetworkUtils->start_nfs != 0) { blah; }_ Comments: none =cut #-------------------------------------------------------------------------------- sub start_nfs { my ($cmd, $output); my $rc = 0; my $exports = "/etc/exports"; #my $PLTFRM = `uname`; chomp $PLTFRM; #using $::PLTFRM instead if ($::MS_INSTALL_SERVER) { #the MS is serving NFS files # Ensure nfs is running. if (!-s $exports) { # nfs will only start if /etc/exports has a size > 0 open(EXPORTS, ">$exports") || NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_READ_FILE', $exports); print EXPORTS "\n"; close(EXPORTS); } # Start nfs if needed. if ($::PLTFRM eq "AIX") { my $rpc_mountd_up = 0; my $nfsd_up = 0; my @output = NodeUtils->runcmd("LANG=C /usr/bin/lssrc -s rpc.mountd", -1); if(!$::RUNCMD_RC) { my ($subsys, $group, $pid, $status) = split(' ', $output[1]); if (defined($status) && $status eq 'active') { $rpc_mountd_up = 1; } } my @output = NodeUtils->runcmd("LANG=C /usr/bin/lssrc -s nfsd", -1); if(!$::RUNCMD_RC) { my ($subsys, $group, $pid, $status) = split(' ', $output[1]); if (defined($status) && $status eq 'active') { $nfsd_up = 1; } } # Only call mknfs if rpc.mountd or nfsd are not active if ($rpc_mountd_up == 0 || $nfsd_up == 0) { my $cmd = "$::MKNFS -N >/dev/null 2>&1"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); my $rc = system($cmd) >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } } } else { # We need modify start_nfs in rc.config on SuSE my $distro = NodeUtils->distribution(); if ($distro =~ /SuSE/ || $distro =~ /SLES/) { my $RCCONFIG = "/etc/rc.config"; my $s = NodeUtils->readFile($RCCONFIG); $s =~ s/^\s*NFS_SERVER\s*=\s*"\s*[Nn][Oo]\s*"\s*$/NFS_SERVER="yes"/m; if (open(OUT, ">$RCCONFIG")) { print OUT ($s); close(OUT); } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgShow_Output', 'Can not open $RCCONFIG for write'); } } # The output of the 'service nfs probe' tells # what needs to be done to start nfs. It returns either # 'start', 'restart', 'reload' or nothing. # SuSE Change #$output = `$::SERVICE nfs probe 2>&1`; $output = InstallUtils->nfsprobe(); if ($output) { # SuSE Change #$cmd = "$::SERVICE nfs $output"; $cmd = NodeUtils->service("nfs", $output); NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); $rc = system($cmd) >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCommandFailed', $cmd, $rc); } else { #wait for nfsserver to start on SLES7 sleep(1); } } } } if (defined %::INSTALL_SERVERS) { #There are install servers serving files #get info about install servers my @make_ex = (); my @AIX_servers = (); my @RedHat_servers = (); my @SUSE_servers = (); #my @Linux_servers = (); my %service; if (defined %{$::INSTALL_SERVERS{'isnode'}}) { #if some of the install servers are nodes then this is a lot easier my @servers = keys %{$::INSTALL_SERVERS{'isnode'}}; foreach my $s (@servers) { my $os = $::INSTALL_SERVERS{'isnode'}{$s}{'OS'}; my $distro = $::INSTALL_SERVERS{'isnode'}{$s}{'DISTRO'}; if ($os eq "AIX") { push @AIX_servers, $s; } elsif ($os eq "Linux") { if ($distro =~ m/RedHat/) { push @RedHat_servers, $s; } elsif ($distro =~ m/SuSE/ || $distro =~ m/SLES/) { #suse? push @SUSE_servers, $s; } # push @Linux_servers, $s; } } if (@RedHat_servers) { my $list = join ',', @RedHat_servers; my $cmd = "LANG=C $::DSH -n $list \"$::LS -s $exports; /sbin/service nfs probe;\""; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); my @output = `$cmd`; foreach my $line (@output) { chomp $line; my ($server, $data) = split ":", $line, 2; if ($line =~ m/$exports/) { #this is the ls line if ( $line !~ m/"does not exist"/ || $line !~ m/"not found"/) { #then /etc/exports exists $data =~ s/^\s+//; #remove any leading whitespace my ($size, $file) = split /\s+/, $data, 2; if ($size == 0) { push @make_ex, $server; } } else { #/ext/exports does not exist push @make_ex, $server; } } elsif ( ($data =~ m/start/) || ($data =~ m/restart/) || ($data =~ m/reload/)) { $data =~ s/^\s+//; #remove any leading whitespace push @{$service{$data}}, $server; } } } if (@AIX_servers || @SUSE_servers) { my $list = join ',', @SUSE_servers, @AIX_servers; #make sure /exports is larger than 0 my $cmd = "LANG=C $::DSH -n $list \"$::LS -s $exports;\" 2>&1"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); my @output = `$cmd`; foreach my $line (@output) { chomp $line; my ($server, $data) = split ":", $line, 2; if ($line =~ m/$exports/) { #this is the ls line if ( $line !~ m/"does not exist"/ || $line !~ m/"not found"/) { #then /etc/exports exists $data =~ s/^\s+//; #remove any leading whitespace my ($size, $file) = split /\s+/, $data, 2; if ($size == 0) { push @make_ex, $server; } } else { #no file push @make_ex, $server; } } } } } if (defined %{$::INSTALL_SERVERS{'notnode'}}) { #size of /etc/exports #OS my $dsh_list = join ",", (keys %{$::INSTALL_SERVERS{'notnode'}}); my $cmd = "LANG=C $::DSH -n $dsh_list \"$::LS -s $exports; /bin/uname; /bin/cat /etc/*release; /sbin/service nfs probe;\" 2>&1"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); my @output = `$cmd`; foreach my $line (@output) { chomp $line; my ($server, $data) = split ":", $line, 2; if ($line =~ m/$exports/) { #this is the ls line if ($line !~ m/"does not exist"/ || $line !~ m/"not found"/) { #then /etc/exports exists $data =~ s/^\s+//; #remove any leading whitespace my ($size, $file) = split /\s+/, $data, 2; if ($size == 0) { push @make_ex, $server; } } else { push @make_ex, $server; } } elsif ($data =~ m/AIX/) { $::INSTALL_SERVERS{'notnode'}{$server}{'OS'} = "AIX"; push @AIX_servers, $server; } elsif ($data =~ m/Red Hat/) { $::INSTALL_SERVERS{'notnode'}{$server}{'OS'} = "Linux"; $::INSTALL_SERVERS{'notnode'}{$server}{'DISTRO'} = "RedHat"; push @RedHat_servers, $server; } elsif ($data =~ m/SuSE/) { $::INSTALL_SERVERS{'notnode'}{$server}{'OS'} = "Linux"; $::INSTALL_SERVERS{'notnode'}{$server}{'DISTRO'} = "SUSE"; push @SUSE_servers, $server; } elsif ( ($data =~ m/start/) || ($data =~ m/restart/) || ($data =~ m/reload/)) { $data =~ s/^\s+//; #remove any leading whitespace push @{$service{$data}}, $server; } } } #first make sure /etc/exports has a size > 0 on all of the install servers if (@make_ex) { my $ex_list = join ",", @make_ex; $cmd = "$::DSH -n $ex_list \"/bin/echo ' ' >> $exports\" 2>&1"; NodeUtils->runcmd($cmd, 0); } if (@RedHat_servers) { #/sbin/service #output of service nfs probe #then start NFS #special steps required in SuSE / SLES case -- these will be implemented in rigel foreach my $value (keys %service) { my $list = join ",", @{$service{$value}}; $cmd = "$::DSH -n $list \"/sbin/service nfs $value &\" 2>&1"; NodeUtils->runcmd($cmd, 0); } } if (@SUSE_servers) { my $list = join ',', @SUSE_servers; #going to need to run sed command to edit /etc/rc.config on SUSE server my $RCCONFIG = "/etc/rc.config"; my $CHECKPROC = "/sbin/checkproc"; my $PIDOF = "/sbin/pidof"; my $NFSD = "nfsd"; my $MOUNTD = "/usr/sbin/rpc.mountd"; my $EXPORTS = "/etc/exports"; my $ETAB = "/var/lib/nfs/etab"; #$cmd = qq($::DSH -n $list '/bin/sed -e s/.*NFS_SERVER.*/NFS_SERVER=\\"yes\\"/ $RCCONFIG | cat '-' > /tmp/csm.rcconfig; /bin/mv /tmp/csm.rcconfig $RCCONFIG; $CHECKPROC -n $NFSD; echo \"nfsd proc rc=\$?\"; $CHECKPROC $MOUNTD; /bin/echo \"mountd proc rc=\$?\"; $PIDOF $NFSD; echo \"pidof nfsd rc=\$?\"; $PIDOF $MOUNTD; echo \"pidof mountd rc=\$?\"; /usr/bin/stat -c %n=%Y $EXPORTS; /usr/bin/stat -c %n=%Y $ETAB;'); $cmd = qq($::DSH -n $list '/bin/sed -e s/.*NFS_SERVER.*/NFS_SERVER=\\"yes\\"/ $RCCONFIG | cat '-' > /tmp/csm.rcconfig; /bin/mv /tmp/csm.rcconfig $RCCONFIG; $CHECKPROC -n $NFSD; echo \"nfsd proc rc=\$?\"; $CHECKPROC $MOUNTD; /bin/echo \"mountd proc rc=\$?\"; $PIDOF $NFSD; echo \"pidof nfsd rc=\$?\"; $PIDOF $MOUNTD; echo \"pidof mountd rc=\$?\";'); NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); my @output = `$cmd`; my %service_hash; my %suse_service = (); foreach my $line (@output) { # print "LINE = $line"; chomp $line; my $hostname; ($hostname, $line) = split ':', $line, 2; # print "HOSTNAME = $hostname\n"; my $rc = (split '=', $line)[1]; if ($line =~ m/nfsd proc/) { $service_hash{$hostname}{'NFSD'}{'PROC'} = $rc; # print "NFSD PROC = $rc\n"; } elsif ($line =~ m/mountd proc/) { $service_hash{$hostname}{'MOUNTD'}{'PROC'} = $rc; # print "MOUNTD PROC = $rc\n"; } elsif ($line =~ m/pidof nfsd/) { $service_hash{$hostname}{'NFSD'}{'PIDOF'} = $rc; # print "NFSD PIDOF = $rc\n"; } elsif ($line =~ m/pidof mountd/) { $service_hash{$hostname}{'MOUNTD'}{'PIDOF'} = $rc; # print "MOUNTD PIDOF = $rc\n"; } elsif ($line =~ m/$EXPORTS/) { $service_hash{$hostname}{'EXPORTS'} = $rc; } elsif ($line =~ m/$ETAB/) { $service_hash{$hostname}{'ETAB'} = $rc; } } foreach my $hostname (keys %service_hash) { my $value; if ( $service_hash{$hostname}{'NFSD'}{'PROC'} || $service_hash{$hostname}{'MOUNTD'}{'PROC'}) { $value = "start"; } elsif ( $service_hash{$hostname}{'NFSD'}{'PIDOF'} == 1 || $service_hash{$hostname}{'MOUNTD'}{'PIDOF'} == 1) { $value = "restart"; } elsif ($service_hash{$hostname}{'EXPORTS'} > $service_hash{$hostname}{'ETAB'}) { $value = "reload"; } else { $value = "status"; } # print "VALUE=$value\n\n"; push @{$suse_service{$value}}, $hostname; } foreach my $value (keys %suse_service) { my $list = join ',', @{$suse_service{$value}}; my $cmd = "$::DSH -n $list \"PATH=\$PATH:/sbin ; /etc/init.d/nfsserver $value;\""; NodeUtils->runcmd($cmd, 0); } } if (@AIX_servers) { my $list = join ',', @AIX_servers; $cmd = "$::DSH -n $list \"$::MKNFS -B >/dev/null\" 2>&1"; NodeUtils->runcmd($cmd, 0); } } return ($rc); } #-------------------------------------------------------------------------------- =head3 tryHost Try to return the primary hostname for the given hostname or ip address. If resolution fails, return the argument passed in. Arguments: hostname and/or ip address as a string Returns: primary hostname as a string or given argument if the hostname can's be resolved Globals: $NodeUtils::Hosts Error: undefined Example: my $hostname = NetworkUtils->tryHost($node, \$resolved); Comments: none =cut #-------------------------------------------------------------------------------- sub tryHost { my ($class, $arg, $resolvedref) = @_; if (!defined $NodeUtils::tryhost{$arg}) { my $host; $resolvedref && ($$resolvedref = 0); my $res = 0; #for caching purposes if (NetworkUtils->isIpaddr($arg)) { if (defined $NodeUtils::Hosts{'IP'}{$arg}) { #cached from /etc/hosts #print "using cached IP: $arg\n"; $host = $NodeUtils::Hosts{'IP'}{$arg}; $resolvedref && ($$resolvedref = 1); $res = 1; } else { my $packedaddr = inet_aton($arg); $host = gethostbyaddr($packedaddr, AF_INET); if (!length($host)) { $host = $arg; } else { $resolvedref && ($$resolvedref = 1); $res = 1; } } } else # they specified a hostname, but it may be a short name { if (defined $NodeUtils::Hosts{'Hostname'}{$arg}) { #cached from /etc/hosts #print "using cached hostname: $arg\n"; $host = $NodeUtils::Hosts{'Hostname'}{$arg}{'Name'}; $resolvedref && ($$resolvedref = 1); $res = 1; } else { my ($hostname, $aliases, $addrtype, $length, @addrs) = gethostbyname($arg); if (length($hostname)) { $host = $hostname; $resolvedref && ($$resolvedref = 1); $res = 1; } else { $host = $arg; } } } $NodeUtils::tryhost{$arg}{'Name'} = $host; #cache this for later if ($resolvedref) { $NodeUtils::tryhost{$arg}{'resolved'} = $$resolvedref; } else { $NodeUtils::tryhost{$arg}{'resolved'} = $res; } return $host; } else { $resolvedref && ($$resolvedref = $NodeUtils::tryhost{$arg}{'resolved'}); return $NodeUtils::tryhost{$arg}{'Name'}; #use cached version } } #-------------------------------------------------------------------------------- =head3 unexport_csminstall NFS unexport the /csminstall directory on the Management Server Arguments: $dir_to_be_exported Returns: 0 - All was successful. 1 - An error occured. Globals: $::PLTFRM %::MS_INSTALL_SERVER %::INSTALL_SERVERS Error: returns 1 Example: if(NetworkUtils->unexport_csminstall('/csminstall/csm') != 0) { blah; } Comments: none =cut #-------------------------------------------------------------------------------- sub unexport_csminstall { my ($class, $dir_to_be_unexported) = @_; my $cmd; my $rc = 0; #my $PLTFRM = `uname`; chomp $PLTFRM; #using $::PLTFRM instead if ($::MS_INSTALL_SERVER) { #the MS is serving NFS files if ($::PLTFRM eq "AIX") { #$cmd = "$::EXPORTFS -i -u /csminstall"; $cmd = "$::EXPORTFS -i -u $dir_to_be_unexported"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); $rc = system($cmd) >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } } else { #$cmd = "$::EXPORTFS -u \*:/csminstall"; $cmd = "$::EXPORTFS -u \*:$dir_to_be_unexported"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); $rc = system($cmd) >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCommandFailed', $cmd, $rc); } } } #determine AIX and Linux install servers my %AIX; my %Linux; foreach my $key (keys %::INSTALL_SERVERS) { foreach my $server (keys %{$::INSTALL_SERVERS{$key}}) { my $os = $::INSTALL_SERVERS{$key}{$server}{'OS'}; my $dir = $::INSTALL_SERVERS{$key}{$server}{'dir'}; if ($os eq "AIX") { $AIX{$dir}{$server} = 1; } elsif ($os eq "Linux") { $Linux{$dir}{$server} = 1; } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgINVALID_OSTYPE'); } } } foreach my $dir (keys %AIX) { #there are AIX install servers, this code will be done in rigel my $list = join ",", keys %{$AIX{$dir}}; my $real_dir = $dir_to_be_unexported; $real_dir =~ s/^\/csminstall/$dir/; $cmd = "$::DSH -n $list '$::EXPORTFS -i -u $real_dir'"; NodeUtils->runcmd($cmd, 0); } foreach my $dir (keys %Linux) { my $list = join ",", keys %{$Linux{$dir}}; my $real_dir = $dir_to_be_unexported; $real_dir =~ s/^\/csminstall/$dir/; $cmd = "$::DSH -n $list '$::EXPORTFS -u \*:$real_dir'"; NodeUtils->runcmd($cmd, 0); } return ($rc); } #-------------------------------------------------------------------------------- =head2 Remote Shells - RSH, SSH =cut #-------------------------------------------------------------------------------- =head3 checkHOMEforSSHperm Checks attributes of root home directory. Arguments: none Returns: 1 - if $HOME has the wrong permissions 0 - if permissions are correct. Globals: none Error: 1 - wrong permissions on root's $HOME Example: $rc = NetworkUtils->checkHOMEforSSHperm(); Comments: If the permessions on $HOME are incorrect, then SSH should not be setup. =cut #-------------------------------------------------------------------------------- sub checkHOMEforSSHperm { my $home = InstallUtils->getRootHomeDir(); my $mode = (stat($home))[2]; my $real_mode = sprintf "%04o", $mode & 07777; my @perm = split '', $real_mode; if ( ($perm[2] == 2) || ($perm[2] == 6) || ($perm[2] == 7) || ($perm[3] == 2) || ($perm[3] == 6) || ($perm[3] == 7)) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgWrongHomePermissions', $home); return 1; } else { return 0; } } #-------------------------------------------------------------------------------- =head3 checkRSReachability Checks a list of machines (they do not need to be CSM nodes) to make sure they can be reached via dsh. Arguments: reference to an array of hostnames Returns: reference to an array of unreachable nodes Globals: $::REMOTE_SHELL Error: none Example: my $unreachable = NetworkUtils->checkRSReachability(\@install_servers); Comments: none =cut #-------------------------------------------------------------------------------- sub checkRSReachability { my ($class, $machines) = @_; $::REMOTE_SHELL = InstallUtils->getRemoteShell(); my $file = InstallUtils->make_node_list_file($machines) ; #put all dest nodes in tmp file my $cmd; (my $cmd_basename = $::REMOTE_SHELL) =~ s:^.*/::; if ($cmd_basename ne "rsh" && (InstallUtils->supportedSSHversion())) { #can do SSH with options $cmd = "$::REMOTESHELL_EXPECT -ds $file"; } else { $cmd = "$::REMOTESHELL_EXPECT -d $file"; } my $value = InstallUtils->supportedSSHversion(); NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); my @output = `$cmd 2>&1`; InstallUtils->close_delete_file($::NODE_LIST_FILE, $file); #delete node file my %reachable; my @unreachable; foreach my $line (@output) { chomp $line; my @parts = split ":", $line; if ($parts[1] =~ m/test.success/) { #this node is reachable $reachable{$parts[0]} = 1; } } foreach my $n (@$machines) { if (!$reachable{$n}) { push @unreachable, $n; } } if (@unreachable) { return (\@unreachable); } } #-------------------------------------------------------------------------------- =head3 cpSSHFiles Returns the locations of authorized keys in /csminstall. Arguments: none Returns: ($authorizedKeys1, $authorizedKeys2) Globals: none Error: returns 1 or exits on message E value Example: $rc = NetworkUtils->cpSSHFiles(); Comments: none =cut #-------------------------------------------------------------------------------- sub cpSSHFiles { my ($cmd, $rc); NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgCopySSHKeys'); my $SSHdir = "/csminstall/csm/config/.ssh"; if (!(-d "/csminstall/csm/config")) { $cmd = "$::MKDIR /csminstall/csm/config"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->message('E', 'EMsgNO_CreateDir', "/csminstall/csm/config"); } } if (!(-d "$SSHdir")) { $cmd = "$::MKDIR $SSHdir"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgNO_CreateDir', $SSHdir); } } my $home = InstallUtils->getRootHomeDir(); my $authorized_keys = "$SSHdir/authorized_keys"; my $authorized_keys2 = "$SSHdir/authorized_keys2"; if ( !(-e "$home/.ssh/identity.pub") || !(-e "$home/.ssh/id_rsa.pub") || !(-e "$home/.ssh/id_dsa.pub")) { return 1; } $cmd = "$::COPY $home/.ssh/identity.pub $authorized_keys"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } $cmd = "$::COPY $home/.ssh/id_rsa.pub $authorized_keys2"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } $cmd = "$::CAT $home/.ssh/id_dsa.pub >> $authorized_keys2"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } if (!defined $::HAMODE) { my $outref = NodeUtils->runrmccmd('lsrsrc-api', "-i", "-s IBM.DmsCtrl::::HAMode"); $::HAMODE = $$outref[0]; } if ($::HAMODE == 1) { #on an active HAMS management server #get management server attribute for node on other ms require HAMS; my ($pvals, $bvals) = HAMS->getAttributes("/var/opt/hams/hamsdef"); my $activems = HAMS->determineActive($pvals, $bvals); if ($activems ne "1") { my $primary = $$pvals{'hostname'}; my $backup = $$bvals{'hostname'}; my $inactivems; if ($activems eq $primary) { $inactivems = $backup; } else { $inactivems = $primary; } #my $inactivems = HAMS->getManagementServerAttr($activems); if ($inactivems ne "") { NodeUtils->runcmd( "/opt/csm/bin/dsh -n $inactivems /opt/csm/csmbin/remoteshell.expect -k" ); #my $auth_key = "$SSHdir/inactivems_auth"; #my $auth_key2 = "$SSHdir/inactivems_auth2"; NodeUtils->runcmd( "/usr/bin/scp $inactivems:.ssh/\*.pub $SSHdir/."); NodeUtils->runcmd( "$::CAT $SSHdir/identity.pub >> $authorized_keys"); NodeUtils->runcmd( "$::CAT $SSHdir/id_rsa.pub >> $authorized_keys2"); NodeUtils->runcmd( "$::CAT $SSHdir/id_dsa.pub >> $authorized_keys2"); NodeUtils->runcmd("$::RM -f $SSHdir/\*.pub"); } } } if (!(-e "$authorized_keys") || !(-e "$authorized_keys2")) { return 1; } return ($authorized_keys, $authorized_keys2); } #-------------------------------------------------------------------------------- =head3 getRemoteShell Get the path of the remote shell if avialble. Arguments: none Returns: path of the remote shell Globals: none Error: 1 - couldn't connect to remote shell Example: $::REMOTE_SHELL = NetworkUtils->getRemoteShell(); Comments: none =cut #-------------------------------------------------------------------------------- sub getRemoteShell { # set local scope because we only want classes on the mgmt svr $ENV{'CT_MANAGEMENT_SCOPE'} = 1; # todo: remove when lsrsrc-api converts to above $ENV{'CT_SESSION_SCOPE'} = 1; if (NodeUtils->isMgmtSvr()) { #only defined on managment server if (!$ENV{'DSH_REMOTE_CMD'}) { my $outref = NodeUtils->runrmccmd('lsrsrc-api', "-i", "-s IBM.DmsCtrl::::RemoteShell"); return $$outref[0]; } else { return $ENV{'DSH_REMOTE_CMD'}; } } return 1; } #-------------------------------------------------------------------------------- =head3 getRootHomeDir Get the path the root user home directory from /etc/passwd. Arguments: none Returns: path to root user home directory. Globals: none Error: none Example: $myHome = NetworkUtils->getRootHomeDir(); Comments: none =cut #-------------------------------------------------------------------------------- sub getRootHomeDir { my @root = split ':', (`/bin/grep ^root /etc/passwd 2>&1`); my $home = $root[5]; return $home; } #-------------------------------------------------------------------------------- =head3 getSetupRemoteShell Get the value of SetupRemoteShell in CSM database. Arguments: none Returns: value from database Globals: none Error: undefined Example: $::SETUP_REMOTE_SHELL = NetworkUtils->getSetupRemoteShell(); Comments: none =cut #-------------------------------------------------------------------------------- sub getSetupRemoteShell { # set local scope because we only want classes on the mgmt svr $ENV{'CT_MANAGEMENT_SCOPE'} = 1; # todo: remove when lsrsrc-api converts to above $ENV{'CT_SESSION_SCOPE'} = 1; if (NodeUtils->isMgmtSvr()) { #only defined on managment server my $outref = NodeUtils->runrmccmd('lsrsrc-api', "-i", "-s IBM.DmsCtrl::::SetupRemoteShell"); return $$outref[0]; } } #-------------------------------------------------------------------------------- =head3 installSSHFiles Installs SSH files Arguments: $filename_of_authorized_keys $filename_of_authorized_keys2 Returns: $::OK Globals: none Error: undefined Example: NetworkUtils->installSSHFiles ( $authorized_keys, $authorized_keys2); Comments: none =cut #-------------------------------------------------------------------------------- sub installSSHFiles { my ($class, $authorized_keys, $authorized_keys2) = @_; my ($cmd, $rc); my $home = InstallUtils->getRootHomeDir(); my $dest_dir = "$home/.ssh"; my $dest_authorized_keys = "$dest_dir/authorized_keys"; my $dest_authorized_keys2 = "$dest_dir/authorized_keys2"; umask(0077); if (!-d "$dest_dir") { # create a local directory $cmd = "$::MKDIR -p $dest_dir"; $rc = system("$cmd"); if ($rc >> 8) { # Could not create $::CSMINSTDIR directory. NodeUtils->message('E', 'EMsgNO_CreateDir', $dest_dir); NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgNO_CreateDir', $dest_dir ); return $::NOK; } else { chmod 0700, $dest_dir; } } umask(0133); if (-e "$dest_authorized_keys") { $cmd = "$::CAT $authorized_keys >> $dest_authorized_keys"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } } else { #just copy the keys my $cmd = "$::COPY $authorized_keys $dest_authorized_keys"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } chmod 0644, $dest_authorized_keys; } if (-e "$dest_authorized_keys2") { $cmd = "$::CAT $authorized_keys2 >> $dest_authorized_keys2"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } } else { #just copy the keys my $cmd = "$::COPY $authorized_keys2 $dest_authorized_keys2"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } chmod 0644, $dest_authorized_keys2; } } #-------------------------------------------------------------------------------- =head3 rmNodesKnownHosts Removes SSH known hosts Arguments: \@node_hostnames file name (optional) Returns: 1 - error 0 - success Globals: none Error: 1 Example: NetworkUtils->rmNodesKnownHosts(\@nodes); Comments: none =cut #-------------------------------------------------------------------------------- sub rmNodesKnownHosts { my ($class, $ref_nodes, $tmpKnownHosts) = @_; my @node_hostnames = @$ref_nodes; my $home = InstallUtils->getRootHomeDir(); my @all_names; my $return = 0; foreach my $n (@node_hostnames) { my @parts = split /\./, $n; my $name = shift @parts; push @all_names, $name; foreach my $ext (@parts) { $name = "$name.$ext"; push @all_names, $name; } #get the IP my $ip = inet_ntoa(inet_aton($n)); push @all_names, $ip; } #create the sed command my $sed = "/bin/sed -e "; $sed .= "\""; foreach my $n (@all_names) { $sed .= "/^$n\[,| ]/d; "; } chop $sed; #get rid of last space $sed .= "\""; my $sed2 = $sed; my $file = "$home/.ssh/$$"; while (-e $file) { $file = InstallUtils->CreateRandomName($file); } if (defined $tmpKnownHosts) { #use a temporary known hosts if (-e $tmpKnownHosts) { $sed .= " $tmpKnownHosts"; $sed .= " > $file"; my $printsed = $sed; $printsed =~ s/"//g; #" NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $printsed); `$sed 2>&1`; my $rc = $? >> 8; if ($rc) { $return = 1; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $printsed, $rc); } my $cp = "$::MV $file $tmpKnownHosts"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cp); `$cp 2>&1`; $rc = $? >> 8; if ($rc) { $return = 1; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cp, $rc); } # system("$::RM -f $file"); } } else { #use real known hosts if (-e "$home/.ssh/known_hosts") { $sed .= " $home/.ssh/known_hosts"; $sed .= " > $file"; my $printsed = $sed; $printsed =~ s/"//g; #" NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $printsed); `$sed 2>&1`; my $rc = $? >> 8; if ($rc) { $return = 1; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $printsed, $rc); } my $cp = "$::MV $file $home/.ssh/known_hosts"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cp); `$cp 2>&1`; $rc = $? >> 8; if ($rc) { $return = 1; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cp, $rc); } #system("$::RM -f $file"); } if (-e "$home/.ssh/known_hosts2") { $sed2 .= " $home/.ssh/known_hosts2"; $sed2 .= " > $file"; my $printsed2 = $sed2; $printsed2 =~ s/"//g; #" NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $printsed2); `$sed2 2>&1`; my $rc = $? >> 8; if ($rc) { $return = 1; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $printsed2, $rc); } my $cp = "$::MV $file $home/.ssh/known_hosts2"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cp); `$cp 2>&1`; $rc = $? >> 8; if ($rc) { $return = 1; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cp, $rc); } #system("$::RM -f $file"); } } return $return; } #-------------------------------------------------------------------------------- =head3 setupAIXRSH Setup RSH on AIX Managment Server Arguments: $fullHostNameofManagmentServer Returns: none Globals: none Error: none Example: NetworkUtils->setupAIXRSH($::csm_server); Comments: none =cut #-------------------------------------------------------------------------------- sub setupAIXRSH { my ($class, $ms, $inactivems) = @_; umask(0177); my $home = InstallUtils->getRootHomeDir(); my ($cmd, $rc); $cmd = "/bin/grep \"^$ms root\" $home/.rhosts"; `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { $cmd = "/bin/echo $ms root >> $home/.rhosts"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } } if (defined $inactivems) { $cmd = "/bin/grep \"^$inactivems root\" $home/.rhosts"; `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { $cmd = "/bin/echo $inactivems root >> $home/.rhosts"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } } } chmod 0600, "$home/.rhosts"; } #-------------------------------------------------------------------------------- =head3 setupLinuxRSH Setup RSH on Linux Mangement Server Arguments: $fullHostNameofManagmentServer Returns: none Globals: none Error: undefined Example: NetworkUtils->setupLinuxRSH($::csm_server); Comments: none =cut #-------------------------------------------------------------------------------- sub setupLinuxRSH { my ($class, $ms, $inactivems) = @_; umask(0177); my $home = InstallUtils->getRootHomeDir(); my ($cmd, $rc); # SuSE Changes # Setup rsh in inetd on SuSE my $distroname = NodeUtils->get_DistributionName; if (($distroname =~ /SuSE/) || ($distroname =~ /SLES/)) { `/bin/rpm -q inetd 2>&1`; if ($? >> 8) { #setup rsh by xinetd $cmd = "/bin/sed -e \"s/disable.*=.*yes/disable = no/\" /etc/xinetd.d/rsh"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); my @rsh = `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } open(RSH, ">/etc/xinetd.d/rsh") or NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgCANT_WRITE_FILE', "/etc/xinetd.d/rsh"); print RSH @rsh; close RSH; chmod 0600, "/etc/xinetd.d/rsh"; $cmd = "/etc/init.d/xinetd restart"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } if (-e "/etc/securetty") { $cmd = "/bin/grep rsh /etc/securetty"; `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { `/bin/echo rsh >> /etc/securetty`; } } } else { $cmd = "/bin/sed -e \"s/#.*shell/shell/\" /etc/inetd.conf"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); my @rsh = `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } open(RSH, ">/etc/inetd.conf") or NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgCANT_WRITE_FILE', "/etc/inetd.conf"); print RSH @rsh; close RSH; chmod 0600, "/etc/inetd.conf"; $cmd = "/etc/rc.d/inetd restart"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } } } else { $cmd = "/bin/sed -e \"s/disable.*=.*yes/disable = no/\" /etc/xinetd.d/rsh"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); my @rsh = `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } open(RSH, ">/etc/xinetd.d/rsh") or NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgCANT_WRITE_FILE', "/etc/xinetd.d/rsh" ); print RSH @rsh; close RSH; chmod 0600, "/etc/xinetd.d/rsh"; $cmd = "/sbin/service xinetd restart"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } if (-e "/etc/securetty") { $cmd = "/bin/grep rsh /etc/securetty"; `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { `/bin/echo rsh >> /etc/securetty`; } } } # End of SuSE change $cmd = "/bin/grep \"^$ms root\" $home/.rhosts"; `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { $cmd = "/bin/echo $ms root >> $home/.rhosts"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } } if (defined $inactivems) { $cmd = "/bin/grep \"^$inactivems root\" $home/.rhosts"; `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { $cmd = "/bin/echo $inactivems root >> $home/.rhosts"; NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'NodeUtils', 'V', 'IMsgCMD', $cmd); `$cmd 2>&1`; $rc = $? >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } } } chmod 0600, "$home/.rhosts"; } #-------------------------------------------------------------------------------- =head3 setupRemoteShellforFullInstall Sets up the remote shell across a list of nodes. Arguments: Reference to an array of nodeNames Returns: 1 - error 0 - success Globals: $::REMOTE_SHELL - shell to configure $SETUP_REMOTE_SHELL - bool: 1 == setup; 0 = don't setup Error: 1 Example: if (NetworkUtils->setupRemoteShellforFullInstall(\@::NODELIST) != 0) { blah; } Comments: none =cut #-------------------------------------------------------------------------------- sub setupRemoteShellforFullInstall { my $rc = 0; my ($class, $ref_nodes) = @_; my @node_hostnames = @$ref_nodes; # SETUP_REMOTE_SHELL controls whether or not to set up the remote shell # on the nodes. It is used when creating the config_file. # 0=do not set up remote shell # 1=set up whichever remote shell is listed in $::REMOTE_SHELL $::SETUP_REMOTE_SHELL = InstallUtils->getSetupRemoteShell(); # If the SetupRemoteShell attribute is set to 0 (or null) in DMSCTRL, # don't do any remote shell setup. if (!$::SETUP_REMOTE_SHELL) { return $rc; } $::REMOTE_SHELL = InstallUtils->getRemoteShell(); # If the REMOTE_SHELL is set to 1, there was an error getting it from # the dmsctrl. Don't bother setting up the remote shell. if ($::REMOTE_SHELL == 1) { return $::NOK; } (my $cmd_basename = $::REMOTE_SHELL) =~ s:^.*/::; if ($cmd_basename eq "rsh") { $::SETUP_REMOTE_SHELL = 1; } else # Attempt to set up ssh { if (InstallUtils->supportedSSHversion()) { # Check permissions on home directory $rc = InstallUtils->checkHOMEforSSHperm(); if ($rc) { $::SETUP_REMOTE_SHELL = 0; return $rc; } # Setup ssh keys NodeUtils->runcmd("/opt/csm/csmbin/remoteshell.expect -k", 0); # Copy ssh keys to /csminstall $rc = InstallUtils->cpSSHFiles(); if ($rc == 1) { $::SETUP_REMOTE_SHELL = 0; return $rc; } # Clean up the Known Hosts file for each node so that when the # nodes are reinstalled, the hosts files will be regenerated. #$rc = InstallUtils->rmNodesKnownHosts(\@node_hostnames); #the rmNodesKnownHosts step was moved to GatherSSHHostKeys # ssh was set up properly, so set it up on the nodes. $::SETUP_REMOTE_SHELL = 1; # Add RemoteShell to config_file } } return $rc; } #-------------------------------------------------------------------------------- =head3 supportedSSHversion Check if SSH version is supported by CSM install. Arguments: Requires proper valued in $::REMOTE_SHELL Returns: 1 - remote shell is a supported version 0 - unsupported vesion Globals: $::REMOTE_SHELL Error: 0 Example: my $sshOk = NetworkUtils->supportedSSHversion(); Comments: none =cut #-------------------------------------------------------------------------------- sub supportedSSHversion { #check if its a supported version of OpenSSH my $ssh_check = "$::REMOTE_SHELL -V"; my @ssh_res = `$ssh_check 2>&1`; my $ssh_rc = $? >> 8; if (!$ssh_rc) { #successful if ($ssh_res[0] =~ m/OpenSSH.(\d)\.\d/) { #we can set this up if ($1 >= 2) { if (wantarray) { return (1, $1); } else { return 1; } } } else { return 0; } } } #-------------------------------------------------------------------------------- =head2 TFTP USER Support =cut #-------------------------------------------------------------------------------- =head3 check4InstalledTftpServers Checks the current install for tftp rpms Arguments: $stars Returns: @tftpRpms - array of rpms found. Globals: $::TFTPUSER $default_tftp_server_name Error: error count Example: NetworkUtils->check4InstalledTftpServers(); Comments: none =cut #-------------------------------------------------------------------------------- sub check4InstalledTftpServers { # check if there are any tftp rpms installed my ($class, $stars) = @_; my $cmd = "rpm -qa | grep tftp"; # check and see if any tftp rpms are installed: my @tftpRpms = NodeUtils->runcmd($cmd, -1); if ($::RUNCMD_RC eq 0) { # first check: If our default tftp server is installed, then # we can just skip: foreach (@tftpRpms) { my $temp = $_; if (grep (/^$temp$/, @::default_tftp_server_name)) { # the default was found: MessageUtils->message('V', 'IMsgRPM_ALREADY_INSTALLED', @::default_tftp_server_name); return (1, @tftpRpms) ; # the 1 means that it is the default server } } if ($stars) { print "\n"; print "*" x 80 . "\n"; } # how many of them are actually installed? if ($#tftpRpms ne -1) { MessageUtils->message('V', 'IMsgRPM_ALREADY_INSTALLED', @::default_tftp_server_name); } else { MessageUtils->message('V', 'IMsgRPM_ALREADY_INSTALLED', @::default_tftp_server_name); } foreach (@tftpRpms) { print "\t$_\n"; } } return (0, @tftpRpms); } #-------------------------------------------------------------------------------- =head3 chTftpUserPermissions Change permissions on TFTP user files. Support routine for calls to find. Arguments: none Returns: none Globals: $::TFTPUSER $::TFTPGROUP Error: error count Example: find(\&chTftpUserPermissions, $dir); Comments: none =cut #-------------------------------------------------------------------------------- sub chTftpUserPermissions { # these guys seem to be in the wrong place. $::TFTPUSER = "tftpd"; $::TFTPGROUP = $::TFTPUSER; if (NetworkUtils->testTftpUser == 0) { NetworkUtils->createTftpUser; } my $filename = $File::Find::name; if (-f $filename) { NodeUtils->runcmd("chmod $::filePermissions $filename"); } elsif (-d $filename) { NodeUtils->runcmd("chmod $::dirPermissions $filename"); } else { print "---> $filename is not a file nor a directory.\n"; return; } # change owner and group: NodeUtils->runcmd("chown $::TFTPUSER $filename"); NodeUtils->runcmd("chgrp $::TFTPGROUP $filename"); } #-------------------------------------------------------------------------------- =head3 configureTftp Configure the default tftp server Arguments: none Returns: error count or 0 (success) Globals: none Error: error count Example: my $eCount = NetworkUtils->configureTftp(); Comments: none =cut #-------------------------------------------------------------------------------- sub configureTftp { # Configure inetd in SuSE my $distro = NodeUtils->distribution(); if ($distro =~ /SuSE/ || $distro =~ /SLES/) { my $inetderr = configureTftp_inetd(); return $inetderr; } my $xinetd = "/etc/xinetd.d"; my $tftpConf = $xinetd . "/tftp"; my $xinetdbackup = "/tmp/tftp.bak"; my $errors = 0; my ($cmd, $output, $rc); unless (-d $xinetd) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgXINETD_MISSING', "$xinetd"); $errors++; } # save old file to tmp if (-f "$tftpConf") { $cmd = "$::COPY -f $tftpConf $xinetdbackup"; $output = NodeUtils->runcmd($cmd, 0); $rc = $::RUNCMD_RC; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgShow_Output', $output); $errors++; } } # Now, configure our file: open(FILE, ">$tftpConf") or die NodeUtils->messageFromCat( 'csmInstall', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgCANT_WRITE_FILE', $tftpConf ); my @fC = <restartTftp($errors, "xinetd"); # restart tftp server. return $errors; } #-------------------------------------------------------------------------------- =head3 configureTftp_inetd Modify /etc/inetd.conf for tftp Arguments: none Returns: error count Globals: none Error: error count or 0 (success) Example: my $inetderr = configureTftp_inetd(); Comments: none =cut #-------------------------------------------------------------------------------- sub configureTftp_inetd { my $inetdconf = "/etc/inetd.conf"; my $inetdbackup = "/tmp/tftp_inetd.bak"; my $errors = 0; my ($cmd, $output, $rc, $s); unless (-f "$inetdconf") { return ($errors++); } # backup inetd.conf $cmd = "$::COPY -f $inetdconf $inetdbackup "; $output = NodeUtils->runcmd($cmd, 0); $rc = $::RUNCMD_RC; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgShow_Output', $output); $errors++; } # now edit the inetd.conf file: $s = NodeUtils->readFile($inetdconf); #comment tftp entry $s =~ s/^\s*(tftp\s+[\s\S]*$)//m; $s = $s . "\ntftp dgram udp wait root /usr/sbin/in.tftpd in.tftpd -r blksize -vvv -p -u tftpd -s /tftpboot\n"; if (open(FILE, ">$inetdconf")) { print FILE ($s); close(FILE); } else { exit; } # Restart inetd to pick up the changes $errors = NetworkUtils->restartTftp($errors, "inetd"); # restart tftp server. return $errors; } #-------------------------------------------------------------------------------- =head3 createTftpUser Create the TFTP user to secure system directories Arguments: none Returns: none Globals: $::TFTPUSER Error: V & I Err mesages Example: NetworkUtils->createTftpUser(); Comments: none =cut #-------------------------------------------------------------------------------- sub createTftpUser { unless ($::GREP) { $::GREP = '/bin/grep' } my $tftpuser = $::TFTPUSER; my $tftpgrp = $::TFTPGROUP; my $passwdFile = "/etc/passwd"; my $grpFile = "/etc/group"; my $bak = "/tmp/csmjunk"; # determine whether or not a tftpd user already exists: NodeUtils->runcmd("$::GREP -e '^$tftpuser' $passwdFile", -1); if ($::RUNCMD_RC eq 0) { #print "tftpd user has already been created.\n" if $::VERBOSE; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "V", 'IMsgUserAlreadyCreated', $tftpuser); } else { #print "Creating default tftpd user for the tftp server.\n"; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "I", 'IMsgCreatingTFTPUser', $tftpuser); # create tftpd user # NodeUtils->runcmd("cp $passwdFile $bak"); NodeUtils->runcmd( "echo '$tftpuser:x:6969:6969::/dev/null:/dev/null' | \ cat $bak - > $passwdFile"); # remove backup file NodeUtils->runcmd("rm $bak", -1); } NodeUtils->runcmd("$::GREP -e '^$tftpgrp' $grpFile", -1); if ($::RUNCMD_RC eq 0) { #print "tftpd group has already been created.\n" if $::VERBOSE; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "V", 'IMsgGroupAlreadyCreated', $tftpgrp); } else { #print "Creating default tftpd group for the tftp server.\n"; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "I", 'IMsgCreatingTFTPGroup', $tftpgrp); NodeUtils->runcmd("cp $grpFile $bak"); NodeUtils->runcmd( "echo '$tftpgrp:x:6969:' | \ cat $bak - > $grpFile"); # remove backup file NodeUtils->runcmd("rm $bak", -1); } } #-------------------------------------------------------------------------------- =head3 process_tftp handles installation of tftp-hpa rpm. Special case for tftp: 1. The tftp-hpa (default csm rpm) may already be installed. skip and do nothing 2. Another tftp server may already be installed remove old tftp server and install new? keep old tftp server and move on? keep old tftp server and install new tftp server quit 3. No tftp server RPM is installed just install the tftp server. if process_tftp returns 1 then install the default tftp package, otherwise, do not install it. (returns 0). Notes: Stuff like this should probably not be in a shared package. =cut #-------------------------------------------------------------------------------- sub process_tftp { my $installTftp = 0; # 0 means no, 1 means install it. my @vn = @::default_tftp_server_name; my ($cmd, $output, $rc, $returncode); $returncode = 0; my ($isDefault, @tftpRpms) = NetworkUtils->check4InstalledTftpServers(1); my $ans = ""; if ($#tftpRpms eq -1) { # no tftp servers were found. BUT, perhaps there is a # tarball installed. We should check for that! my $running = NetworkUtils->verifyTftp(); if ($running) { print "*" x 80 . "\n"; NodeUtils->message('I', 'IMsgTftpProcFound', @vn); while (1) { NodeUtils->message('I', 'IMsgTftpOptionsMenu', @vn, @vn); $| = 1; # force a flush $ans = ; chomp($ans); if ($ans eq 1 || $ans eq 2 || $ans eq 3) { last; } print "\n\n"; print "*" x 80 . "\n"; } if ($ans eq 3) { exit; } elsif ($ans eq 1) { # install @::default_tftp_server_name $installTftp = 1; # install tftp } elsif ($ans eq 2) { # warn them if they do not install tftp... NodeUtils->message('I', 'IMsgChangeTftpUser', 'tftpd'); my $d = ; # do nothing and leave. NodeUtils->message('I', 'IMsgWILL_NOT_INSTALL', @::default_tftp_server_name); } } # there were no tftp processes running. else { # so we need to install! $installTftp = 1; } } elsif ($#tftpRpms ne -1 && !$isDefault) { NodeUtils->message('I', 'IMsgTFTPInfo', @vn, @vn); while (1) { NodeUtils->message('I', 'IMsgTFTPOptions', @vn, @vn, @vn, @vn); $| = 1; # force a flush $ans = ; chomp($ans); if ($ans eq 1 || $ans eq 2 || $ans eq 3 || $ans eq 4) { last; } print "\n\n"; print "*" x 80 . "\n"; } # warn them if they do not install tftp... unless ($ans eq 1 || $ans eq 2 || $ans eq 4) { NodeUtils->message('I', 'IMsgChangeTftpUser', 'tftpd'); my $d = ; } if ($ans eq 1) { # remove tftp rpms and install @::default_tftp_server_name NetworkUtils->rmTftpRpms(@tftpRpms); $installTftp = 1; # install it! } elsif ($ans eq 2) { # install @::default_tftp_server_name $installTftp = 1; # install tftp } elsif ($ans eq 3) { # do nothing and leave. NodeUtils->message('I', 'IMsgWILL_NOT_INSTALL', @::default_tftp_server_name); } elsif ($ans eq 4) { exit; } else { # if we got here something went wrong print "internal error 127"; exit; } } elsif (!$isDefault) { # no tftp server is installed, so install the tftp server: $installTftp = 1; } # the last case is if the default tftp server was already installed. # if this is true then nothing needs to be returned (0) because we # do not wish to install it again. return $installTftp; } #-------------------------------------------------------------------------------- =head3 restartTftp Restart xinetd to pick up changes. Arguments: $errors $service - e.g. "inetd" or "xinetd" Returns: Number of errors Globals: none Error: Number of errors as a scalar. Example: $errors = NetworkUtils->restartTftp($errors, "inetd" ); Comments: none =cut #-------------------------------------------------------------------------------- sub restartTftp { my ($class, $errors, $service) = @_; my $rc; # Restart xinetd to pick up the changes my $cmd = NodeUtils->service($service, "start"); NodeUtils->runcmd($cmd, 0); if ($rc) { $errors++ } $cmd = NodeUtils->service($service, "reload"); NodeUtils->runcmd($cmd, 0); if ($rc) { $errors++ } return $errors; } #-------------------------------------------------------------------------------- =head3 rmTftpRpms Removes uses rpm to remove TFTP RPMs =cut #-------------------------------------------------------------------------------- sub rmTftpRpms { my ($class, @tftpRpms) = @_; my ($class, $output, $returncode, $ans); $returncode = 1; # signal an error by default, unless things run right. foreach my $installedTftp (@tftpRpms) { NodeUtils->message("I", 'IMsgUNINSTALLING', $installedTftp); my $cmd = "$::RPMCMD -e $installedTftp --nodeps"; $output = NodeUtils->runcmd($cmd, 0); $returncode = $::RUNCMD_RC if ($::RUNCMD_RC > $returncode); } return ($returncode); } #-------------------------------------------------------------------------------- =head3 secureFilePermissions Configure the default tftp server Arguments: $directory - the root directory $dir-perm - permissions for dirs and subdirs $file-perm - permissions for files Returns: none Globals: none Error: none Example: NetworkUtils->secureFilePermissions ( $directory, $dir-perm, $file-perm); Comments: none =cut #-------------------------------------------------------------------------------- sub secureFilePermissions { my ($class, $dir, $dirPerm, $filePerm, $disable_recurtive) = @_; # set these variables global, since &wanted does not # take parameters (see find routine in perl docs). $::dirPermissions = $dirPerm; $::filePermissions = $filePerm; if($disable_recurtive==0){ find(\&chTftpUserPermissions, $dir); }else{ $File::Find::name = $dir; &chTftpUserPermissions; } } #-------------------------------------------------------------------------------- =head3 testTftpUser Tests that the tftp user exists. Arguments: Returns: 0 = does not exit 1 = does exits errors Globals: $::TFTPUSER $passwdFile Error: none Example: if ( NetworkUtils->testTftpUser ) { blah;}; Comments: ATTN: set $tftpuser and $passwdFile in this sub. the tftp stuff might be better in a security package. =cut #-------------------------------------------------------------------------------- sub testTftpUser { my $tftpuser = $::TFTPUSER; my $passwdFile = "/etc/passwd"; # determine whether or not a tftpd user already exists: NodeUtils->runcmd("$::GREP -e '^$tftpuser' $passwdFile", -1); if ($::RUNCMD_RC eq 0) { return 1; } return 0; } #-------------------------------------------------------------------------------- =head3 verifyTftp Check that tftp server is running. If a value of 1 is passed in as an argument, then the routine will try to restart tftp if it isn't running. Arguments: optional argument "1" Returns: 0 = not running 1 = running errors Globals: none Error: return value of restart routine Example: my $running = NetworkUtils->verifyTftp(1); Comments: none =cut #-------------------------------------------------------------------------------- sub verifyTftp { # if the value 1 is passed in then we should try to restart tftp if # it is not running. my ($class, $restart) = @_; my $errors = 0; my $running = 0; my $cmd; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgCheckingTftp'); unless ($::LSOF) { $::LSOF = '/usr/sbin/lsof' } $cmd = "$::LSOF -i UDP:tftp"; NodeUtils->runcmd($cmd, -1); if ($::RUNCMD_RC) { # There is no tftp server running on this machine NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgTftpNotRunning', 'tftp'); } else { # A tftp server is up and running. NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgRunning', 'tftp'); $running = 1; } # try to restart it if ($restart && $::RUNCMD_RC) { # trying to restart tftp server NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgRestart', 'tftp'); my $distro = NodeUtils->distribution(); # restart tftp server. if ($distro =~ /SuSE/ || $distro =~ /SLES/) { $errors = NetworkUtils->restartTftp($errors, "inetd"); } else { $errors = NetworkUtils->restartTftp($errors, "xinetd"); } $cmd = "$::LSOF -i UDP:tftp"; NodeUtils->runcmd($cmd, -1); if ($::RUNCMD_RC) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgStillCantRestart', 'tftp' ); } else { $running = 1; } } return $running; } #-------------------------------------------------------------------------------- =head3 validate_ip Check that tftp server is running. If a value of 1 is passed in as an argument, then the routine will try to restart tftp if it isn't running. Arguments: hostname Returns: -1 = errors ipaddress Globals: none Error: return ip address for the hostname Example: my $ipaddr = NetworkUtils->validate_ip($hostname); Comments: none =cut #-------------------------------------------------------------------------------- sub validate_ip { my $class = shift; my $host = shift; my ($work, $res_ip_addr); $work = inet_aton($host); if (!defined($work)) { $res_ip_addr = -1; } else { $res_ip_addr = inet_ntoa($work); } return $res_ip_addr; } #-------------------------------------------------------------------------------- 1; kP0PBm7usa@a@a@ s./opt/csm/pm/NodeUtils.pmpm.pmm#!/usr/bin/perl # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2000,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # -*- perl -*- # "@(#)29 1.133.1.2 src/csm/core/pm/NodeUtils.pm.perl, csmcore, csm_rveg, rvegs002a 6/10/04 13:23:56" # #-------------------------------------------------------------------------------- package NodeUtils; use strict; # locale tells perl to honor locale for sorting, dates, etc. # More info about locale.pm and perl handling of locales can be found in # /usr/lib/perl5/5.6.0/locale.pm and the man page for perllocale. use locale; use Socket; use File::Basename; use MessageUtils; use NetworkUtils; require CSMDefs; my $msgs; my $distro; my $useTranslatedMsg; my %catHashes; my $csmroot; my ($MSGCAT, $MSGMAPPATH, $MSGSET); my $NO_NODERANGES; my $NODEGROUPEXPMEM_WARNING = 1; # $NodeUtils::NO_MESSAGES; # Set this to 1 if you do not want NodeUtils to # print any error msgs # $NodeUtils::errno; # Will be set if an error occurs. You must zero # this out before calling a NodeUtils function, # if you want to check it afterwards. BEGIN { $::progname=basename $0; # This enables us to redirect where it looks for other CSM files during development $csmroot = $ENV{'CSM_ROOT'} ? $ENV{'CSM_ROOT'} : '/opt/csm'; $MSGCAT = 'nodecmds.cat'; if (defined $::MSGMAPPATH) { $MSGMAPPATH = $ENV{'CSM_ROOT'} ? "$csmroot/msgmaps" : $::MSGMAPPATH; } else { $MSGMAPPATH = "$csmroot/msgmaps"; } $MSGSET = 'NodeUtils'; #set LD_ASSUME_KERNEL if running on a RH EL 3 machine # my $rh_relfile = "/etc/redhat-release"; # my $rh_vers = '^Red Hat Enterprise Linux .* release 3 (.*)$'; # if (-f $rh_relfile) # { # `/bin/grep \"$rh_vers\" $rh_relfile > /dev/null 2>&1`; # my $exit = $? >> 8; # if ($exit == 0) # { # $ENV{'LD_ASSUME_KERNEL'} = "2.4.19"; # } # } } # Cannot run lsrsrc from within a DMSRM action (causes deadlock), # so don't call it from nodestatus or write_status. if (($::progname ne "nodestatus") && ($::progname ne "write_status") && (!$ENV{'CSM_HAMS_CONTROL'})) { my $hamode = `CT_MANAGEMENT_SCOPE=1 lsrsrc-api -i -s IBM.DmsCtrl::::HAMode 2>/dev/null`; if (($hamode != 0) && ($hamode != 1)) { MessageUtils->messageFromCat($MSGCAT, $MSGMAPPATH, $MSGSET, 'E1', 'EMsgCannotRunCSMCommands'); } } umask(0022); # This sets umask for all CSM files so that group and world only # have read permissions. # To change it, simply use the umask call in your script, after # the "use NodeUtils;" line #-------------------------------------------------------------------------------- =head1 NodeUtils =head2 Package Description This program module file, supports the CSM/install Node dependencies, and provides general utilities used by the node commands and a few other parts of CSM. If adding to this file, please take a moment to ensure that: 1. Your contrib has a readable pod header describing the purpose and use of your contrib. 2. Your contrib is under the correct heading and is in alphabetical order under that heading. 3. You test your contribution by running from the command line: pod2html --verbose --title=NodeUtils NodeUtils.pm.perl --outfile=NodeUtils.html and examining the ./NodeUtils.html file in a browser. =cut #-------------------------------------------------------------------------------- =head2 Package Dependancies package NodeUtils; use strict; locale tells perl to honor locale for sorting, dates, etc. More info about locale.pm and perl handling of locales can be found in /usr/lib/perl5/5.6.0/locale.pm and the man page for perllocale. use locale; use Socket; use MessageUtils; use NetworkUtils; =cut #-------------------------------------------------------------------------------- =head2 Global "umask" Setting umask(0022); umask sets umask for all CSM files so that group and world only have read permissions. To change it, simply use the umask call in your script, after the "use NodeUtils;" line =cut #-------------------------------------------------------------------------------- =head1 Subroutines by Functional Group =cut #-------------------------------------------------------------------------------- =head2 Misc Tools =cut #-------------------------------------------------------------------------------- =head3 csm_license_valid Check the status of a CSM License. Arguments: none Returns: 1 - a CSM license exists & is not expired 0 - no license exists or it has expired -1 - encountered a problem determining status Globals: none Error: see returns Example: not used Comments: none =cut #-------------------------------------------------------------------------------- sub csm_license_valid { my $outref = NodeUtils->runrmccmd('runact-api', "-c IBM.DmsCtrl::::isLicenseValid"); if (!$outref || @$outref[0] =~ /::0$/) { return 0; } else { return 1; } } #-------------------------------------------------------------------------------- =head3 distribution Returns the distribution and version of the current machine in the form: Arguments: none Returns: distro and version strings separated by a space. Globals: none Error: Returns undef if it is an unknown distro. Example: NodeUtils->distribution(); Comments: none =cut #-------------------------------------------------------------------------------- sub distribution { if (!defined($distro)) { # see info.c of the guname tool in gnome-utils for examples # of supporting other distros if (-f '/etc/redhat-release') { my $s = NodeUtils->readFile('/etc/redhat-release'); #print "s=$s"; my ($name, $version) = split(/ release /, $s); $version = (split(' ', $version))[0]; # Strip codename if (($name =~ /Advanced/) && ($version =~ /AS/)) { $version =~ s/AS$//; # Strip AS off the end $name = 'RedHatAS'; } elsif ( (($name =~ /Enterprise/) && ($version =~ /AS/)) || (($name =~ /Enterprise/) && ($name =~ /AS/))) { $version =~ s/AS$//; $name = 'RedHatEL-AS'; } elsif (($version =~ /WS/) || ($name =~ /WS/)) { $version =~ s/WS$//; $name = 'RedHatEL-WS'; } elsif (($version =~ /ES/) || ($name =~ /ES/)) { $version =~ s/ES$//; $name = 'RedHatEL-ES'; } else { $name = 'RedHat'; } #print "name=$name version=$version\n"; $distro = $name . ' ' . $version; } elsif (-f '/etc/SuSE-release') { my $s = NodeUtils->readFile('/etc/SuSE-release'); #print "s=$s"; my $d = 'SuSE'; if ($s =~ /SLES/s) { $d = 'SLES'; } my ($version) = $s =~ /VERSION\s*=\s*(\d+\.\d+)/; $distro = "$d $version"; } else { $distro = ''; } # this prevents it from trying to find it every time } return (length($distro) ? $distro : undef); } #-------------------------------------------------------------------------------- =head3 equalArrays Compares 2 arrays and returns true if they are the same length and all of their elements are equal. Both arrays are references. Arguments: ref_array1 ref_array2 Returns: bool_ret - 1 or 0 Globals: none Error: none Example: unused Comments: unused =cut #-------------------------------------------------------------------------------- sub equalArrays { my ($class, $a1, $a2) = @_; my $len1 = scalar(@$a1); if ($len1 != scalar(@$a2)) { return 0; } for (my $i = 0 ; $i < $len1 ; $i++) { if ($$a1[$i] ne $$a2[$i]) { return 0; } } return 1; } #-------------------------------------------------------------------------------- =head3 isAIX returns 1 if localHost is AIX Arguments: none Returns: 1 - localHost is AIX 0 - localHost is some other platform Globals: none Error: none Example: if (NodeUtils->isAIX()) { blah; } Comments: none =cut #-------------------------------------------------------------------------------- sub isAIX { if ($^O =~ /^aix/i) { return 1; } else { return 0; } } #-------------------------------------------------------------------------------- =head3 isLinux returns 1 if localHost is Linux Arguments: none Returns: 1 - localHost is Linux 0 - localHost is some other platform Globals: none Error: none Example: if (NodeUtils->isLinux()) { blah; } Comments: none =cut #-------------------------------------------------------------------------------- sub isLinux { if ($^O =~ /^linux/i) { return 1; } else { return 0; } } #-------------------------------------------------------------------------------- =head3 ispLinux returns 1 if localHost is pLinux Arguments: none Returns: 1 - localHost is pLinux 0 - localHost is some other platform Globals: none Error: none Example: if (NodeUtils->ispLinux()) { blah; } Comments: none =cut #-------------------------------------------------------------------------------- sub isPLinux { my $arch = `/bin/uname -m`; chomp($arch); if ($arch eq "ppc64") { return 1; } else { return 0; } } #-------------------------------------------------------------------------------- =head3 isMgmtSvr returns 1 if localHost is a CSM Management Server Arguments: none Returns: 1 - localHost is a Managment Sever 0 - localHost is not Globals: none Error: none Example: if (NodeUtils->isMgmtSvr()) { blah; } Comments: none =cut #-------------------------------------------------------------------------------- sub isMgmtSvr { # Note: we could check for the csm.server, but that check is slower and OS dependent. if (-f '/usr/bin/lsrsrc-api' && -f '/usr/sbin/rsct/bin/IBM.DMSRMd') { return 1; } else { return 0; } } #-------------------------------------------------------------------------------- =head3 isNode returns 1 if localHost is CSM node or Management Server. Arguments: none Returns: 1 - localHost is a CSM Node or Management Sever 0 - localHost is neither Globals: none Error: none Example: if (NodeUtils->isNode()) { blah; } Comments: none =cut #-------------------------------------------------------------------------------- sub isNode { # Note: we could check for the csm.client, but that check is slower and OS dependent. if (-f '/usr/bin/lsrsrc-api' && -f '/usr/sbin/rsct/bin/IBM.CSMAgentRMd') { return 1; } else { return 0; } } #-------------------------------------------------------------------------------- =head3 isRoot returns 1 if the effective user running this subroutine is the root user. Arguments: none Returns: 1 - effective user is root 0 - effective user is not root. Globals: none Error: none Example: if (NodeUtils->isRoot()) { blah; } Comments: none =cut #-------------------------------------------------------------------------------- sub isRoot { return $> == 0; } #-------------------------------------------------------------------------------- =head3 programName Return the name of the perl script currently being executed, w/o the path. Arguments: none Returns: program name without the path Globals: none Error: none Example: return NodeUtils->programName() . ": Houstin , we have a problem.\n"; Comments: none =cut #-------------------------------------------------------------------------------- sub programName { my $progname = $0; $progname =~ s|.*/([^/]+?)$|$1|; # on linux we have to strip the path return $progname; } #-------------------------------------------------------------------------------- =head3 quote Quote a string, taking into account embedded quotes. This function is most useful when passing string through the shell to another cmd. It handles one level of embedded double quotes, single quotes, and dollar signs. Arguments: string to quote Returns: quoted string Globals: none Error: none Example: if (defined($$opthashref{'WhereStr'})) { $where = NodeUtils->quote($$opthashref{'WhereStr'}); } Comments: none =cut #-------------------------------------------------------------------------------- sub quote { my ($class, $str) = @_; # if the value has imbedded double quotes, use single quotes. If it also has # single quotes, escape the double quotes. if (!($str =~ /\"/)) # no embedded double quotes { $str =~ s/\$/\\\$/sg; # escape the dollar signs $str = qq("$str"); } elsif (!($str =~ /\'/)) { $str = qq('$str'); } # no embedded single quotes else # has both embedded double and single quotes { # Escape the double quotes. (Escaping single quotes does not seem to work # in the shells.) $str =~ s/\"/\\\"/sg; #" this comment helps formating $str =~ s/\$/\\\$/sg; # escape the dollar signs $str = qq("$str"); } } #-------------------------------------------------------------------------------- =head3 readFile Read a file and return its content. Arguments: filename Returns: file contents or undef Globals: none Error: undef Example: my $blah = NodeUtils->readFile('/etc/redhat-release'); Comments: none =cut #-------------------------------------------------------------------------------- sub readFile { my ($class, $filename) = @_; open(FILE, "<$filename") or return undef; my @contents; @contents = ; close(FILE); if (wantarray) { return @contents; } else { return join('', @contents); } } #-------------------------------------------------------------------------------- =head2 Attribute Layer =cut #-------------------------------------------------------------------------------- =head3 checkForNotFound Checks to see if listnodeattrs couldn't find some nodes. Arguments: $nodeList Returns: none. Globals: $::LISTNODEATTRS_NUMNOTFOUND Error: E12 Example: NodeUtils->checkForNotFound($refnodes); Comments: none =cut #-------------------------------------------------------------------------# sub checkForNotFound { my ($class, $nodelist) = @_; if ($::LISTNODEATTRS_NUMNOTFOUND) { if (scalar(@$nodelist) == 1) { NodeUtils->messageFromCat( 'nodecmds.cat', $::MSGMAPPATH, 'lsnode', 'E12', 'EMsgNODE_NOT_FOUND', $$nodelist[0] ); } elsif (scalar(@$nodelist) <= 10) { NodeUtils->messageFromCat( 'nodecmds.cat', $::MSGMAPPATH, 'lsnode', 'W12', 'EMsgSOME_NOT_FOUND_LIST', join(', ', @$nodelist) ); } else { NodeUtils->messageFromCat('nodecmds.cat', $::MSGMAPPATH, 'lsnode', 'W12', 'EMsgSOME_NOT_FOUND'); } } } #-------------------------------------------------------------------------------- =head3 check_valid_install_distros Check whether current node's InstallDistributionName and InstallDistributionVersion is valid for full installation Arguments: $installMethod $distro Returns: -1 - couldn't find valid install distro 0 - found valid install distro Globals: none Error: -1 - on failure Example: my $rc = NodeUtils->check_valid_install_distros("autoyast",$distro); Comments: none =cut #-------------------------------------------------------------------------------- sub check_valid_install_distros { my ($class, $installmethod, $distro) = @_; my @VALID_AUTOYAST_DISTROS = ('SuSE8.1', 'SLES8.1'); if (!grep(/^$distro$/, @VALID_AUTOYAST_DISTROS)) { return -1; } return 0; } #-------------------------------------------------------------------------------- =head3 common_install_method Test that the install method attribute is identical across all the nodes in the global %::NODEHASH. Arguments: uses global below Returns: a scalar value of the InstallMethod node attribute held in common by all nodes in the %::NODEHASH ( "kickstart" || "yast" ). Globals: %::NODEHASH - input list of nodes to check Error: Exits with an error if the InstallMethod attribute is not the same on all the nodes. Example: $::INSTALL_METHOD = NodeUtils->common_install_method(); Comments: May be used in conjuction with "NodeUtils->get_common_attrs()" but this routine exists to handle an idiosyncracy in installnode(). =cut #-------------------------------------------------------------------------------- sub common_install_method { my $const_attr = 0; # the InstallMethod value my @hosts = keys %::NODEHASH; # all hosts my $test_host = @hosts[0]; # just get the first one if ( $test_host ) # not empty { # constant value to test against $const_attr = $::NODEHASH{$test_host}{'InstallMethod'}; } else { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgNO_ATTR', 'InstallMethod'); } # go through all hosts and compare InstallMethod to $const_attr foreach $test_host (@hosts) { my $next_hash_value = $::NODEHASH{$test_host}{'InstallMethod'}; if ( $next_hash_value ne $const_attr ) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgDIFFERENT_ATTR', 'InstallMethod'); } } return $const_attr; } #-------------------------------------------------------------------------# =head3 getBladeStatus Returns a reference to a hash of nodeName/[yes|no]. Determines whether each node in the array is or is not a blade. Arguments: @node_list - an array of nodesNames. Returns: A hash ref of { node => yes or no } Error: none Example: $ref_bladeStatus = NodeUtils->getBladeStatus(@goodNodes); Comments: getBladeStatus will not verify that the nodes are defined in the Database. =cut #-------------------------------------------------------------------------------- sub getBladeStatus { # local variables. my ($node, $nodes, %nodes, $rc, $rv, $cmd, @stdout, $line); # first strip the class name: shift; # need to do 50 at a time so that we don't have scaling problems. $nodes = join(',', @_); # the command to find out whether we have a blade or not is this: $cmd = "/opt/csm/bin/lshwstat -n $nodes blade"; # do runcmd, but do not exit if there is an error. Just # set the return code. @stdout = NodeUtils->runcmd("$cmd"); foreach $line (@stdout) { ($node, $rv) = split(': ', $line); $nodes{$node} = $rv; } return \%nodes; } #-------------------------------------------------------------------------------- =head3 get_common_attrs Get the common attributes across all the nodes for the follwoing attrs: InstallDistributionName InstallDistributionVersion InstallPkgArchitecture InstallCSMVersion Arguments: uses global below Returns: Array of common attribute values on success Globals: %::NODEHASH - input list of nodes to check Error: Exits with an error if one of the attributes is not the same on all the nodes in %::NODEHASH Example: ($::DISTRO_NAME, $::DISTRO_VERSION, $::ARCH, $::CSM_VERSION ) = NodeUtils->get_common_attrs(); Comments: =cut #-------------------------------------------------------------------------------- sub get_common_attrs { # no parameters... my ($hostname, $distro_name, $distro_version, $arch, $csm_version); my ($InstallDistributionName); my ($InstallDistributionVersion); my ($InstallPkgArchitecture); my ($InstallCSMVersion); my ($errors) = 0; my $InstallCSMVersion_Err_Flg = 0; my $InstallPkgArchitecture_Err_Flg = 0; my $InstallDistributionVersion_Err_Flg = 0; my $InstallDistributionName_Err_Flg = 0; my $DistributionName_Err_Flg = 0; my $DistributionVersion_Err_Flg = 0; my $PkgArchitecture_Err_Flg = 0; my $CSMVersion_Err_Flg = 0; foreach $hostname (keys %::NODEHASH) { $InstallDistributionName = $::NODEHASH{$hostname}{'InstallDistributionName'}; $InstallDistributionVersion = $::NODEHASH{$hostname}{'InstallDistributionVersion'}; $InstallPkgArchitecture = $::NODEHASH{$hostname}{'InstallPkgArchitecture'}; $InstallCSMVersion = $::NODEHASH{$hostname}{'InstallCSMVersion'}; if (!$distro_name) { $distro_name = $InstallDistributionName; } if (!$distro_version) { $distro_version = $InstallDistributionVersion; } if (!$csm_version) { $csm_version = $InstallCSMVersion; } if (!$arch) { $arch = $InstallPkgArchitecture; } if ("$distro_name" and ($InstallDistributionName ne $distro_name)) { $errors++; $InstallDistributionName_Err_Flg++; } if ("$distro_version" and ($InstallDistributionVersion ne $distro_version)) { $errors++; $InstallDistributionVersion_Err_Flg++; } if ("$arch" and ($InstallPkgArchitecture ne $arch)) { $errors++; $InstallPkgArchitecture_Err_Flg++; } if ("$csm_version" and ($InstallCSMVersion ne $csm_version)) { $errors++; $InstallCSMVersion_Err_Flg++; } } if (!$distro_name) { $errors++; $DistributionName_Err_Flg++; } if (!$distro_version) { $errors++; $DistributionVersion_Err_Flg++; } if (!$arch) { $errors++; $PkgArchitecture_Err_Flg++; } if (!$csm_version) { $errors++; $CSMVersion_Err_Flg++; } if ($InstallDistributionName_Err_Flg > 0) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgDIFFERENT_ATTR', 'InstallDistributionName' ); } if ($InstallDistributionVersion_Err_Flg > 0) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgDIFFERENT_ATTR', 'InstallDistributionVersion' ); } if ($InstallPkgArchitecture_Err_Flg > 0) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgDIFFERENT_ATTR', 'InstallPkgArchitecture' ); } if ($InstallCSMVersion_Err_Flg > 0) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgDIFFERENT_ATTR', 'InstallCSMVersion' ); } if ($DistributionName_Err_Flg > 0) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgNO_ATTR', 'InstallDistributionName' ); } if ($DistributionVersion_Err_Flg > 0) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgNO_ATTR', 'InstallDistributionVersion' ); } if ($PkgArchitecture_Err_Flg > 0) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgNO_ATTR', 'InstallPkgArchitecture' ); } if ($CSMVersion_Err_Flg > 0) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgNO_ATTR', 'InstallCSMVersion'); } exit $errors if ($errors); my @return_array = ($distro_name, $distro_version, $arch, $csm_version); return (@return_array); } #-------------------------------------------------------------------------------- =head3 get_CSMVersion Get the version of csm component that is installed on the management server. Arguments: $component $showfixlevel Returns: the csm version as a string. Globals: $::PLTFRM $::RPMCMD Error: Undefined Example: $ret_code=NodeUtils->get_CSMVersion("rpm"); Comments: The version should be in the form "V.R.M" (e.g. 1.2.0). If showfixlevel parameter == true (1), the version will be in the form "V.R.M.F" (e.g. 1.2.0.0). =cut #-------------------------------------------------------------------------------- sub get_CSMVersion { my ($class, $component, $showfixlevel) = @_; my ($cmd, $output, $rpm, $version, $release, $v1, $v2, $v3, $v4, $rest); if ($::PLTFRM eq "Linux") { $cmd = "$::RPMCMD -q $component"; $output = NodeUtils->runcmd($cmd); chomp($output); ($rpm, $version, $release) = split(/-/, $output); ($v1, $v2, $v3, $v4, $rest) = split(/\./, $version); if ($showfixlevel) { $version = join(".", $v1, $v2, $v3, $v4); } else { $version = join(".", $v1, $v2, $v3); } } elsif ($::PLTFRM eq "AIX") { $cmd = "$::LSLPP -cLq $component"; $output = NodeUtils->runcmd($cmd); chomp($output); # The third field in the lslpp output is the VRMF ($version) = (split(/:/, $output))[2]; ($v1, $v2, $v3, $v4, $rest) = split(/\./, $version); if ($showfixlevel) { $version = join(".", $v1, $v2, $v3, $v4); } else { $version = join(".", $v1, $v2, $v3); } } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E2', 'EMsgINVALID_OSTYPE'); } return (length($version) ? $version : undef); } #-------------------------------------------------------------------------------- =head3 get_default_attributes Set these default values for attributes not on command line: InstallOSName OS Name of management server ("Linux" or "AIX"). InstallDistributionVersion MS's operating system version. InstallDistributionName MS's operating system distribution (Linux only) InstallPkgArchitecture MS's architecture (Linux only). if MS's architecture=i?86: set to i386.. InstallCSMVersion Version of csm.core installed on MS. ConsoleMethod PowerMethod if PowerMethod=hmc. ConsoleServerName Set to HWControlPoint if PowerMethod=hmc also set during -H and -C processing. ConsoleSerialDevice ConsolePortNum Arguments: none Returns: number of errors Globals: $::ATTRS hash Error: error count Example: NodeUtils->get_default_attributes; Comments: none =cut #-------------------------------------------------------------------------------- sub get_default_attributes { my ($errors) = 0; # Operating System Type (Linux or AIX). Use MS's InstallOSName by default if (!$::ATTRS{"InstallOSName"}) { $::ATTRS{"InstallOSName"} = InstallUtils->get_OSName(); NodeUtils->message('V', 'IMsgDEFAULT_ATTR_SET', "InstallOSName", $::ATTRS{'InstallOSName'}); if (!$::ATTRS{"InstallOSName"}) { NodeUtils->message('W', 'EMsgCANT_GET_OSNAME'); $errors++; } } # Operating System Version. Use MS's Operating System Version if (!$::ATTRS{"InstallDistributionVersion"}) { $::ATTRS{"InstallDistributionVersion"} = InstallUtils->get_DistributionVersion(); NodeUtils->message('V', 'IMsgDEFAULT_ATTR_SET', "InstallDistributionVersion", $::ATTRS{'InstallDistributionVersion'}); unless ($::ATTRS{"InstallDistributionVersion"}) { NodeUtils->message('W', 'EMsgCANT_GET_DISTROVERSION'); $errors++; } } # Operating System Distribution. Use MS's Operating System Distribution. # Only for Linux. if (!$::ATTRS{"InstallDistributionName"} && ($::ATTRS{"InstallOSName"} eq "Linux")) { $::ATTRS{"InstallDistributionName"} = InstallUtils->get_DistributionName(); NodeUtils->message('V', 'IMsgDEFAULT_ATTR_SET', "InstallDistributionName", $::ATTRS{'InstallDistributionName'}); unless ($::ATTRS{"InstallDistributionName"}) { NodeUtils->message('W', 'EMsgCANT_GET_DISTRONAME'); $errors++; } } # Package Architecture. Use MS's Architecture. # Only for Linux. if (!$::ATTRS{"InstallPkgArchitecture"} && ($::ATTRS{"InstallOSName"} eq "Linux")) { $::ATTRS{"InstallPkgArchitecture"} = InstallUtils->get_PkgArchitecture(); # All x86 machine types map to i386 since all x86 rpms are stored in # the same directory. if ($::ATTRS{'InstallPkgArchitecture'} =~ /i.86/) #SSS { $::ATTRS{'InstallPkgArchitecture'} = "i386"; } NodeUtils->message('V', 'IMsgDEFAULT_ATTR_SET', "InstallPkgArchitecture", $::ATTRS{'InstallPkgArchitecture'}); unless ($::ATTRS{"InstallPkgArchitecture"}) { NodeUtils->message('W', 'EMsgCANT_GET_PKGARCH'); $errors++; } } # CSM Version. Use version of csm.core installed on MS by default for Linux if ( (!$::ATTRS{"InstallCSMVersion"}) && ($::ATTRS{"InstallOSName"} eq "Linux")) { # No default value for AIX nodes $::ATTRS{"InstallCSMVersion"} = InstallUtils->get_CSMVersion("csm.core"); NodeUtils->message('V', 'IMsgDEFAULT_ATTR_SET', "InstallCSMVersion", $::ATTRS{'InstallCSMVersion'}); unless ($::ATTRS{"InstallCSMVersion"}) { NodeUtils->message('W', 'EMsgCANT_GET_CSMVERSION'); $errors++; } } # Console Serial Device. For Linux, default to "ttyS0". if ( (!$::ATTRS{"ConsoleSerialDevice"}) && ($::ATTRS{"InstallOSName"} eq "Linux")) { $::ATTRS{"ConsoleSerialDevice"} = "ttyS0"; } # ConsoleMethod. Set this to the PowerMethod if PowerMethod=hmc. if (!$::ATTRS{"ConsoleMethod"} and ($::ATTRS{"PowerMethod"} eq "hmc")) { $::ATTRS{"ConsoleMethod"} = $::ATTRS{"PowerMethod"}; } # ConsoleServerName. Set this to the HWControlPoint if PowerMethod=hmc. if (!$::ATTRS{"ConsoleServerName"} and ($::ATTRS{"PowerMethod"} eq "hmc")) { $::ATTRS{"ConsoleServerName"} = $::ATTRS{"HWControlPoint"}; } # If the PowerMethod is "csp" we can set some of the console attributes # ConsoleMethod. Set this to the PowerMethod if PowerMethod=csp if (!$::ATTRS{"ConsoleMethod"} and ($::ATTRS{"PowerMethod"} eq "csp")) { $::ATTRS{"ConsoleMethod"} = $::ATTRS{"PowerMethod"}; } # ConsoleServerName. Set this to the HWControlPoint if PowerMethod=csp if (!$::ATTRS{"ConsoleServerName"} and ($::ATTRS{"PowerMethod"} eq "csp")) { $::ATTRS{"ConsoleServerName"} = $::ATTRS{"HWControlPoint"}; } # ConsolePortNum. Set this to the HWControlNodeId if PowerMethod=csp if (!$::ATTRS{"ConsolePortNum"} and ($::ATTRS{"PowerMethod"} eq "csp")) { $::ATTRS{"ConsolePortNum"} = $::ATTRS{"HWControlNodeId"}; } return ($errors); } #-------------------------------------------------------------------------------- =head3 get_DistributionName Linux only command Get the distribution name for Linux Arguments: $output $rpm $distro Returns: Linux distribution name as a string. Globals: $::PLTFRM Error: Exits with E2 Example: $::ATTRS{'InstallDistributionName'} = NodeUtils->get_DistributionName; Comments: returns nulls for AIX and exits on E2 for any other platform. =cut #-------------------------------------------------------------------------------- sub get_DistributionName { my ($cmd, $output, $rpm, $distro); # IF LINUX if ($::PLTFRM eq "Linux") { $distro = (split ' ', (NodeUtils->distribution()))[0]; #if (-f '/etc/redhat-release') #{ # RedHat is the only Linux distro we support for now. # $distro = "RedHat"; #} } elsif ($::PLTFRM eq "AIX") { $distro = ""; } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E2', 'EMsgINVALID_OSTYPE'); } return (length($distro) ? $distro : undef); } #-------------------------------------------------------------------------------- =head3 get_DistributionVersion Returns the Operating System version that is installed on the management server. Arguments: none Returns: OS Version as a string. Globals: $::PLTFRM Error: undef Example: my $DistVersion = NodeUtils->get_DistributionVersion(); Comments: For AIX, the version is in the V.R.M form ( e.g. 1.2.0 ). For Linux, the form reported in the /etc/redhat-release file (V.R) is used ( e.g. 1.2 ) =cut #-------------------------------------------------------------------------------- sub get_DistributionVersion { my ($cmd, $output, $rpm, $version, $release, $v1, $v2, $v3, $rest); if ($::PLTFRM eq "Linux") { $version = (split ' ', (NodeUtils->distribution()))[1]; #if (-f '/etc/redhat-release') #{ # my $s = NodeUtils->readFile('/etc/redhat-release'); # ($version) = $s =~ /\s(\d+\.\d+)\s/; #} } elsif ($::PLTFRM eq "AIX") { #$cmd = "$::OSLEVEL"; $cmd = "$::LSLPP -Lcq bos.rte | /usr/bin/cut -d: -f 3"; $output = NodeUtils->runcmd($cmd); chomp($output); ($v1, $v2, $v3, $rest) = split(/\./, $output); $version = join(".", $v1, $v2, $v3); } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E2', 'EMsgINVALID_OSTYPE'); } return (length($version) ? $version : undef); } #-------------------------------------------------------------------------------- =head3 get_OSName Returns the OS Name i.e. Linux, AIX or undef. Arguments: none Returns: OS Name as a string. Globals: none Error: undef Example: $::ATTRS{'InstallOSName'}=NodeUtils->get_OSName; Comments: none =cut #-------------------------------------------------------------------------------- sub get_OSName { if (NodeUtils->isLinux() == 1) { return "Linux"; } elsif (NodeUtils->isAIX() == 1) { return "AIX"; } return undef; } #-------------------------------------------------------------------------------- =head3 get_PkgArchitecture Linux only routine. Returns the rpm package architure for the OS in $::PLTFRM i.e. i386 for linux Arguments: $output, $osarch Returns: none Globals: $::PLTFRM Error: messageFromCat E2 Example: $::ATTRS{'InstallPkgArchitecture'} = NodeUtils->get_PkgArchitecture; Comments: Works for Linux. Returns null values $::PLTFRM is AIX, and exits with E2 for any other $::PLTFRM. =cut #-------------------------------------------------------------------------------- sub get_PkgArchitecture { my ($cmd, $output, $osarch); if ($::PLTFRM eq "Linux") { $cmd = "$::UNAME -m"; $output = NodeUtils->runcmd($cmd); chomp($output); $osarch = $output; return (length($osarch) ? $osarch : undef); } elsif ($::PLTFRM eq "AIX") { $osarch = ""; return (length($osarch) ? $osarch : undef); } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E2', 'EMsgINVALID_OSTYPE'); } } #-------------------------------------------------------------------------------- =head3 get_pkgVersion AIX only routine. Returns the installp image version from Installp command which, looks into the .toc file. Arguments: $installpPackage Returns: AIX installp image version as a string Globals: $::PLTFRM $::INSTALLPCMD Error: messageFromCat E2 Example: not used outside NodeUtils Comments: none =cut #-------------------------------------------------------------------------------- sub get_pkgVersion { my ($class, $pkg) = @_; my ($cmd, $output, $version); if ($::PLTFRM eq "Linux") { $version = ""; return (length($version) ? $version : undef); } elsif ($::PLTFRM eq "AIX") { $cmd = qq($::INSTALLPCMD -L -d . | grep $pkg 2>&1); $output = NodeUtils->runcmd($cmd); chomp($output); (undef, undef, $version, undef) = split(/:/, $output); return (length($version) ? $version : undef); } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E2', 'EMsgINVALID_OSTYPE'); } } #-------------------------------------------------------------------------------- =head3 getSetupKRB5 # Gets or sets up KRB5 for a Management Server Node. Arguments: none Returns: 1 on failure value of attribute on success Globals: none Error: none Example: my $krb5setup = NetworkUtils->getSetupKRB5(); Comments: none =cut #-------------------------------------------------------------------------------- sub getSetupKRB5 { # set local scope because we only want classes on the mgmt svr $ENV{'CT_MANAGEMENT_SCOPE'} = 1; # todo: remove when lsrsrc-api converts to above $ENV{'CT_SESSION_SCOPE'} = 1; if (NodeUtils->isMgmtSvr()) { #only defined on managment server my $outref = NodeUtils->runrmccmd('lsrsrc-api', "-i", "-s IBM.DmsCtrl::::SetupKRB5"); return $$outref[0]; } return 1; } #-------------------------------------------------------------------------------- =head3 listNodeAttrs Return attribute values for a given array of node names. Before calling this function, you can optionally call gatherNodeList() to build the array of node names from user input. You can also optionally call resolveAndUndup() separately, if you need access to the resolved list. Arguments: arrayref A reference to the array containing the list of nodes. If the list is empty and the WhereStr option is not specified, all the nodes in the ManagedNode class will be selected. attrs list of attributes that should be returned. Multiple attribute names can be separate by spaces and/or commas. opthashref A reference to a hash with the following options: WhereStr: A where string to use instead of a nodeList. IncludeAttrNames: set to 1 if you want the attribute name to precede each attribute value. SkipResolve: set to 1 if this function should not do name resolution on the list of nodes and remove duplicates. If you set this to 1, you must also pass in Res2Unres below. Res2Unres: reference to the hash returned by resolveAndUndup(). ResourceClass: resource class to get the node info from. Default is IBM.ManagedNode. Make sure the environment variable CT_MANAGEMENT_SCOPE is set appropriately for the class being used (for IBM.ManagedNode it should be 1). Returns: Returns a reference to an array in which each line will contain the attributes for 1 node, separated by :|: Also $::LISTNODEATTRS_NUMNOTFOUND will be set to the number of nodes that were specified, but not found. Globals: $::LISTNODEATTRS_NUMNOTFOUND will be set to the number of nodes specified Error: none Example: none Comments: none =cut #-------------------------------------------------------------------------------- sub listNodeAttrs { my ($class, $arrayref, $attrs, $opthashref) = @_; # Process the select argument if (length($attrs)) { $attrs =~ s/[, ]+/::/g; } # lsrsrc-api needs the attrs separated by :: else { $attrs = "'*b0x0020'"; } # this means return all public attributes # Set up where string my ($where, $whereattr, $ar2, $res2unres, $dontstripnameattr); if ($$opthashref{'ResourceClass'} eq 'IBM.Host') { $whereattr = 'NodeNameList'; } elsif ($$opthashref{'ResourceClass'} eq 'IBM.DeviceHwCtrl') { $whereattr = 'Name'; } my $numtobefound = 0; # 0 means we do not know, i.e. a where string if (defined($$opthashref{'WhereStr'})) { $where = NodeUtils->quote($$opthashref{'WhereStr'}); } elsif (defined($arrayref) && scalar(@$arrayref)) { if ($$opthashref{'SkipResolve'}) { $ar2 = $arrayref; if (!defined($$opthashref{'Res2Unres'})) { if (!$NodeUtils::NO_MESSAGES) { NodeUtils->messageFromCat($MSGCAT, $MSGMAPPATH, $MSGSET, 'W', 'EMsgNO_RES2UNRES'); } $NodeUtils::errno = 33; $res2unres = {}; } else { $res2unres = $$opthashref{'Res2Unres'}; } } else { ($ar2, $res2unres) = NodeUtils->resolveAndUndup($arrayref); } $where = NodeUtils->buildWhereInList($ar2, $whereattr); $numtobefound = scalar(@$ar2); $dontstripnameattr = $attrs =~ /(^|::)Name(::|$)/; if (!$dontstripnameattr) { $dontstripnameattr = $attrs =~ /\*(b|p)/; } if ($$opthashref{'ResourceClass'} eq 'IBM.Host') { $attrs = "NodeNameList::$attrs"; } else { $attrs = "Name::$attrs"; } # prepend the Name attr so we can tell which ones were found } else { $where = ''; } # this will pick up everything # Process other options and run lsrsrc-api cmd my $outputFormat = "-D ':|:'"; my $longFormat = 0; if ($$opthashref{'IncludeAttrNames'}) { $outputFormat .= ' -n'; $longFormat = 1; } my $resclass = $$opthashref{'ResourceClass'} || 'IBM.ManagedNode'; my $numfound = 0; my $outref = NodeUtils->runrmccmd( 'lsrsrc-api', "$outputFormat -i", "-s ${resclass}::${where}::$attrs" ); # runrmccmd will exit if the cmd fails $numfound = scalar(@$outref); my $somenotfound = ($numtobefound && $numfound < $numtobefound); # Strip the Name attr from the front and figure out which nodes were not found (if applicable) if ($numtobefound) { my $namefound = 0; #looking for Name attribute, #lsrsrc-api only returns 1 value per attribute, even if attribute apears more than once in the string. if($dontstripnameattr){ #locate the Name attribute in the string, so we can put it back in the right place my @vals = split /::/, $attrs; my $i =0; shift @vals; #Name is the first one foreach my $v (@vals){ if($v eq "Name"){ $namefound = $i; last; } $i++; } } foreach my $l (@$outref) { # Get the Name attribute and strip it from the beginning of the line my ($junk, $name, $rest); if ($longFormat) { ($junk, $name, $rest) = split(/:\|:/, $l, 3); } else { ($name, $rest) = split(/:\|:/, $l, 2); } if (!$dontstripnameattr) { $l = $rest; } #this strips the Name elsif(($namefound != 0) && (!$longFormat)){ #found the Name attribute my @values = split /:\|:/, $rest; splice @values, $namefound, 0, $name; $l = join ":|:", @values; } # Remove this node from the hash so we do not try to get it again if ($somenotfound) { delete $$res2unres{$name}; } } } if ($somenotfound) # some of the specified nodes were not found { # The only thing left in the hash are the nodes we did not find. Build # the array of unresolved node names and try those my @a; foreach my $k (keys %$res2unres) { if ($k ne "" && $k ne $$res2unres{$k}) { push @a, @{$$res2unres{$k}}; } } if (scalar(@a)) { $where = NodeUtils->buildWhereInList(\@a, $whereattr); $attrs =~ s/^Name:://; my $outref2 = NodeUtils->runrmccmd( 'lsrsrc-api', "$outputFormat -i", "-s ${resclass}::${where}::$attrs" ); $numfound += scalar(@$outref2); push @$outref, @$outref2; # append this to the 1st } $::LISTNODEATTRS_NUMNOTFOUND = $numtobefound - $numfound; } else # everything found { $::LISTNODEATTRS_NUMNOTFOUND = 0; } return $outref; } #-------------------------------------------------------------------------------- =head3 SetAllowRequest Make sure the management server can update the node information. Arguments: $ref_DestNodeHash $value Returns: 0 - All was successful 1 - An error occured. Error: $::NOK Example: # Turn on ability of a node to request itself managed. NodeUtils->SetAllowRequest(\%nodehash, '1'); Comments: Value should be set to 3 by installnode and by updatenode if the Mode is not managed. Otherwise it should be set to 2 by updatenode. During updatenode exit, it should be set to 0. =cut #-------------------------------------------------------------------------------- sub SetAllowRequest { my ($class, $ref_DestNodeHash, $value) = @_; my %DestNodeHash = %$ref_DestNodeHash; if (!$value) { $value = "0 "; } if (keys %DestNodeHash) { # DestNodeHash is a hash containing attribute values for # each node that was provided on the command line. my ($cmd, $rc); # check each node on our list and set the AllowManageRequest # attribute if needed. my @nodelist = (keys %DestNodeHash); my $nodelist_file = InstallUtils->make_node_list_file(\@nodelist); $cmd = "$::CHNODE -f $nodelist_file AllowManageRequest=$value"; $rc = system("$cmd"); if ($rc >> 8) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCMD_FAILED_RC', "$cmd", $rc ); } InstallUtils->close_delete_file($::NODE_LIST_FILE, $nodelist_file); return $::OK; } else { return 1; #a value and nodes must be specified. } } #-------------------------------------------------------------------------------- =head3 SetControlFlag Set the ControlFlag attribute. Currently, this is used to determine whether the node is allowed to write to the status log in /csminstall/csm/status/. Arguments: $ref_DestNodeHash $value Returns: $::OK 1 on error Error: 1 on error Example: # Turn on ability of a node to write to status file NodeUtils->SetControlFlag(\%nodehash, '1'); Comments: $value should be set to 1 by installnode, and then csmfirstboot will run an RMC action to set it back to 0 when the node install is complete and no more status messages need to be written to the MS. =cut #-------------------------------------------------------------------------------- sub SetControlFlag { my ($class, $ref_DestNodeHash, $value) = @_; my %DestNodeHash = %$ref_DestNodeHash; if (!$value) { $value = "0 "; } if (keys %DestNodeHash) { # DestNodeHash is a hash containing attribute values for # each node that was provided on the command line. my ($cmd, $rc); my @nodelist = (keys %DestNodeHash); my $nodelist_file = InstallUtils->make_node_list_file(\@nodelist); $cmd = "$::CHNODE -f $nodelist_file ControlFlag=$value"; $rc = system("$cmd"); if ($rc >> 8) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCMD_FAILED_RC', "$cmd", $rc ); } InstallUtils->close_delete_file($::NODE_LIST_FILE, $nodelist_file); return $::OK; } else { return 1; #a value and nodes must be specified. } } #-------------------------------------------------------------------------------- =head3 SetMode Set a node's Mode attribute to PreManaged, Installing or Managed. Arguments: $node, $mode Returns: Status code from chnode() Globals: $::CSMLITE Example: $rc = NodeUtils->SetMode($node, $mode);_ Comments: none =cut #-------------------------------------------------------------------------------- sub SetMode { my ($class, $node, $mode) = @_; my ($cmd, $rc, $fstatus); my $CSMLITE = $::CSMLITE; if ( ($mode ne "PreManaged") and ($mode ne "Installing") and ($mode ne "Managed") and ($mode ne $CSMLITE) and ($mode ne "${CSMLITE}-Installing")) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgINVALID_MODE', $mode, "PreManaged, Installing, Managed, $CSMLITE, ${CSMLITE}-Installing" ); } $cmd = "$::CHNODE $node Mode=$mode"; $rc = system($cmd) >> 8; if ($rc != 0) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCMD_FAILED_RC', $::CHNODE, $rc); $fstatus = $rc; } return $fstatus; } #-------------------------------------------------------------------------------- =head3 testvalidconsole Checks for the valid Console Method attributes. This subroutine compares the given Console method against the list in the /opt/csm/bin/*_console Console methods. Arguments: ConsoleMethod attribute value as a string Returns: 0 - valid console 1 - not a valid console 2 - error running ls on /opt/csm/bin Globals: none Error: 1 or 2 Example: $retCode = NodeUtils->testvalidconsole($::ATTRS{"ConsoleMethod"}); Comments: none =cut #-------------------------------------------------------------------------------- sub testvalidconsole { my ($class, $my_console) = @_; my @temp_console = (); @::valid_console = (); my $console = ""; my $tmp_console = ""; @temp_console = NodeUtils->runcmd("$::LS \/opt\/csm\/bin\/\*_console", -1); if ($::RUNCMD_RC != 0) { return 2; } foreach $tmp_console (@temp_console) { (undef, undef, undef, undef, $console) = split("/", $tmp_console); ($console, undef) = split("_", $console); push(@::valid_console, $console); } if (!grep(/^$my_console$/, @::valid_console)) { return 1; } else { return 0; } } #-------------------------------------------------------------------------------- =head3 testvalidpowermethod Checks for the valid Power Method attributes. Arguments: $powerMethod as a string Returns: 0 - valid power method 1 - not valid Globals: none Error: 1 Example: $retCode = NodeUtils->testvalidpowermethod($::ATTRS{"PowerMethod"}); Comments: This subroutine compares the given Power method against the one in the /opt/csm/lib/lib++_power.so. If this Method is not found then it checks against the value in /opt/csm/bin/*_power for a power command shipped with csm. If not found there then it checks against the value in /opt/local/*_power. =cut #-------------------------------------------------------------------------------- sub testvalidpowermethod { my ($class, $my_powermethod) = @_; my @temp_powermethod = (); @::valid_powermethod = (); my $powermethod = ""; my $tmp_powermethod = ""; my $exit_code = 0; @temp_powermethod = (); @temp_powermethod = NodeUtils->runcmd("$::LS \/opt\/csm\/lib\/\*_power\.so", -1); if ($::RUNCMD_RC != 0) { $exit_code = 2; } else { foreach $tmp_powermethod (@temp_powermethod) { if (-z $tmp_powermethod) { next; } $powermethod = basename($tmp_powermethod); $powermethod =~ s/^lib(.*)_power.*$/$1/; push(@::valid_powermethod, $powermethod); } if (!grep(/^$my_powermethod$/, @::valid_powermethod)) { $exit_code = 1; } else { $exit_code = 0; } } if (($exit_code == 1) || ($exit_code == 2)) { @temp_powermethod = (); @temp_powermethod = NodeUtils->runcmd("$::LS \/opt\/csm\/bin\/\*_power", -1); if ($::RUNCMD_RC != 0) { #$exit_code=2; } else { foreach $tmp_powermethod (@temp_powermethod) { if (-z $tmp_powermethod) { next; } $powermethod = basename($tmp_powermethod); $powermethod =~ s/(.*)_power.*$/$1/; push(@::valid_powermethod, $powermethod); } if (!grep(/^$my_powermethod$/, @::valid_powermethod)) { $exit_code = 1; } else { $exit_code = 0; } } } if (($exit_code == 1) || ($exit_code == 2)) { @temp_powermethod = (); @temp_powermethod = NodeUtils->runcmd("$::LS \/opt\/local\/\*_power", -1); if ($::RUNCMD_RC != 0) { #$exit_code=2; } else { foreach $tmp_powermethod (@temp_powermethod) { if (-z $tmp_powermethod) { next; } $powermethod = basename($tmp_powermethod); $powermethod =~ s/(.*)_power.*$/$1/; push(@::valid_powermethod, $powermethod); } if (!grep(/^$my_powermethod$/, @::valid_powermethod)) { $exit_code = 1; } else { $exit_code = 0; } } } return $exit_code; } #-------------------------------------------------------------------------------- =head3 verify_linux_attribute_definitions Linux only. Check if all the attributes are there, if not defined then get the default from Management Server. Does a fairly loose test of the values that the attributes have been assigned and will generate an error if it finds an incorrect value. Attributes tested are: . InstallOSName . InstallCSMVersion . InstallDistributionName . InstallDistributionVersion . InstallPkgArchetecture Arguments: none Returns: undef Globals: $::ATTRS $::PLTFRM @::VALID_DISTROS @::VALID_CSM_DISTROS @::DISTRO Error: Multiple E1 error messages Example: NodeUtils->verify_linux_attribute_definitions(); Comments: rewritten for defect 10100 =cut #-------------------------------------------------------------------------------- sub verify_linux_attribute_definitions { # Get defaults if the attributes aren't defined if (!($::ATTRS{'InstallOSName'})) { $::ATTRS{'InstallOSName'} = NodeUtils->get_OSName; } if (!($::ATTRS{'InstallCSMVersion'})) { $::ATTRS{'InstallCSMVersion'} = NodeUtils->get_CSMVersion("csm\.core"); } if (!($::ATTRS{'InstallDistributionName'})) { $::ATTRS{'InstallDistributionName'} = NodeUtils->get_DistributionName; } if (!($::ATTRS{'InstallDistributionVersion'})) { $::ATTRS{'InstallDistributionVersion'} = NodeUtils->get_DistributionVersion; } if (!($::ATTRS{'InstallPkgArchitecture'})) { $::ATTRS{'InstallPkgArchitecture'} = ArchiveUtils->get_PkgArchitecture; } # AIX is not supported - get it out of the routine. if (($::ATTRS{'InstallOSName'} eq "AIX") || ($::PLTFRM eq "AIX")) { MessageUtils->message('E', 'EMsgCopyingAIXpkgs'); exit 1; } # Test InstallOSName if ($::ATTRS{'InstallOSName'} ne "Linux") { MessageUtils->message("E2", 'EMsgINVALID_OSTYPE'); } # Test platform if ($::PLTFRM ne "Linux") { MessageUtils->message("E2", 'EMsgINVALID_OSTYPE'); } # Test InstallDistributionName / InstallDistributionVersion my $temp_distro = $::ATTRS{'InstallDistributionName'} . " " . $::ATTRS{'InstallDistributionVersion'}; if (!grep(/^$temp_distro$/, @::VALID_DISTROS)) { MessageUtils->message('W', 'EMsgUNSUPPORTED_DISTRO', $temp_distro, join(', ', @::VALID_DISTROS)); } else { $::DISTRO = $temp_distro; MessageUtils->message('V', 'IMsgDETECTED_DISTRO', $temp_distro); } # Test InstallPkgArchitecture if ($::ATTRS{'InstallPkgArchitecture'} =~ /i.86/) { $::ATTRS{'InstallPkgArchitecture'} = "i386"; } elsif ($::ATTRS{'InstallPkgArchitecture'} eq "ppc64") { # hip hip, hurrah! }elsif($::ATTRS{'InstallPkgArchitecture'} eq "x86_64"){ # hahehi }else { MessageUtils->message('E1', 'EMsgNoArch'); } # Test InstallCSMVersion if (length($::ATTRS{'InstallCSMVersion'}) == 0) { MessageUtils->message('E2', 'EMsgNO_CORE_COPY'); } if (!grep(/^$::ATTRS{'InstallCSMVersion'}$/, @::VALID_CSM_DISTROS)) { MessageUtils->message( 'E5', 'EMsgUNSUPPORTED_CSM_DISTRO', "CSM" . $::ATTRS{'InstallCSMVersion'}, join(', ', @::VALID_CSM_DISTROS) ); } else { MessageUtils->message( 'V', 'IMsgDETECTED_CSM_DISTRO', "CSM" . $::ATTRS{'InstallCSMVersion'} ); } } #-------------------------------------------------------------------------------- =head2 Messaging The NodeUtils messageing subroutines have been moved to their own package: MessageUtils.pm Please do not add messaging subroutines to NodeUtils. =cut #-------------------------------------------------------------------------------- =head3 getMessage MessageUtils->getMessage =cut sub getMessage { shift; return MessageUtils->getMessage(@_); } #-------------------------------------------------------------------------------- =head3 getMessageFromCat MessageUtils->getMessageFromCat =cut sub getMessageFromCat { shift; return MessageUtils->getMessageFromCat(@_); } #-------------------------------------------------------------------------------- =head3 getmsg MessageUtils->getmsg =cut sub getmsg { shift; return MessageUtils->getmsg(@_); } #-------------------------------------------------------------------------------- =head3 getmsgmap MessageUtils->getmsgmap =cut sub getmsgmap { shift; return MessageUtils->getmsgmap(@_); } #-------------------------------------------------------------------------------- =head3 msg MessageUtils->msg =cut sub msg { shift; return MessageUtils->msg(@_); } #-------------------------------------------------------------------------------- =head3 message MessageUtils->message =cut sub message { shift; return MessageUtils->message(@_); } #-------------------------------------------------------------------------------- =head3 messageFromCat MessageUtils->messageFromCat =cut sub messageFromCat { shift; return MessageUtils->messageFromCat(@_); } #-------------------------------------------------------------------------------- =head3 processNewlines MessageUtils->processNewlines =cut sub processNewlines { shift; return MessageUtils->processNewlines(@_); } #-------------------------------------------------------------------------------- =head3 substituteValues MessageUtils->substituteValues =cut sub substituteValues { shift; return MessageUtils->substituteValues(@_); } #-------------------------------------------------------------------------------- =head3 useTranslatedMsg MessageUtils->useTranslatedMsg =cut sub useTranslatedMsg { shift; return MessageUtils->useTranslatedMsg(@_); } #-------------------------------------------------------------------------------- =head2 Run Command Tools =head3 filterRmcApiOutput filter RMC Api Output Arguments: RMC command Output reference Returns: none Globals: none Error: none Example: NodeUtils->filterRmcApiOutput($cmd, $outref); Comments: The error msgs from the RPM -api cmds are pretty messy. This routine cleans them up a little bit. =cut #-------------------------------------------------------------------------------- sub filterRmcApiOutput { my ($class, $cmd, $outref) = @_; if ($::VERBOSE || !($cmd =~ m|^/usr/bin/\S+-api |)) { return; } # give as much info as possible, if verbose # Figure out the output delimiter my ($d) = $cmd =~ / -D\s+(\S+)/; if (length($d)) { $d =~ s/^(\'|\")(.*)(\"|\')$/$2/; # remove any surrounding quotes $d =~ s/([\|\^\*\+\?\.])/\\$1/g ; # escape any chars perl pattern matching would intepret as special chars } else { $d = '::'; } # this is the default output delimiter for the -api cmds #$$outref[0] =~ s/^ERROR:\|:.*:\|:.*:\|:.*:\|:.*:\|://; #print "d=$d.\n"; $$outref[0] =~ s/^ERROR${d}.*${d}.*${d}.*${d}.*${d}//; } #-------------------------------------------------------------------------------- =head3 runcmd Run the given cmd and return the output in an array (already chopped). Alternatively, if this function is used in a scalar context, the output is joined into a single string with the newlines separating the lines. Arguments: command, exitcode and reference to output Returns: see below Globals: $::RUNCMD_RC Error: Normally, if there is an error running the cmd, it will display the error msg and exit with the cmds exit code, unless exitcode is given one of the following values: 0: display error msg, DO NOT exit on error, but set $::RUNCMD_RC to the exit code. -1: DO NOT display error msg and DO NOT exit on error, but set $::RUNCMD_RC to the exit code. -2: DO the default behavior (display error msg and exit with cmds exit code. number > 0: Display error msg and exit with the given code Example: my $outref = NodeUtils->runcmd($cmd, -2, 1); Comments: If refoutput is true, then the output will be returned as a reference to an array for efficiency. =cut #-------------------------------------------------------------------------------- sub runcmd { my ($class, $cmd, $exitcode, $refoutput) = @_; $::RUNCMD_RC = 0; if (!($cmd =~ /2>&1$/)) { $cmd .= ' 2>&1'; } if (!$NodeUtils::NO_MESSAGES) { NodeUtils->messageFromCat($MSGCAT, $MSGMAPPATH, $MSGSET, 'V', 'IMsgCMD', $cmd); } my $outref = []; @$outref = `$cmd`; if ($?) { $::RUNCMD_RC = $? >> 8; my $displayerror = 1; my $rc; if (defined($exitcode) && length($exitcode) && $exitcode != -2) { if ($exitcode > 0) { $rc = $exitcode; } # if not zero, exit with specified code elsif ($exitcode <= 0) { $rc = ''; # if zero or negative, do not exit if ($exitcode < 0) { $displayerror = 0; } } } else { $rc = $::RUNCMD_RC; } # if exitcode not specified, use cmd exit code #print "rc=$rc\n"; if ($displayerror) { my $errmsg = ''; if (NodeUtils->isLinux() && $::RUNCMD_RC == 139) { $errmsg = "Segmentation fault $errmsg"; } else { NodeUtils->filterRmcApiOutput($cmd, $outref) ; # The error msgs from the -api cmds are pretty messy. Clean them up a little. $errmsg = join('', @$outref); chomp $errmsg; } if (!$NodeUtils::NO_MESSAGES) { NodeUtils->messageFromCat($MSGCAT, $MSGMAPPATH, $MSGSET, "E$rc", 'EMsgCMD_FAILED', $::RUNCMD_RC, $cmd, $errmsg); } $NodeUtils::errno = 29; } #return undef; # if rc was set msg() will exit, otherwise return output } if ($refoutput) { chomp(@$outref); return $outref; } elsif (wantarray) { chomp(@$outref); return @$outref; } else { my $line = join('', @$outref); chomp $line; return $line; } } #-------------------------------------------------------------------------------- =head3 run_cmd Run a system command Arguments: The first argument is a string containing the command to run. The second argument is the type of message that should be printed. Valid values for msgtype are: E, W, I, etc. (same as the msg routine) If msgtype is "E" (the default), the command exits the program with the return code of the command. The third argument specifies how the command will run. Returns: Return code from the shell executing the commmand. Globals: none Error: If msgtype is "E" (the default), the command exits the program with the return code of the command. If runtype is "show_errors" or not specified, stdout will be captured and displayed in a message as specified by msgtype. If runtype is "show_all", all output will go be sent to stdout or wherever the command sends it. Any errors will be displayed as a message as specified by msgtype. If runtype is "ignore_errors", all output will go be sent to the screen or wherever the command sends it. Any errors will be ignored. Example: NodeUtils->run_cmd($cmd, "W", "ignore_errors"); Comments: none =cut #-------------------------------------------------------------------------------- sub run_cmd { my ($class, $cmd, $msgtype, $runtype) = @_; my ($rc, @cmdout, $msgtypestr); $msgtype = "E" if (!$msgtype); $runtype = "show_errors" if (!$runtype); NodeUtils->message('V', 'IMsgCMD', $cmd); if ($runtype eq "show_all") { $rc = system("$cmd") >> 8; if ($rc) { # Only exit with a return code if msgtype = "E" (Error) $msgtypestr = $msgtype; $msgtypestr = "$msgtype$rc" if ($msgtype eq "E"); NodeUtils->message("$msgtypestr", 'EMsgCMD_FAILED_RC', $cmd, $rc); } } elsif ($runtype eq "show_errors") { @cmdout = `$cmd 2>&1`; chomp(@cmdout); # take the newline off $rc = $? >> 8; if ($rc) { # Only exit with a return code if msgtype = "E" (Error) $msgtypestr = $msgtype; $msgtypestr = "$msgtype$rc" if ($msgtype eq "E"); NodeUtils->message("$msgtypestr", 'EMsgCMD_FAILED', $cmd, join('', @cmdout)); } } elsif ($runtype eq "ignore_errors") { $rc = system("$cmd") >> 8; } else { NodeUtils->message('E1', 'EMsgRUN_CMD_INVALID', $runtype); } return $rc; } #-------------------------------------------------------------------------------- =head3 runrmccmd Runs an RMC commmand Arguments: $rmccmd, $resclass, $options, $select Returns: the output from NodeUtils->runcmd($cmd, -2, 1) as a ref to the output array. Globals: none Error: none Example: my $outref = NodeUtils->runrmccmd('lsrsrc-api', "-i -D ':|:'", $where); Comments: none =cut #-------------------------------------------------------------------------------- sub runrmccmd { #my ($class, $rmccmd, $resclass, $options, $select) = @_; my ($class, $rmccmd, $options, $select) = @_; my $cmd = "/usr/bin/$rmccmd $options $select"; return NodeUtils->runcmd($cmd, -2, 1) ; # returns a reference to the output array } #-------------------------------------------------------------------------------- =head2 Node & Group Support =cut #-------------------------------------------------------------------------------- =head3 add_cluster_nl Get hosts currently in CSM and adds to the node list. Routine uses $main::lsnodes_opt as the flag to lsnodes command. This description doesn't make much sense. Maybe someone will rewrite it. Arguments: none Returns: none Globals: $main::lsnodes_opt Error: Prints to STDERR. Example: not used Comments: not used?? =cut #-------------------------------------------------------------------------------- sub add_cluster_nl { my ($hostname, @hostnames); my $optcsmdir = "/opt/csm/bin"; if (!-x "$optcsmdir/lsnode") { print STDERR "Cluster System Management (csm.server) lsnode command not installed\n"; exit(-1); } # get the long hostname from CSM lsnode chop(@hostnames = `$optcsmdir/lsnode $::lsnodes_opt 2>/dev/null`); # user specified -a and lsnode failed then exit if ($? != 0) { print STDERR "Cluster System Management lsnodes command error\n"; exit(-1); } foreach $hostname (@hostnames) { NodeUtils->add_nl($hostname); } } #-------------------------------------------------------------------------------- =head3 add_nl Add a host to the node list. Don't add a hostname if it is already there or if the is contained in another name which resolves to the same host. Arguments: hostName Returns: none Globals: @main::nl; Error: Prints to STDERR. Example: none Comments: none =cut #----------------------------------------------------------------------------- sub add_nl { shift; # get rid of the class my $host = shift; my ($hostname, @hostnames); my ($newname, $name, $aliases, $addtype, $length, @addrs); $host =~ s/\s//g; # Now loop through hosts and return if the host is found foreach $hostname (@::nl) { # before adding- check to see if either hostnames are a shortname # for the same host if ($hostname =~ /^$host.*/ | $host =~ /^$hostname.*/) { # resolve hostname of new host to be added to list ($name, $aliases, $addtype, $length, @addrs) = gethostbyname($host); unless ($name) { print STDERR "Could not resolve hostname $host\n"; return (1); } $newname = $name; # resolve hostname of existing node list host ($name, $aliases, $addtype, $length, @addrs) = gethostbyname($hostname); unless ($name) { print STDERR "Could not resolve hostname $host\n"; return (1); } # If both names resolve to the same hostname, then do not add the host if ($name eq $newname) { return; } } } # Did not already have this host - add it to node list @::nl push(@::nl, $host); } #-------------------------------------------------------------------------------- =head3 buildWhereInList Build a "where" list Arguments: reference to an array of nodeNames array of where attributes Returns: where list Globals: none Error: none Example: $where = NodeUtils->buildWhereInList($ar2, $whereattr); Comments: none =cut #-------------------------------------------------------------------------------- sub buildWhereInList { my ($class, $arrayref, $attrname) = @_; if (!defined($attrname) || !length($attrname)) { $attrname = 'Hostname'; } #todo: handle long cmd line my @newarray; foreach my $string (@$arrayref){ my @vals = split ',| ', $string; push @newarray, @vals; } my $where = qq/"$attrname IN ('/ . join("','", @newarray) . q/')"/; #my $comma = ''; #foreach my $a (@$arrayref) # { # my $hostname = NodeUtils->tryHost($a); # $where .= "$comma'$hostname'"; # $comma = ','; # } #$where .= ')'; return $where; } #-------------------------------------------------------------------------------- =head3 check_duplicate_nodes Make sure the nodes in @::Nodes are not already defined as CSM Nodes. Arguments: none Returns: 0 - no duplicate nodes 2 - duplicate nodes found Globals: none Error: returns 2 on error Example: my $retCode = NodeUtils->check_duplicate_nodes; Comments: none =cut #-------------------------------------------------------------------------------- sub check_duplicate_nodes { my ($returncode) = 0; my ($n, $m, $p); my ($duplicate_ManagedNodes); for $n (0 .. $#::Nodes) { for $m (0 .. $#::ManagedNodes) { if ($::Nodes[$n]{"hostname"} eq $::ManagedNodes[$m]{"Hostname"}) { $duplicate_ManagedNodes .= $::ManagedNodes[$m]{"Hostname"} . " "; } } } if ($duplicate_ManagedNodes) { NodeUtils->message('E', 'EMsgALREADY_DEFINED_MANAGEDNODES', $duplicate_ManagedNodes); $returncode = 2; } return ($returncode); } #-------------------------------------------------------------------------------- =head3 expandExclusionRange Expand exclusion ranges that start with a minus. Arguments: $nodeList $list of expended group nodes Returns: array of nodeNames Globals: none Error: none Example: _ if ($node =~ /^-/) { push @nodes, NodeUtils->expandExclusionRange($node, $groupExpansion); } Comments: none =cut #-------------------------------------------------------------------------------- sub expandExclusionRange { my ($class, $node, $groupExpansion) = @_; #my (@groups, @nodes); $node =~ s/^-//; # get rid of the leading minus my @nodes = NodeUtils->expandRanges($groupExpansion, $node); # Prepend a minus on each name. These names will be excluded later. foreach my $n (@nodes) { $n =~ s/^/-/; } return @nodes; } #-------------------------------------------------------------------------------- =head3 expandGroupRange Expand group ranges such as: g or g1-g3 or 1-3 or g1+2 Arguments: Expand range values over a group. Returns: array of expended goup ranges. Globals: none Error: none Example: if ($node =~ /^-/) { push @nodes, NodeUtils->expandGroupRange($node, $groupExpansion); } Comments: none =cut #-------------------------------------------------------------------------------- sub expandGroupRange { my ($class, $group, $groupExpansion) = @_; my (@groups, @nodes); # First expand into multiple groups if it is a range $group =~ s/^\+//; @groups = NodeUtils->expandNodeRange($group); if ($groupExpansion) { # Now get memberlist for each group $NODEGROUPEXPMEM_WARNING = 0; my $outref = NodeUtils->listNodeGroupExpMem(@groups); $NODEGROUPEXPMEM_WARNING = 1; # If the name did not match a group, then assume it is a hostname if (scalar(@groups) == 1 && scalar(@$outref) == 0) { return "+$groups[0]"; } foreach my $row (@$outref) { my ($name, $nodelist) = $row =~ /^(.+):\|:\{(.*)\}$/; #push @nodes, NodeUtils->expandRanges(split(/,/, $nodelist)); push @nodes, split(/,/, $nodelist); } return @nodes; } else # do not expand groups { # Put the plus sign back on the group names foreach my $g (@groups) { $g =~ s/^/\+/; } return @groups; } } #-------------------------------------------------------------------------------- =head3 expandNodeRange Expand node ranges such as : n1-n3 or 1-3 or n1+2 or 2 or n1.ibm.com-n3.ibm.com or n1.ibm.com+2. Arguments: node range string Returns: array of nodeNames representing the expansion Globals: none Error: none Example: @groups = NodeUtils->expandNodeRange($group); Comments: none =cut #-------------------------------------------------------------------------------- sub expandNodeRange { my ($class, $node) = @_; my (@nodes, $fRoot, $fDomain, $fNum, $eRoot, $eNum, $eDomain); if ($node =~ /-/) # a range { my ($front, $end) = split('-', $node, 2); # Get the roots of the front part of the range and the end. # If there is any problem in the form, assume it is not a range ($fRoot, $fNum, $fDomain) = $front =~ /^(.*?)(\d+)(\..+)?$/; ($eRoot, $eNum, $eDomain) = $end =~ /^(.*?)(\d+)(\..+)?$/; #print "fRoot=$fRoot, fNum=$fNum, eRoot=$eRoot, eNum=$eNum\n"; if ( !defined($fNum) || !defined($eNum) || $fNum >= $eNum || $eRoot ne $fRoot || $eDomain ne $fDomain) { return $node; } } elsif ($node =~ /\+/) # a base node name plus an increment { my ($front, $increment) = split(/\+/, $node, 2); ($fRoot, $fNum, $fDomain) = $front =~ /^(.*?)(\d+)(\..+)?$/; if (!defined($fNum) || !($increment =~ /^\d+$/)) { return $node; } if ($ENV{CSM_XCAT_COMPAT} == 1) { $eNum = $fNum + $increment - 1; } else { $eNum = $fNum + $increment; } } elsif ($node =~ /^\d+$/) # an all numeric node name { return $ENV{CSM_NODE_PREFIX} . $node; } else { return $node; } # no range syntax at all # Handle 5-8 and 5+8 cases if (!length($fRoot) && !length($fDomain)) { $fRoot = $ENV{CSM_NODE_PREFIX}; if (!defined($fRoot)) { return $node; } } my $prefix; foreach my $suffix ($fNum .. $eNum) { my $numOfZeros = (length($fNum) - length($suffix)); my $prefix = '0' x $numOfZeros; push @nodes, "$fRoot$prefix$suffix$fDomain"; } return @nodes; } #-------------------------------------------------------------------------------- =head3 expandRanges Expands node and group entries if they use any of the node range syntax. EXAMPLES: node01-node05: node01, node02, node03, node04, node05 n8-n11: n8, n9, n10, n11 frame2n5-frame2n7: frame2n5, frame2n6, frame2n7 15-20: n15, n16, n17, n18, n19, n20 (assuming CSM_NODE_PREFIX is set to n) n8+3: n8, n9, n10 8+3: n8, n9, n10 8: n8 +g1: n1, n2, n3 (assuming g1 was a group containing n1, n2, n3) -n2: exclude n2 -n2-n4: exclude n2, n3, n4 -+g1: exclude the members of g1 SOME ADDITIONAL RULES: - no spaces in the entry - the roots of the 1st and last node names must match - a name that starts with plus, but is not a valid group will be interpreted as a node name (including the plus) - If the right format is not found, it just returns the whole entry as a node name. This means that most hostnames with dashes in them will still be treated as a regular hostname. DIFFERENCES FROM XCAT NODE RANGES: - do not support non-numeric ranges based on definition order of nodes - file input with -f - regular expressions via dynamic nodegroups - suffix not supported in node ranges - groups specified with + operator or with -N - ranges not supported with hostnames that have dashes in them - n1+2 means n1,n2,n3 unless CSM_XCAT_COMPAT is 1, then n1+2 means n1,n2 ENVIRONEMENT VARIABLES: CSM_NO_NODERANGES - disable expansion of node ranges CSM_NODE_PREFIX - text to prepend to ranges like 1-5 CSM_XCAT_COMPAT - if set to 1, then n1+2 means n1,n2 =cut #-------------------------------------------------------------------------------- sub expandRanges { shift; # get rid of class name my $groupExpansion = shift; # The rest of @_ are the node names if (!defined($NO_NODERANGES)) { $NO_NODERANGES = defined($ENV{CSM_NO_NODERANGES}); } if ($NO_NODERANGES) { return @_; } my @nodes; foreach my $node (@_) { if ($node =~ /^-/) { push @nodes, NodeUtils->expandExclusionRange($node, $groupExpansion); } elsif ($node =~ /^\+/) { push @nodes, NodeUtils->expandGroupRange($node, $groupExpansion); } elsif ($node =~ /-|\+/ || $node =~ /^\d+$/) { push @nodes, NodeUtils->expandNodeRange($node); } else { push @nodes, $node; } } return @nodes; } #-------------------------------------------------------------------------------- =head3 gatherNodeList Processes all the ways a user can specify nodes to our commands and creates an array with the whole list. The list is checked for duplicates. A reference to the array is returned. This function will process -n, -N, and -f. If nodes can be passed in as positional args, pass a reference to ARGV (\@ARGV) into this function. Arguments: arrayref - reference to ARGV (\@ARGV). NOTE: If you are going to pass an opthashref, you need to also pass an arrayref before it (the arrayref can reference an empty array - use []). opthashref - a optional reference to a hash with the following keys: NodeFile - 1 or name of file containing node list. If 1, it will not look in a file at all. If undefined, this function will look in the file specified by $::opt_f. NodeGrp - string containing node groups separated by commas or spaces. If undefined, it will look in $::opt_N. Returns: reference to an array of nodeNames. Globals: opt_ globals Error: $NodeUtils::errno = 30; Example: my $refnodes = NodeUtils->gatherNodeList(\@nodelist, \%opthashref); Comments: none =cut #-------------------------------------------------------------------------------- sub gatherNodeList { my ($class, $arrayref, $opthashref) = @_; my $nodes = []; # create a reference to an array if (defined($arrayref)) { foreach my $e (@$arrayref) { push @$nodes, NodeUtils->expandRanges(1, split(/[, ]+/, $e)); } } if (defined($::opt_n)) { push @$nodes, NodeUtils->expandRanges(1, split(/[, ]+/, $::opt_n)); } my $groups = $$opthashref{'NodeGrp'} ? $$opthashref{'NodeGrp'} : $::opt_N; if (defined($groups)) # they specified node groups { my $outref = NodeUtils->listNodeGroupExpMem(split(/[, ]+/, $groups)); foreach my $row (@$outref) { my ($name, $nodelist) = $row =~ /^(.+):\|:\{(.*)\}$/; # push @$nodes, NodeUtils->expandRanges(split(/,/, $nodelist)); push @$nodes, split(/,/, $nodelist); } } if (!defined($$opthashref{'NodeFile'}) || $$opthashref{'NodeFile'} ne "1") { my $file = $$opthashref{'NodeFile'} ? $$opthashref{'NodeFile'} : $::opt_f; if (defined($file)) # read the node list from the file { if (open(NODELIST, $file)) { while () { chomp($_); push @$nodes, NodeUtils->expandRanges(1, split(/[, ]+/, $_)); } close(NODELIST); } else { if (!$NodeUtils::NO_MESSAGES) { NodeUtils->messageFromCat($MSGCAT, $MSGMAPPATH, $MSGSET, 'E', 'EMsgNODELIST_FILE', $file, "$!"); } $NodeUtils::errno = 30; } } } return $nodes; } #-------------------------------------------------------------------------------- =head3 generate_node_range Generate the list of nodes to define. If the starting IP address (or hostname) and the count are provided, generate all the IP addresses from the starting IP address up to the correct ending number. Arguments: none Returns: @Nodes - an arrary of nodenames Globals: @::ClusterOptions @$::nodelist Error: E2 message if no nodes are available from @$::nodelist Example: NodeUtils->generate_node_range; Comments: might be good to give more info on the globals =cut #-------------------------------------------------------------------------------- sub generate_node_range { my (@Nodes); my $i = 0; my ($node, $hostname, $ipaddr, $shorthost); # Generate a range of IP addresses based on the starting_nodename # and the node_count if ( $::ClusterOptions{"starting_nodename"} and $::ClusterOptions{"node_count"}) { # Set the first node to the starting nodename $node = $::ClusterOptions{"starting_nodename"}; # Increment the IP Address up to the number in node_count while ($i < $::ClusterOptions{"node_count"}) { # Get the IP Address and hostname for the node. # getHost can accept either an IP address or a hostname as its # input parameter. ($hostname, $ipaddr) = NodeUtils->getHost($node); ($shorthost = $hostname) =~ s/\..*$//; $Nodes[$i]{"name"} = $shorthost; $Nodes[$i]{"shorthost"} = $shorthost; $Nodes[$i]{"hostname"} = $hostname; $Nodes[$i]{"ipaddr"} = $ipaddr; $node = InstallUtils->inc_ip($ipaddr); # Get the next IP Address $i++; } } elsif (@$::nodelist) { $i = 0; foreach my $node (@$::nodelist) { ($hostname, $ipaddr) = NodeUtils->getHost($node); ($shorthost = $hostname) =~ s/\..*$//; $Nodes[$i]{"name"} = $shorthost; $Nodes[$i]{"shorthost"} = $shorthost; $Nodes[$i]{"hostname"} = $hostname; $Nodes[$i]{"ipaddr"} = $ipaddr; $i++; } } else { #die "No nodes provided!\n"; NodeUtils->message('E2', 'EMsgNoNodesProvided'); } if ($::VERBOSE) { NodeUtils->message('V', 'IMsgNEW_NODES_TO_DEFINE'); for $i (0 .. $#Nodes) { NodeUtils->message('I', 'IMsgShow_Output', $Nodes[$i]{"hostname"}); } } return @Nodes; } #-------------------------------------------------------------------------------- =head3 get_target_nodes Get a list of target nodes from the command line Arguments: (\@ARGV) either from @ARGV $::opt_n ($node group string) $::opt_N $file containing node list 1 -- skips the check for not found nodes Returns: \@DestNode = reference to list of all target nodes \@lsnode_info = reference to a list of results from lsnode command (only for the nodes in @DestNode) \%DestNodeHash = reference to a hash of hostnames and attributes (foreach node in @Destnode): $DestNodeHash{$hostname}{$attribute_name} = "attribute value" For the list of attributes see $lsnode_attr Globals: $::ALL - Distribute to all nodes $::MANAGED - Distribute to all nodes where Mode="Managed" $::PRE_MANAGED - Distribute to all nodes where Mode="PreManaged" Error: None documented Example my ($ref_DestNode, $ref_lsnode_info, $ref_DestNodeHash) = NodeUtils->get_target_nodes(\@ARGV, $::NODE_GRPS, $::FILE); Comments: Common method for getting node list from command line. =cut #-------------------------------------------------------------------------------- sub get_target_nodes { my ($class, $ref_nodelist, $nodegrp_list, $file, $skipNFcheck) = @_; my @nodelist = @$ref_nodelist; my ( @DestNode, @DestGroup, %DestKeyTemp, %all_groups, @lsnode_info, @empty_array ); my @real_nodelist; #split the nodes if there are commas foreach my $n (@nodelist) { if ($n =~ m/,/) { my @tmp = split ',', $n; foreach my $t (@tmp) { push @real_nodelist, $t; } } else { push @real_nodelist, $n; } } @nodelist = @real_nodelist; undef @real_nodelist; my $lsnode_attr = "Hostname,ManagementServer,InstallOSName,InstallCSMVersion,InstallDistributionVersion,InstallDistributionName,InstallPkgArchitecture,Mode,InstallAdapterMacaddr,InstallAdapterName,InstallAdapterType,InstallAdapterDuplex,InstallAdapterSpeed,InstallMethod,ConsoleSerialDevice,Status,InstallServer,InstallTemplate,PowerMethod,InstallDiskType,InstallDisk,PowerStatus,ConsoleSerialSpeed,InstallAdapterGateway"; # These delimeters are used with the lsnode command. A simple colon (:) # cannot be used since there are colons in InstallAdapterMacaddr. #my $delim = ':|:'; # Used on the lsnode command my $check_delim = ':\|:'; # Used when splitting the line apart if ($::ALL || $::MANAGED || $::PRE_MANAGED) { #distribute to all nodes of a certain set my $select_string; if ($::MANAGED) { $select_string = "Mode=\"Managed\""; } elsif ($::PRE_MANAGED) { $select_string = "Mode=\"PreManaged\""; } else { #just managednodes $select_string = ""; } my %opthash = (WhereStr => $select_string); my $ref_lsnode_info = NodeUtils->listNodeAttrs(\@empty_array, $lsnode_attr, \%opthash); @lsnode_info = @$ref_lsnode_info; foreach my $line (@lsnode_info) { chomp $line; my $hostname = (split /$check_delim/, $line)[0]; push @DestNode, $hostname; } } else { #we are not distributing to all nodes of a certain mode my %opthashref = (); if ($file) { %opthashref = (NodeFile => $file, NodeGrp => $nodegrp_list); } else { %opthashref = (NodeFile => 1, NodeGrp => $nodegrp_list); } my $refnodes = NodeUtils->gatherNodeList(\@nodelist, \%opthashref); if (scalar @$refnodes) { my $ref_lsnode_info = NodeUtils->listNodeAttrs($refnodes, $lsnode_attr); @lsnode_info = @$ref_lsnode_info; if (!$skipNFcheck) { InstallUtils->checkForNotFound($refnodes); } } else { @lsnode_info = (); } } my %DestNodeHash; foreach my $line (@lsnode_info) { #this only has node names in it from the cluster my @attributes = split /$check_delim/, $line; my $hostname = $attributes[0]; chomp $line; my @attr_names = split ',', $lsnode_attr; my $index = 0; foreach my $attr (@attr_names) { $DestNodeHash{$hostname}{$attr} = $attributes[$index]; $index++; } } if (@::VALID_INSTALLMETHODS) { my %meths; foreach my $method (@::VALID_INSTALLMETHODS) { $meths{$method} = 1; } my @methString = keys %meths; foreach my $target (keys %DestNodeHash) { if (!$meths{$DestNodeHash{$target}{'InstallMethod'}}) { if (!($::ALL || $::MANAGED || $::PRE_MANAGED)) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgINVALID_INSTALL_METH', $target, "@methString"); } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'W', 'EMsgINVALID_INSTALL_METH', $target, "@methString"); delete $DestNodeHash{$target}; } } } } my @tmpDestNode = keys %DestNodeHash; my @return_array = (\@tmpDestNode, \@lsnode_info, \%DestNodeHash); return @return_array; } #-------------------------------------------------------------------------------- =head3 listNodeGroupExpMem Return the expanded member list for each of the node group names passed in. Arguments: One or more node groups as parameters Returns: reference to an array: Each element of the array represents one (1) row and has the format: nodegroupname:|:{node1,node2,node3} Globals: none Error: none Example: my $outref = NodeUtils->listNodeGroupExpMem(@groups); Comments: none =cut #-------------------------------------------------------------------------------- sub listNodeGroupExpMem { shift; # get rid of the class arg - the rest of @_ are the group names my $where = ''; if (scalar(@_)) { # We do it this way instead of putting all the groups in one IN expression because # this way guarantees they will come back in the same order specified. foreach my $g (@_) { $where .= qq( -s IBM.NodeGroup::"Name='$g'"::Name::ExpMemberList); } } else { $where = '-s IBM.NodeGroup::::Name::ExpMemberList'; } # Get the data my $outref = NodeUtils->runrmccmd('lsrsrc-api', "-i -D ':|:'", $where); if ($::RUNCMD_RC) { $outref = []; } if (scalar(@_) && scalar(@$outref) < scalar(@_) && $NODEGROUPEXPMEM_WARNING) { if (scalar(@_) == 1) { if (!$NodeUtils::NO_MESSAGES) { NodeUtils->messageFromCat($MSGCAT, $MSGMAPPATH, $MSGSET, 'W', 'EMsgGROUP_NOT_FOUND', $_[0]); } $NodeUtils::errno = 31; } else { if (!$NodeUtils::NO_MESSAGES) { NodeUtils->messageFromCat($MSGCAT, $MSGMAPPATH, $MSGSET, 'W', 'EMsgSOME_GROUPS_NOT_FOUND', join(',', @_)); } $NodeUtils::errno = 32; } } return $outref; } #-------------------------------------------------------------------------------- =head3 resolveAndUndup Take the reference to an array of node names and resolve each name to its primary hostname and then eliminate duplicates in the list. Returns a reference to a new array. This function is separate from gatherNodeList because it is rather expensive to do all the name resolutions, so this should only be called when necessary. For example, if you are going to pass the node list to lsnode, lsnode will do this for you, so you do not need to call this. Arguments: reference to an array of nodeNames. Returns: Returns a reference to processed array. This function can also return a reference to a hash mapping each resolved name back to its original name. Globals: none Error: none Example: _ Comments: This function also processes exclusions (node names that start with minus), unless the CSM_NO_NODERANGES env var is set. =cut #-------------------------------------------------------------------------------- sub resolveAndUndup { my ($class, $arrayref) = @_; if (!$NodeUtils::NO_MESSAGES) { NodeUtils->messageFromCat($MSGCAT, $MSGMAPPATH, $MSGSET, 'V', 'IMsgRESOLVING'); } my $hash = {}; my $exclude = {}; #my @ar1; my $ar2 = []; if (!defined($NO_NODERANGES)) { $NO_NODERANGES = defined($ENV{CSM_NO_NODERANGES}); } # Go through the list once to find all the exlusions if (!$NO_NODERANGES) { foreach my $node (@$arrayref) { if ($node =~ /^-/) { my $n2 = substr($node, 1); my $hostname = NodeUtils->tryHost($n2); $$exclude{$hostname}++; } } } my $numnodes = scalar @$arrayref; if ($numnodes > 15) { #if there are more than 15 nodes NodeUtils->cacheEtcHosts(); #cache /etc/hosts if used } # Now go through the list a 2nd time foreach my $node (@$arrayref) { if (!$NO_NODERANGES && $node =~ /^-/) { next; } # we already put the exclusions in the exclude hash my $resolved; my $hostname = NodeUtils->tryHost($node, \$resolved); if (!defined($$exclude{$hostname})) { if (!$resolved) # Hosts that are not resolved successfully # are placed under an empty key { $hostname = ""; push @$ar2, $node; } if (!defined($$hash{$hostname})) { $$hash{$hostname} = [$node]; if ($resolved) { push @$ar2, $hostname; } } else { push(@{$$hash{$hostname}}, $node); # record duplicates } } } if (wantarray) { return ($ar2, $hash, $exclude); } else { return $ar2; } } #-------------------------------------------------------------------------------- =head3 subtractOrIntersect Does @$g1-@$g2 and returns the resulting array. The arrays passed in and the array returned are all references. If $intersect is 1, then it finds the intersection of @$g1 and @$g2 instead. g1 and g2 are groups of nodeNames. Arguments: $ref_group1 $ref_group2 $bool_intersect. Returns: ref_array - result of subtraction or intersection. Globals: none Error: none Example: not used Comments: not used ?? =cut #-------------------------------------------------------------------------------- sub subtractOrIntersect { my ($class, $g1, $g2, $intersect) = @_; if ($intersect) { $intersect = 1; } # we need it exactly 0 or 1 else { $intersect = 0; } # make a hash out of g2 my %g2hash; @g2hash{@$g2} = (1) x scalar(@$g2); #foreach (@$g2) { $g2hash{$_}++; } # go through @g1 and only copy elements to the returned array that are not in # %g2hash my $out = []; # this cryptic line says: if the element of g1 is not in g2 and we are # doing a subtraction, then add it to the out arrary. Or if the element # of g1 is in g2 and we are doing the intersection, then add it to out. foreach my $g (@$g1) { if (defined($g2hash{$g}) == $intersect) { push @$out, $g; } } return $out; } #-------------------------------------------------------------------------------- =head2 Networking - Moved to NetworkUtils =cut #-------------------------------------------------------------------------------- =head3 cacheEtcHosts NetworkUtils->cacheEtcHosts =cut sub cacheEtcHosts { shift; return NetworkUtils->cacheEtcHosts(@_); } #-------------------------------------------------------------------------------- =head3 getHost NetworkUtils->getHost =cut sub getHost { shift; return NetworkUtils->getHost(@_); } #-------------------------------------------------------------------------------- =head3 getRSCThostname NetworkUtils->getRSCThostname =cut sub getRSCThostname { shift; return NetworkUtils->getRSCThostname(@_); } #-------------------------------------------------------------------------------- =head3 isIpaddr NetworkUtils->isIpaddr =cut sub isIpaddr { shift; return NetworkUtils->isIpaddr(@_); } #-------------------------------------------------------------------------------- =head3 service NetworkUtils->service =cut sub service { shift; return NetworkUtils->service(@_); } #-------------------------------------------------------------------------------- =head3 tryHost NetworkUtils->tryHost =cut sub tryHost { shift; return NetworkUtils->tryHost(@_); } #-------------------------------------------------------------------------------- 1; des > k0PB7u#q@#q@#q@ ./opt/csm/pm/Rpm/RpmIndex.pm.pm#!/usr/bin/perl # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # # @(#)66 1.1 src/csm/core/pm/Rpm/RpmIndex.pm.perl, setup, csm_rveg, rveg0414a 1/20/04 14:20:55 # ##################################################################### package RpmIndex; use strict; use locale; # honor locale for sorting, dates, etc. use Fcntl qw(:flock); # file and directory modules use File::Find; # used by copy to search $::opt_p use FindBin qw($Bin); # mkpath use File::Path; use File::Basename; use File::Listing; use Cwd; use NodeUtils; use MessageUtils; use InstallUtils; # our wrapper package - temporary umask(0022); # default file permission mask # configure search paths my ($csmroot, $MSGCAT, $MSGMAPPATH, $MSGSET); BEGIN { $csmroot = $ENV{'CSM_ROOT'} ? $ENV{'CSM_ROOT'} : '/opt/csm'; $MSGCAT = 'nodecmds.cat'; if (defined $::MSGMAPPATH) { $MSGMAPPATH = $ENV{'CSM_ROOT'} ? "$csmroot/msgmaps" : $::MSGMAPPATH; } else { $MSGMAPPATH = "$csmroot/msgmaps"; } #$MSGSET = 'NodeUtils'; $MSGSET = 'MessageUtils'; } #-------------------------------------------------------------------------------- =head1 RpmIndex =head2 Package Description This program module file, supports the RpmIndex data structures. The purpose of RpmIndex is to supply a global hash of key value pairs: the rpm package name is the key, and the base path to the rpm in the runtime environment is the value. For examle, the rpm, tftp-hpa-3.4.rpm when when used as a key to the hash will return the path of that rpm in the runtime environment . The RpmIndex Abstraction: This package implements the model of a runtime index of all rpm files available on the local system. It is an "abstraction" to the extent that it exports a full set of operations on the runtime index - it implements the abstract data type RpmIndex. Data is at the center of the design but not available to the user. Most of the operations in the package operatate on the unexported data structures. It is fair to say that the package emodies the ideas of "data hiding" and "data abstraction", two design principals popular with C, another proceedural language like perl. Supported Media: RpmIndex supports three types of media common to rpm packages: 1. packages in the local filesystem (including NFS mounts) These are supported as normal key value pairs: the rpm name is the key and simple path string is the values 2. packages in ISO CD file format. Iso images are mountable files. Rpm files in iso image files can be operated on like normal rpm files in the filesystem. The RpmIndex routines will mount and unmount the iso image during get and add operations. A media value is supported in the Index which identifies these rpm files as "ISO". 3. packages on CD ROMs. - to be implemented These are handled as /dev mounts, and the design assumed that the CD contents are either known by the caller, or that the CD contents need not be known to operate on them as in for example a block copy of a CD. A media value is supported in the Index which identifies these types of rpm files as "CDR". Filters: Filters should exist for most of the key attributes. If a speific filter is missing from the package, use one of the other filter routines (such as path_filter) as a template and add the missing filter to the package. Another tip: don't add filters until you need them. For while it would be concptually interesting to have a complete implementation of the RpmIndex abastraction, filling this file with code that is never used will simply increase complexity (a bad thing). The filter routines are intended as a way of accessing two types of values: the value assoicated with a key, or the all of the values associated with the Index. For example, passing a key to the path_filter will return the path associated with the key. Passing the string "INDEX" to the path_filter will return an array of all of the unique directories in the index. This model is altered in the media filter where the "INDEX" option is not available, but is replaced with "ISO" | "CDR" | "UNK". A better design would eleminate this exception; make the change if the solution occurs to you. Scope of the Design: Not to labor the point, but while the RpmIndex is implemented as a global hash, accessing the hash should always be done using the routines in this package (in the spirit of data hiding). If you can't get the RpmIndex package to give you the results needed, this shoudld be considered an opportunity for you to make the package more robust by adding the unsupplied fucntionality - unless of course you are trying to get RpmIndex to return a tuna sandwich, an opeation which falls outside the scope of the design. The original intention in making this package is to attempt to make a perl.org style utility package, to see if thier approach would work in usfully encapulating CSM/install domain knowledge. This approach is atypical of the CSM/install back-end modules (at least at the time of writing), which have generally focused on sharing task-based subroutines that do some setup task. When adding to this package, please keep in mind that your intention should be to extend the completeness of the RpmIndex abstraction. Not to share a bit of rpm related code. If that is what you need, use the xxxUtils.pm.perl modules in src/csm/core/pm. =cut #-------------------------------------------------------------------------------- =head2 File Scope Variables - no globals allowed. The file scope variables in this package should be considered hidden and are not intended for export. Please don't add any global variables to the package. Please do not access these file scope variables directly - use the functions supplied with this package. =cut #-------------------------------------------------------------------------------- # variables with file scope - not exported my %RpmIndex = (); # the rpm index hash my $separator = ":"; # file separator from -p string #my $rpm_suffix = ".msg"; # file separator from -p string my $rpm_suffix = ".rpm"; # file separator from -p string my $current_mount = 0; # currently mounted directory my $RpmIndexCount = 0; # size of the index my %index_product_hash = 0; # hash of products in the index my %index_arch_hash = 0; # hash of interesting archs #-------------------------------------------------------------------------------- =head3 add Add an rpm and path to the RpmIndex. Does not allow duplicate keys - last assignment to a key wins. Media is either a mountable iso file or a cdrom (see comments). Arguments: $name # rpm name $path # rpm path $media # path to mountable media $mtype # media type Returns: $::OK - no error checking as yet. Error: none Example: RpmIndex->add( $rpm_name, $path ); RpmIndex->add( $rpm_name, $path, $iso_path, "ISO"); # $path starts below $iso_path Comments: supported media_types: "ISO" # iso image file "CDR" # CDROM "UNK" # unknown =cut #-------------------------------------------------------------------------------- sub add { my ($class, $indexKey, $indexValue, $media, $mtype) = @_; # for duplicate keys, the last one wins. # indexKey is the full name of an rpm # decompose the rpm name # the hash is ordered by these values my ($arch, $product, $release, $version) = RpmIndex->split_key($indexKey); $RpmIndex{$arch}{$indexKey}{'Arch'} = $arch; $RpmIndex{$arch}{$indexKey}{'Name'} = $indexKey; $RpmIndex{$arch}{$indexKey}{'Media'} = $media; $RpmIndex{$arch}{$indexKey}{'Media_Type'} = $mtype; $RpmIndex{$arch}{$indexKey}{'Path'} = $indexValue; $RpmIndex{$arch}{$indexKey}{'Product'} = $product; $RpmIndex{$arch}{$indexKey}{'Release'} = $release; $RpmIndex{$arch}{$indexKey}{'Version'} = $version; # increment the size counter $RpmIndexCount++; # add to the prod and arch hashes $index_product_hash{$product} = 1; $index_arch_hash{$arch} = 1; return $::OK; } #-------------------------------------------------------------------------------- =head3 arch_get_set Returns array of architectures of interest. Returns none Arguments: $arch - name of a arch (i.e. i386) Returns: $::OK or $::NOK Globals: none Error: none Example: my $array_ref = RpmIndex->arch_get_set(); Comments: none =cut #-------------------------------------------------------------------------------- sub arch_get_set { # get arch values from the hash return keys %index_arch_hash; } #-------------------------------------------------------------------------------- =head3 arch_unset Removes the parameter as an architecture of interest. Any RpmIndex routines called after arch_unset($arch,...) will not be applied to elements of $arch architecture in the index. Multiple archs can be unset using this command multple times. Returns none Arguments: $arch - name of a arch (i.e. "i386") Returns: none Globals: none Error: none Example: RpmIndex->arch_unset("i386"); Comments: none =cut #-------------------------------------------------------------------------------- sub arch_unset { my ($class, $arch) = @_; # remove the hash if (!$arch) { %index_arch_hash = 0; } # remove $arch from the hash delete $index_arch_hash{$arch}; } #-------------------------------------------------------------------------------- =head3 copy Copy one or more rpms to a location in the filesystem. Arguments: @rpm_names # array of rpm file names ( ie RpmIndex keys ) $dest_path # copy the files here Returns: $::OK if copied okay Globals: none Error: Exits if it can't a copy file or change its permissions Example: my $rc = RpmIndex->copy ( @rpm_names, $dest_path }; Comments: none =cut #-------------------------------------------------------------------------------- sub copy { my ($class, $ref_names, $dest) = @_; my @names = @$ref_names; #print "dest $dest \n"; my (@iso_file_array, @norm_file_array); my $files; #foreach my $name (@names) { print "params: $name, $dest\n"; } # break out normal and iso_image rpm files foreach my $name (@names) { # test for file type if (RpmIndex->in_iso_image($name) == $::OK) { #print "pushing $name to iso_file_array\n"; push @iso_file_array, $name; } else { # don't need keys, so add path to name # get a ref w/single elem: name my $path = &deref_elem(RpmIndex->path_filter($name)); #print "name: $name\n"; #print "path: $path \n"; next if ($path == "1"); my $full_name = join('/', $path, $name); #print "full_name: $full_name, path: $path \n"; push @norm_file_array, $full_name; } } #print "dest $dest\n"; # make the $dest directory mkpath($dest, $::VERBOSE, 0755); # handle normal filesystem rpm files $files = join(' ', @norm_file_array); NodeUtils->message("I", 'IMsgCOPYING', $files); #print "copy cmd: $::COPY $files $dest \n"; NodeUtils->run_cmd("$::COPY $files $dest"); # handle iso image rpm files $files = join(' ', @iso_file_array); if (scalar($files) > 0) # do this if there are $files... { # Design issue: limit the number of iso mount operations my $mount_bool = $::NOK; # get a reference turn it into an array my $array_ref = RpmIndex->media_type_filter("ISO"); next if ($array_ref == "1"); # all Iso files in the Index my @media_in_index = @$array_ref; # go through media_in_index array # and copy every target rpm file found in each iso image file foreach my $image (@media_in_index) # looks at each iso file { foreach my $file (@iso_file_array) # look at each target rpm file { # filter returns media value for $file my $media = &dref_elem(RpmIndex->media_filter($file)); next if ($media == scalar($::NOK)); my @array = @$array_ref; my $media = pop @array; # assign filter output to media returned next if ($image ne $media); # found one of the targets in the iso file $image # test the mount if ($mount_bool == $::NOK) { # nice if we could umount first but $current_mount = ArchiveUtils->mount_iso_image($image); $mount_bool = $::OK; } # array ref w/ one elem my $array_ref = RpmIndex->path_filter($file); next if ($array_ref == "1"); my @array = @$array_ref; my $path = pop @array; NodeUtils->message("I", 'IMsgCOPYING', $file); NodeUtils->run_cmd("$::COPY $path/$file $dest"); } if ($mount_bool == $::OK) { ArchiveUtils->unmount_iso_image($current_mount); $mount_bool == $::NOK; # reset bool } } } # set the permissions on the copied files in $dest foreach my $name (@names) { NodeUtils->run_cmd("$::CHMOD +r $dest/$name"); } return $::OK; } #-------------------------------------------------------------------------------- =head3 create Create an RpmIndex given a list of pathnames. This routine takes a list of : separated pathnames as a parameter and generates an index of all rpm packages found in the directories (and subdirectories) in the list. If an ISO Image file is found in a directory, the ISO file is mounted and the rpms in the image are added to the index. unmounted CD's are not currently searched for rpms for the index, though if the mount point of a CD is a member of the @base_dir_array, these rpms will be included in the index. Arguments: $base_dir_string - an string of base directories separated by : , (i.e. -p list) this routine will search subdirectories of the base directories for rpm packages. Returns: count of rpms in the index. Error: none Example: RpmIndex->create ( $opt_p ); Comments: Designed to accept the commandline string (opt_p) as it comes from the -p flag. Two so-called "wanted subroutines preceed the function both are used by File:find. =cut #-------------------------------------------------------------------------------- # file scope vars, for passing between &iso_wanted() and &create(). my $current_iso = (); # currently mounted iso file my @iso_file_array = (); # all potiential iso files in index # the "wanted" routines used by find() in create() (see below). sub iso_wanted { # this routines processes one mounted iso_file at a time my $iso_file = @_; # name of mounted file # find() sets these, each time (see create_wanted) my $dir = $File::Find::dir; my $file = $_; my $path; # hold corrected $dir next if (RpmIndex->is_rpm_file($file) == $::NOK); # $dir includes $current_mount # have to throw away $current_mount string ($path = $dir) =~ s:^$current_mount::; RpmIndex->add($file, $path, $current_iso, "ISO"); } sub create_wanted { # find() sets these, each time it examines something my $cur_dir = $File::Find::dir; # the directory path with "/" my $cur_file = $_; # current file my $full_name = $File::Find::name; # full filename if (RpmIndex->is_rpm_file($cur_file) == $::OK) { RpmIndex->add($cur_file, $cur_dir); } else { # $cur_file may be an iso image # try to mount $full_name to $current_mount. # if a loop device is availble and $full_name # is an ISO image file, the mount should succeeed. # to be safe, umnount first ArchiveUtils->unmount_iso_image($current_mount); next if (ArchiveUtils->mount_iso_image($full_name) == $::NOK); # mount succeeded - put $full_name in iso list push @iso_file_array, $full_name; ArchiveUtils->unmount_iso_image($current_mount); } } sub create { my ($class, $dir_list) = @_; my (@base_dir_array); # split the list into the @baseDir_array @base_dir_array = split($separator, $dir_list); # populate the RpmIndex with rpm filenames and paths # treats ISO image files like unmounted filesystems # find rpm in all directories in $dir_list find(\&create_wanted, @base_dir_array); # find rpms in iso mounts foreach my $iso_file (@iso_file_array) # from &create_wanted() { # for safety - unmount the $current_mount ArchiveUtils->unmount_iso_image($current_mount); next if (ArchiveUtils->mount_iso_image($iso_file) == $::NOK); $current_iso = $iso_file; find(\&iso_wanted, $current_mount); ArchiveUtils->unmount_iso_image($current_mount); $current_iso = 0; } # RpmIndex is now a full index of all the # rpms below the directories in $dir_list return RpmIndex->sizeof; } #-------------------------------------------------------------------------------- =head3 deref_elem Dereferences an array reference containing a single element Local to RpmIndex file, not exported Useful for woking with filter routines - probably a better approach out there. Arguments: $array_ref Returns: Returns a scalar of an array reference containing a single element. Globals: none Error: none Example: my $path = &deref_elem( RpmIndex->path_filter($name) ); Comments: # Not exported, but feel free to copy this somewhere in your file. sub deref_elem { my ( $array_ref ) = @_; my ( $elem, $NOK ); $NOK = scalar ( $::NOK ); if ( $array_ref == $NOK ) { return $::NOK; } # get a ref w/single elem my @array = @$array_ref; my $elem= pop @array; return $elem } =cut #-------------------------------------------------------------------------------- sub deref_elem { my ($array_ref) = @_; my ($elem, $NOK); $NOK = scalar($::NOK); if ($array_ref == $NOK) { return $::NOK; } # get a ref w/single elem my @array = @$array_ref; my $elem = pop @array; return $elem; } #-------------------------------------------------------------------------------- =head3 get Get an entry from the RpmIndex given a rpm name as key. Arguments: $rpm_name Returns: $name # rpm name - caller's param $path # path to rpm $product # rpm "short" name $version # rpm version $release # rpm release $media # path mountable media $mtype # type of media Globals: none Error: none Example: my ( $name, $path, $product, $version, $release, $media $mtype ) = RpmIndex->find ( $name ); Comments: supported media types (mtype): "ISO" # iso image file "CDR" # cdrom "UNK" # unknonw =cut #-------------------------------------------------------------------------------- sub get { my ($class, $indexKey) = @_; # split the key, in order to access index elems my ($arch, $product, $rel, $ver) = RpmIndex->split_key($indexKey); my $name = $RpmIndex{$arch}{$indexKey}{'Name'}; my $path = $RpmIndex{$arch}{$indexKey}{'Path'}; my $product = $RpmIndex{$arch}{$indexKey}{'Product'}; my $version = $RpmIndex{$arch}{$indexKey}{'Version'}; my $release = $RpmIndex{$arch}{$indexKey}{'Release'}; my $media = $RpmIndex{$arch}{$indexKey}{'Media'}; my $mtype = $RpmIndex{$arch}{$indexKey}{'Media_Type'}; return ($name, $path, $product, $version, $release, $media, $mtype); } #-------------------------------------------------------------------------------- =head3 in_cdrom Determine if an rpm in the index is contained on a cdrom Arguments: $rpm_name Returns: $::OK if rpm_name is on a known CD $::NOK if it is not Globals: none Error: none Example: my $rc = RpmIndex->in_cdrom($rpm_name}; Comments: none =cut #-------------------------------------------------------------------------------- sub in_cdrom { my ($class, $name) = @_; my ($indexKey, $indexValue, $product, $version, $release, $media, $mtype) = RpmIndex->get($name); if ($mtype eq "CDR") { return $::OK; } return $::NOK; } #-------------------------------------------------------------------------------- =head3 in_iso_image Determine if an rpm in the index is embedded in an ISO image file. Arguments: $rpm_name Returns: $::OK if rpm_name is embedded in an ISO image file $::NOK if it is an rpm in a fileystem. Globals: none Error: none Example: if ( RpmIndex->in_iso_image($rpm_name} == $::OK) { ...; } Comments: none =cut #-------------------------------------------------------------------------------- sub in_iso_image { my ($class, $name) = @_; my ($indexKey, $indexValue, $product, $version, $release, $media, $mtype) = RpmIndex->get($name); if ($mtype eq "ISO") { return $::OK; } return $::NOK; } #-------------------------------------------------------------------------------- =head3 is_arch Returns $::OK or $::NOK depending on wether parameter is an arch in the index_arch_hash (if it exists). Returns $::OK if the parameter is an arch which has been previously set, or if no arch has been set. $::NOK otherwise Arguments: $arch - name of a arch (i.e. i386) Returns: $::OK or $::NOK Globals: none Error: none Example: RpmIndex->arch_set( $arch) ); if ( RpmIndex->is_arch($arch) == $::OK ) {...} Comments: Don't have to set the arch, in which case any parameter is valid =cut #-------------------------------------------------------------------------------- sub is_arch { my ($class, $arch) = @_; foreach my $ar (keys %index_arch_hash) { if ($arch eq $ar) { return $::OK; } } return $::NOK; } #-------------------------------------------------------------------------------- =head3 is_product Returns $::OK or $::NOK depending on wether filename parameter is a the name of a product rpm in the hash. Returns $::OK if the parameter is a known product $::NOK otherwise Arguments: $product - name of a product rpm (i.e. tftp-hpa) Returns: $::OK or $::NOK Globals: none Error: none Example: if ( RpmIndex->is_product($filename) ) { #something } Comments: This is independent of arch - just relates to product name. =cut #-------------------------------------------------------------------------------- sub is_product { my ($class, $product) = @_; my $retval = $::NOK; foreach my $prod (keys %index_product_hash) { if ($product eq $prod) { return $::OK; } } return $retval; } #-------------------------------------------------------------------------------- =head3 is_rpm_file Returns $::OK or $::NOK depending on wether filename parameter has a ".rpm" suffix. Returns $::OK if the parameter is an rpm file $::NOK otherwise Arguments: $filename - the name of a file with or without path Returns: $::OK or $::NOK Globals: none Error: none Example: if ( RpmIndex->is_rpm_file($filename) ) { #something } Comments: just checks the suffix, doesn't type the file =cut #-------------------------------------------------------------------------------- sub is_rpm_file { my ($class, $filename) = @_; my ($base, $path, $type) = fileparse($filename, $rpm_suffix); #print "name: $filename, type: $type\n"; if ($type eq $rpm_suffix) { return $::OK; } return $::NOK; } #-------------------------------------------------------------------------------- =head3 media_filter Filter the Index for media values, either for a key or for the Index itself. Passing in a key will return the media value assicated with the key. Passing a media type string will return an array of all media (mountable files) in the Index of that type. Arguments: $rpm_name | "ISO" | "CDR" | "UNK" Returns: $array_ref - return media value for rpm name as an array reference - return all media filenames of that type the media are mountable $filenames (includes path). "CDR" and "UNK" not yet implemented Globals: none Error: return $::NOK; Example: my $ret_ref = RpmIndex->media_filter($rpm_name}; my $ret_ref = RpmIndex->media_filter("ISO"}; # all mountable iso media Comments: If you need to know what iso image files are stored in the index, this is the routine for you. =cut #-------------------------------------------------------------------------------- sub media_filter { my ($class, $name) = @_; my @return_array; # handle an index key if (RpmIndex->is_rpm_file($name) == $::OK) { my ($indexKey, $indexValue, $product, $version, $release, $media, $mtype) = RpmIndex->get($name); # return $mtype in an array reference push @return_array, $mtype; return \@return_array; } # handle a media parameter if ( ($name eq "ISO") || ($name eq "CDR") || ($name eq "UNK")) { my %media_hash; my @return_array; foreach my $arch (keys %RpmIndex) { foreach my $name (keys %{$RpmIndex{$arch}}) { my $mtype = $RpmIndex{$arch}{$name}{'Media_Type'}; if ($mtype eq "ISO") { # returns a mountable filename (including path). my $media = $RpmIndex{$arch}{$name}{'Media'}; # need to store one entry per unique value if ($media) { $media_hash{$media} = 1; } } if ($mtype eq "CDR") { print "support for media: $name is not implemented yet\n"; return $::NOK; } if ($mtype eq "UNK") { print "support for media: $name is not implemented yet\n"; return $::NOK; } } } # turn hash into an array of unique elements, and return it. foreach my $media (keys %media_hash) { push @return_array, $media; } return \@return_array; } # bad param print "bad parameter passed in media_filter: $name "; return $::NOK; } #-------------------------------------------------------------------------------- =head3 defs_filter Returns a hash of arrays of all indexKeys that match a wildcard string from a CSM "defs" file. Most recent version of a product will be the first element in each arrray in the hash. The hash keys are $arch values. Arguments: $def_string # e.g. "perl-libwww-perl-*.i?86.rpm" Returns: reference to a hash of arrays of index keys that match. Globals: none Error: none Example: $hash_ref = RpmIndex->defs_filter( $defs_string ); Comments: Design: . pop off the arch information from the parameter string . get a substring from the parameter sring - up to the first "*" . for each appropriate arch, search for substring in each indexKey . if a match is found search for version substring ( "*-5*" ) . sort found keys in to an array; add array to the return hash =cut #-------------------------------------------------------------------------------- sub defs_filter { my ($class, $string) = @_; # x86 architectures my @x_arch = ("i286", "i386", "i486", "i586", "i686", "i786", "i886", "i986"); my ($product, $version, $release, @arch_array); my %return_hash; # decompose the input parameter my @split_array = split(/\*/, $string); my $tail = pop @split_array; my @tmp = split(/\./, $tail); pop @tmp; my $arch = pop @tmp; # see if there are keys of $arch in index if ($arch eq "i?86") # some x86 architecture { foreach my $arch (@x_arch) { if (RpmIndex->is_arch($arch) == $::OK) { push @arch_array, $arch; } } } else { # some other architecture if (is_arch($arch) == $::OK) { push @arch_array, $arch; } else { return $::NOK; } # arch not in index } # product is substring like "perl-5*" my $product = shift @split_array; # version is substring like "*-5*" # release isn't supported my $cnt = scalar(@split_array); if ($cnt > 0) { $version = shift @split_array; } if ($cnt == 2) { $release = shift @split_array; } # search for matching index keys foreach $arch (@arch_array) { my @return_array; # reset array each itteration foreach my $key (keys %{$RpmIndex{$arch}}) { if ($key =~ /^$product/) { if ($version eq "-" || $version eq "") { push @return_array, $key; #print "found $key\n"; } else # version value ( e.g. "*-5*" ) { my $hash_ref = RpmIndex->version_filter($key); my %version_hash = %$hash_ref; my @version_array = @version_hash{$arch}; { foreach my $key_version (@version_array) { my $product = RpmIndex->product_filter($key); my $version_key = RpmIndex->version_filter($product); if ($version_key =~ /^.*-$version/) { # test the release wildcards here # if this functionality is needed # this $key is a keeper for this $arch push @return_array, $key; #print "found $key\n"; } } } } } } # sort array - newest first my @t_array = sort @return_array; #print "returning the following\n"; #foreach my $key (@t_array){ print "key: $key \n"; } @return_hash{$arch} = @t_array; } # return reference return \%return_hash; } #-------------------------------------------------------------------------------- =head3 path_filter Filter the Index for path values, for a key or for the Index itself. Passing in a key will return the path value assicated with the key. Passing the string "INDEX" will return an array of all paths in the Index. Arguments: $rpm_name | "INDEX" Returns: $path - return path value for rpm name @all_paths - return all paths the path in the Index. Globals: none Error: return $::NOK; Example: my $array_ref = RpmIndex->path_filter($rpm_name}; # single elem my $array_ref = RpmIndex->path_filter("INDEX"}; # returns all paths Comments: returns all the directories associated with the Index when used with the "INDEX" parameter. =cut #-------------------------------------------------------------------------------- sub path_filter { my ($class, $name) = @_; my @return_array; # test parameters if (RpmIndex->is_rpm_file($name) == $::OK) { my ($indexKey, $indexValue, $product, $version, $release, $media, $mtype) = RpmIndex->get($name); # return $path in an array reference push @return_array, $indexValue; return \@return_array; } if ($name eq "INDEX") { my %path_hash; my @return_array; foreach my $arch (keys %RpmIndex) { foreach my $name (keys %{$RpmIndex{$arch}}) { # returns a path. my $path = $RpmIndex{$arch}{$name}{'Path'}; # need to store one entry per unique path if ($path) { $path_hash{$path} = 1; } } } # turn hash into an array and return it. foreach my $path (keys %path_hash) { push @return_array, $path; } # return reference return \@return_array; } # bad param print "bad parameter in path_filter\n"; return $::NOK; } #-------------------------------------------------------------------------------- =head3 print Debug routine: print the contents of the index stdout Arguments: none Returns: none Globals: none Error: none Example: RpmIndex->print; Comments: none =cut #-------------------------------------------------------------------------------- sub print { my (%nameH, $arch); my $index_size = RpmIndex->sizeof; print "\n\nIndex size: $index_size\n\n"; print "Attributes listed in alphabetical order:\n\n"; foreach my $arch (keys %RpmIndex) { foreach my $name (keys %{$RpmIndex{$arch}}) { print " $RpmIndex{$arch}{$name}{'Name'}: \n"; print " Arch: $RpmIndex{$arch}{$name}{'Arch'} \n"; print " Media: $RpmIndex{$arch}{$name}{'Media'} \n"; print " Media Type: $RpmIndex{$arch}{$name}{'Media_Type'} \n"; print " Path: $RpmIndex{$arch}{$name}{'Path'} \n"; print " Product: $RpmIndex{$arch}{$name}{'Product'} \n"; print " Release: $RpmIndex{$arch}{$name}{'Release'} \n"; print " Version: $RpmIndex{$arch}{$name}{'Version'} \n"; print "\n\n\n"; } } } #-------------------------------------------------------------------------------- =head3 product_filter Filter the Index for product values, for a key or for the Index itself. Passing in a key will return the product value assicated with the key. Passing the string "INDEX" will return an array of all products in the Index. Arguments: $rpm_name | "INDEX" Returns: $product - return product value for rpm name @products - return all product values in the Index Globals: none Error: return $::NOK; Example: my $array_ref = RpmIndex->product_filter($rpm_name}; # single elem my $array_ref = RpmIndex->product_filter("INDEX"}; # returns all products Comments: none =cut #-------------------------------------------------------------------------------- sub product_filter { my ($class, $name) = @_; my @return_array; # test parameters if (RpmIndex->is_rpm_file($name) == $::OK) { my ($indexKey, $indexValue, $product, $version, $release, $media, $mtype) = RpmIndex->get($name); # return $product in an array reference push @return_array, $product; return \@return_array; } if ($name eq "INDEX") { my %product_hash; my @return_array; foreach my $arch (keys %RpmIndex) { foreach my $name (keys %{$RpmIndex{$arch}}) { # returns a product my $product = $RpmIndex{$arch}{$name}{'Product'}; # need to store one entry per unique product if ($product) { $product_hash{$product} = 1; } } } # turn hash into an array and return it. foreach my $product (keys %product_hash) { push @return_array, $product; } # return reference return \@return_array; } # bad param print "bad parameter in product_filter\n"; return $::NOK; } #-------------------------------------------------------------------------------- =head3 sizeof Returns the sizeof the Index Arguments: none Returns: number of elements in the Index Globals: none Error: none Example: my size = RpmIndex->sizeof; Comments: none =cut #-------------------------------------------------------------------------------- sub sizeof { return $RpmIndexCount; } #-------------------------------------------------------------------------------- =head3 split_key Returns the parts of an Rpm name: arch, product, release, version. $arch - archetecture ie i386 $product - e.g. tkl or Java-JRE $release $version Arguments: $key # the name of an rpm ( may be incomplete ) Returns: ( $arch, $product, $release, $version ) Globals: none Error: none Example: my ( $arch, $product, $release, $version ) = RpmIndex->split_key ($rpm_name); Comments: retun values are ordered alphabetically (ie arch to version). =cut #-------------------------------------------------------------------------------- sub split_key { my ($class, $indexKey) = @_; if ($indexKey == "") { return; } # empty param my @split_array = split(/-/, $indexKey); my $rel_rpm = pop @split_array; my $version = pop @split_array; # yuck my ($t3, $t2, $t1); $t3 = "-"; $t1 = $indexKey; ($t2 = $t1) =~ s:$version.*$::; ($t1 = $t2) =~ s:$t3$::; my $product = $t1; # parse $rel_rpm my ($release, $arch, $rpm) = split(/\./, $rel_rpm); return ($arch, $product, $release, $version); } #-------------------------------------------------------------------------------- =head3 version_filter Filter the Index for versions of the rpms of a product. Passing in a key, will return the version value for that key in the index. Passing in a product value will return a referance to a hash of arrays of all versions of the product in the index - one array for each arch. The array contents will be organized in decending order: the product rpm with the highest version and release will be first in the array. Arguments: $product Returns: %$hash_ref ref of a hash of arrays of $prod rpms in decending order of version and release. Globals: none Error: return $::NOK; Example: my $hash_ref = RpmIndex->version_filter("tkl"}; Comments: =cut #-------------------------------------------------------------------------------- sub version_filter { my ($class, $name) = @_; my @return_array; # handle an index key if (RpmIndex->is_rpm_file($name) == $::OK) { my ($indexKey, $indexValue, $product, $version, $release, $media, $mtype) = RpmIndex->get($name); # return $path in an array reference push @return_array, $version; return \@return_array; } # handle a product string "tcl" if (RpmIndex->is_product($name) == $::NOK) { return $::NOK; } my %return_hash; foreach my $arch (keys %RpmIndex) { my @indexKey_array; foreach my $key (keys %{$RpmIndex{$arch}}) { # create arrays of all versions of product by arch if ($name eq $RpmIndex{$arch}{$key}{'Product'}) { my $indexKey = $RpmIndex{$arch}{$key}{'Name'}; push @indexKey_array, $indexKey; } } # add sorted array to return_hash my @sorted = sort @indexKey_array; @return_hash{$arch} = @sorted; } # return the reference return \%return_hash; } 1; # leave this here k/0PB7uxԄAԄAԄA x./opt/csm/pm/ServerUtils.pm.pm#!/usr/bin/perl # IBM_PROLOG_BEGIN_TAG # This is an automatically generated prolog. # # # # Licensed Materials - Property of IBM # # (C) COPYRIGHT International Business Machines Corp. 2003,2004 # All Rights Reserved # # US Government Users Restricted Rights - Use, duplication or # disclosure restricted by GSA ADP Schedule Contract with IBM Corp. # # IBM_PROLOG_END_TAG # @(#)32 1.27.1.1 src/csm/core/pm/ServerUtils.pm.perl, setup, csm_rveg, rvegs005a 8/3/04 22:13:12 # ##################################################################### package ServerUtils; use strict; # locale tells perl to honor locale for sorting, dates, etc. # More info about locale.pm and perl handling of locales can be found in # /usr/lib/perl5/5.6.0/locale.pm and the man page for perllocale. use locale; use Socket; use Fcntl qw(:flock); use File::Basename; use File::Find; use File::Path; # Provides mkpath() my $msgs; my $distro; my $useTranslatedMsg; my %catHashes; my $csmroot; my ($MSGCAT, $MSGMAPPATH, $MSGSET); my $NO_NODERANGES; my $NODEGROUPEXPMEM_WARNING = 1; # $NodeUtils::NO_MESSAGES; # Set this to 1 if you do not want NodeUtils to # print any error msgs # $NodeUtils::errno; # Will be set if an error occurs. You must zero # this out before calling a NodeUtils function, # if you want to check it afterwards. BEGIN { # This enables us to redirect where it looks for other CSM files during development $csmroot = $ENV{'CSM_ROOT'} ? $ENV{'CSM_ROOT'} : '/opt/csm'; $MSGCAT = 'nodecmds.cat'; if (defined $::MSGMAPPATH) { $MSGMAPPATH = $ENV{'CSM_ROOT'} ? "$csmroot/msgmaps" : $::MSGMAPPATH; } else { $MSGMAPPATH = "$csmroot/msgmaps"; } $MSGSET = 'NodeUtils'; } umask(0022); # This sets umask for all CSM files so that group and world only # have read permissions. # To change it, simply use the umask call in your script, after # the "use ServerUtils;" line #-------------------------------------------------------------------------------- =head1 ServerUtils =head2 Package Description This program module file, supports the CSM/install server-side dependencies. If adding to this file, please take a moment to ensure that: 1. Your contrib has a readable pod header describing the purpose and use of your contrib. 2. Your contrib is under the correct heading and is in alphabetical order under that heading. 3. You test your contribution by running from the command line: pod2html --verbose --title=ServerUtils ServerUtils.pm.perl --outfile=ServerUtils.html and examining the ./ServerUtils.html file in a browser. =cut #-------------------------------------------------------------------------------- =head2 Package Dependancies use strict; use Fcntl qw(:flock); use File::Basename; use File::Find; use File::Path; # Provides mkpath() =cut #-------------------------------------------------------------------------------- =head2 Misc Tools =cut #-------------------------------------------------------------------------------- =head3 close_delete_file Closes and deletes the file specified by the two input parameters. Arguments: $file handle $file name Returns: null Error: none Example: ServerUtils->close_delete_file($::NODE_LIST_FILE, $nodelist_file); Comments: none =cut #-------------------------------------------------------------------------------- sub close_delete_file { my ($class, $file_handle, $file_name) = @_; close $file_handle; my $cmd = "$::RM -f $file_name"; my $rc = system($cmd) >> 8; if ($rc) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $rc); } } #-------------------------------------------------------------------------------- =head3 copy_exceptions_rveg A subroutine to hold some file copy hacks for the vega release. The rotuine has the release name rveg attached to it, to motiveate those who come later to fix the underlying problem for the next release. Arguments: n/a Returns: null Error: none Example: n/a Comments: none =cut #-------------------------------------------------------------------------------- sub copy_exceptions_rveg { my ( $distro_name, # eg RedHat or SLES (case sensitive) $filename # the name of the file to test. ) = @_; my $server = $::PLTFRM; # the managment server doing the install # This hack relates to an interoprability issue between AIX and Linux. # When AIX runs copycsmpkgs on a Linux Distro, it tries to copy a few too many files... if ( ($server eq "AIX") && ( ($distro_name =~ /RedHat/) || ($distro_name =~ /SLES/) || ($distro_name =~ /SuSE/) ) ) { # just test against the filenames one at a time if ($filename eq "/opt/csm/csmbin/nodestatus.client") { return $::NOK; } if ($filename eq "/opt/csm/csmbin/setbootdisk") { return $::NOK; } if ($filename eq "/usr/lib/syslinux/pxelinux.0") { return $::NOK; } } return $::OK; } #-------------------------------------------------------------------------------- =head3 get_lock get ownership of a non-blocking semiphore / file Arguments: $fileName Returns: 2 if it couldn't open $fileName 3 if it couldn't lock $fileName Error: messageFromCat E1 Example: ServerUtils->get_lock("/tmp/updateisvr.sem");_ Comments: get_lock() and release_lock() implement semiphore locking for csm comnands such as updatenode.perl. The devleoper obtains a lock at the beginning of execution and hold it until the script completes. It is guaranteed that two or more instances of the script will NOT be able to run concurrently. This is not a blocking lock. If a script calls get_lock while another instance of the same script has not released the lock, the calling script will fail. If the script exits for any reason, the lock is released. =cut #-------------------------------------------------------------------------------- sub get_lock { my ($class, $file) = @_; my $return_code = 0; my $program = NodeUtils->programName(); NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "V", 'IMsgGet_Lock', $file, $program); if (!open(SEM, ">$file")) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E1", 'EMsgSEMAPHORE_ERROR', $file, "$? $!" ); } if (!flock(SEM, LOCK_EX | LOCK_NB)) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E1", 'EMsgLOCK_ERROR', $program, $file, "$? $!" ); } } #-------------------------------------------------------------------------------- =head3 get_uniqu_arry_elemnts Returns the unique elements in an array Arguments: @array_to_examined Returns: @array_of_unique_ele Globals: none Error: undefined Example: @::os_prereq = ServerUtils->get_uniqu_arry_elemnts( @::os_prereq ); Comments: none =cut #-------------------------------------------------------------------------------- sub get_uniqu_arry_elemnts { my ($class, @my_arry) = @_; my %my_hsh = (); my @uniq = (); my $itm; foreach $itm (@my_arry) { $my_hsh{$itm}++; } @uniq = keys %my_hsh; return @uniq; } #-------------------------------------------------------------------------------- =head3 isAutoupdateInstalled Checks to see if the Autoupdate RPM is installed on a Management Server Arguments: nodeHash Returns: returns 1 if Autoupdate is installed 0 otherwise Globals: none Error: none Example: none Comments: This make sense only on a managment server. =cut #-------------------------------------------------------------------------------- sub isAutoupdateInstalled { my ($class, $destnodekey) = @_; my $exit = 1; #assume it is installed #Autoupdate should be in /csminstall/Linux//csm//packages/ #EX: /csminstall/Linux/RedHat/csm/1.3.0/packages/autoupdate-4.0.1-1.noarch.rpm #determine possible directory structures my %directories = (); foreach my $node (keys %$destnodekey) { if ($$destnodekey{$node}{'InstallOSName'} eq "Linux") { my $distro = $$destnodekey{$node}{'InstallDistributionName'}; my $version = $$destnodekey{$node}{'InstallCSMVersion'}; if ($version >= 1.3) { my $dir = "/csminstall/Linux/$distro/csm/$version/packages/"; $directories{$dir} = 1; } } } #check if there is an autoupdate rpm in the directory foreach my $dir (keys %directories) { `/bin/ls $dir/autoupdate*.rpm 2>/dev/null`; my $rc = $? >> 8; if ($rc != 0) { #autoupdate isn't there NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgNoAutoupdate', $dir, "http://freshmeat.net/projects/autoupdate", $dir ); $exit = 0; } } return $exit; } #-------------------------------------------------------------------------------- =head3 release_lock Releases a non-blocking semiphore / file Arguments: $fileName Returns: 2 if it couldn't open $fileName 3 if it couldn't lock $fileName Error: messageFromCat E1 Example: ServerUtils->get_lock("/tmp/updateisvr.sem");_ Comments: get_lock() and release_lock() implement semiphore locking for csm comnands such as updatenode. The develeoper obtains a lock at the beginning of execution and hold it until the script completes. It is guaranteed that two or more instances of the script will NOT be able to run concurrently. This is not a blocking lock. If a script calls get_lock while another instance of the same script has posession of the lock, the calling script will fail. If a script exits for any reason, the lock will be released. =cut #-------------------------------------------------------------------------------- sub release_lock { my ($class, $file) = @_; close(SEM); if (-e "$file") { system("/bin/rm -f $file"); } } #-------------------------------------------------------------------------------- =head2 Cluster Layer =cut #-------------------------------------------------------------------------------- =head3 makeSyncHash Returns a hash of which directories to distribute to which Install Servers. Assigns a value to the global: %::INSTALL_SERVERS - this is an array of the host names of all the install servers in the cluster. Arguments: %DestNodeHash (where InstallServer is one of the attributes). Returns: Hash of directory name arrays by install server keys Globals: %::INSTALL_SERVERS Error: undefined Example: my $sHash = ServerUtils->makeSyncHash($DestNodeHash); Comments: none =cut #-------------------------------------------------------------------------------- sub makeSyncHash { my ($class, $DestNodeHash) = @_; my $defDir = "/csmserver"; my %sHash; my $ms_used = 0; %::INSTALL_SERVERS = (); my @install_servers = (); my $progname = NodeUtils->programName(); #hash of directory{replacement name}{installserver} NODE: foreach my $node (keys %$DestNodeHash) { my $InstallOSName = $$DestNodeHash{$node}{'InstallOSName'}; my $InstallDistributionName = $$DestNodeHash{$node}{'InstallDistributionName'}; if ($$DestNodeHash{$node}{'InstallServer'}) { if ($$DestNodeHash{$node}{'ManagementServer'} eq $$DestNodeHash{$node}{'Hostname'}) { #this machine is a MS and a node $ms_used = 1; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'W', 'EMsgMSNoInstallServer', $node); next NODE; } my ($server, $rep_dir) = split ':', $$DestNodeHash{$node}{'InstallServer'}; if ($server) { if ($server eq $$DestNodeHash{$node}{'ManagementServer'}) { $ms_used = 1; #this node's install server is the same as the managment server NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'I', 'IMsgMSisInstallServer', $node); next NODE; } if ($progname =~ m/installnode/) { #make sure a machine is not an install server of itself my ($node_hostname, $node_ip) = NodeUtils->getHost($node); my ($isvr_hostname, $isvr_ip) = NodeUtils->getHost($server); if ($node_hostname eq $isvr_hostname) { $ms_used = 1; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'W', 'EMsgISVR_OF_ITSELF', $node); next NODE; } } my $dir = $defDir; if ($rep_dir) { #todo: check to make sure this start with a / $dir = $rep_dir; } #transfer /csminstall/csm/* to all nodes push @{$sHash{"/csminstall/csm/"}{$dir}}, $server; #%{$::INSTALL_SERVERS{$server}} = (); #hash of a hash push @install_servers, $$DestNodeHash{$node}{'InstallServer'}; #find node attributes my $InstallDistributionVersion = $$DestNodeHash{$node}{'InstallDistributionVersion'}; #my $InstallPkgArchitecture = $DestNodeHash{$node}{'InstallPkgArchitecture'}; if ($InstallOSName eq "Linux") { #All Linux nodes: /csminstall/Linux//csm/* # /csminstall/Linux///* push @{$sHash{ "/csminstall/Linux/$InstallDistributionName/csm/"} {$dir}}, $server; push @{ $sHash{ "/csminstall/Linux/$InstallDistributionName/$InstallDistributionVersion" }{$dir} }, $server; } elsif ($InstallOSName eq "AIX") { #All AIX Nodes: /csminstall/AIX/csm/* push @{$sHash{"/csminstall/AIX/csm/"}{$dir}}, $server; } else { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgUnsupportedOS', $node, $InstallOSName); } } else { #management server is a server $ms_used = 1; } } else { $ms_used = 1; } } if (!$ms_used) { $::MS_INSTALL_SERVER = 0; } #figure out if any of the install servers are also nodes foreach my $entry (@install_servers) { my ($server, $dir) = split ':', $entry; if (!$dir) { $dir = $::SERVER_DIRECTORY; } if (exists $$DestNodeHash{$server}) { #it is a node $::INSTALL_SERVERS{'isnode'}{$server}{'dir'} = $dir; $::INSTALL_SERVERS{'isnode'}{$server}{'OS'} = $$DestNodeHash{$server}{'InstallOSName'}; $::INSTALL_SERVERS{'isnode'}{$server}{'DISTRO'} = $$DestNodeHash{$server}{'InstallDistributionName'}; } else { #not a node my ($real_hostname, $ip) = NodeUtils->getHost($server); #print "REAL HOSTNAME = $real_hostname\n"; $::INSTALL_SERVERS{'notnode'}{$real_hostname}{'dir'} = $dir; } } if (scalar @install_servers) { for (@install_servers) { s/:.*// } #remove directory my $unreachable = InstallUtils->checkRSReachability(\@install_servers); if ($unreachable != 0) { if (scalar @$unreachable >= 1) { #there are unreachable InstallServers my $isvrs = join ",", @$unreachable; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgISDown', $isvrs); } } } return (\%sHash); } #-------------------------------------------------------------------------------- =head3 syncServers Syncronize a cluster's Install Servers. Arguments: Reference to a nodeName Hash; Returns: 0 on error Globals: %::INSTALL_SERVERS Error: 0 - there are no install servers in the cluster. Example: ServerUtils->syncServers(\%DestNodeHash); Comments: The caller of this function must use CFM. =cut #-------------------------------------------------------------------------------- sub syncServers { #use CFM -- all commands that call this function need to use CFM my ($class, $DestNodeHash) = @_; if(defined $ENV{'CSM_SKIP_ISVR'} && $ENV{'CSM_SKIP_ISVR'} !=0){ return 0; } my $sHash = InstallUtils->makeSyncHash($DestNodeHash); if (!keys %::INSTALL_SERVERS) { #there are no install servers return 0; } my $distro = NodeUtils->get_DistributionName(); #rsync is no longer used for SuSE and SLES # if(($distro eq "SuSE") || ($distro eq "SLES")){ # CFM->rsyncIsvrs($sHash); #PROBLEM: the links are being made wrong: RPMS -> /csminstall/Linux/SuSE/8.0/i386/SuSE/RPMS or wait, # } # else{ #use rdist my $distlocation = "/tmp/csm_servers"; CFM->createGenDistfile($sHash, $distlocation); CFM->distGenDistfile($distlocation); # } } #-------------------------------------------------------------------------------- =head2 Filesystem Layer =cut #-------------------------------------------------------------------------------- =head3 copyBinaries This function takes functionality from installms so that the commands updatenode, rmnode, and csmsetupnim can ensure that the latest binaries are located in the /csminstall/csm directory. This function does the following: 1. create the /csminstall/csm directory if it doesn't exist 2. create the /csminstall/csm/script directories 3. copy the binaries into /csminstall/csm, including the defs and pkdefs directory, if the timestamp of the files in /csminstall/csm are older than those installed on the system. 4. copies updateglibc._RedHat80Nodes for RedHat 5. copies /tftpboot files for Linux 6. Copies hardware control ucode files on AIX to /csminstall/AIX/ucode Arguments: none Returns: none Globals: $::PREINSTALLDIR $::POSTINSTALLDIR $::UPDATEDIR $::SCRIPTDATADIR" Error: none Example: ServerUtils->copyBinaries; Comments: none =cut #-------------------------------------------------------------------------------- sub copyBinaries { my ( $class, $osname, # eg Linux or AIX (case sensitive) $distro_name, # eg RedHat or SuSE (case sensitive) $distro_version, # eg 7.3 or 5.2 $hw_arch, # eg i386, ppc $csm_version, # eg 1.3.0 ) = @_; my $INSTALLDIR_CSM = "/csminstall/csm"; # # Get information about the OS, distribution, and package # my %pkginfo; ($osname) and $pkginfo{'OSName'} = $osname; (!$osname) and $pkginfo{'OSName'} = InstallUtils->get_OSName; #AIX/Linux ($distro_name) and $pkginfo{'DistributionName'} = $distro_name; (!$distro_name) and $pkginfo{'DistributionName'} = NodeUtils->get_DistributionName; ($distro_version) and $pkginfo{'DistributionVersion'} = $distro_version; (!$distro_version) and $pkginfo{'DistributionVersion'} = NodeUtils->get_DistributionVersion; ($hw_arch) and $pkginfo{'PkgArchitecture'} = $hw_arch; (!$hw_arch) and $pkginfo{'PkgArchitecture'} = InstallUtils->get_PkgArchitecture; if ($pkginfo{'PkgArchitecture'} =~ /i.86/) { $pkginfo{'PkgArchitecture'} = "i386"; } ($csm_version) and $pkginfo{'CsmCoreVersion'} = $csm_version; (!$csm_version) and $pkginfo{'CsmCoreVersion'} = InstallUtils->get_CSMVersion("csm\.core"); if (length($pkginfo{'CsmCoreVersion'}) == 0) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E2', 'EMsgNO_CORE'); } # # Create the /csminstall/csm directory if it doesn't exist # NOTE: This function will not create any operating system specific # directories, such as /csminstall/csm/AIX if (!-d "$INSTALLDIR_CSM") { mkpath($INSTALLDIR_CSM, $::VERBOSE, 0755); } # make the script sub-directories if they don't exist if (!-d "$::PREINSTALLDIR") { mkpath($::PREINSTALLDIR, $::VERBOSE, 0755); } if (!-d "$::POSTINSTALLDIR") { mkpath($::POSTINSTALLDIR, $::VERBOSE, 0755); } if (!-d "$::UPDATEDIR") { mkpath($::UPDATEDIR, $::VERBOSE, 0755); } if (!-d "$::SCRIPTDATADIR") { mkpath($::SCRIPTDATADIR, $::VERBOSE, 0755); } # # Store the pkgdefs into a hash # my %Svrpkgdefs = InstallUtils->get_pkgdefs( $pkginfo{'OSName'}, $pkginfo{'DistributionName'}, $pkginfo{'DistributionVersion'}, $pkginfo{'PkgArchitecture'}, "MgmtServer", $pkginfo{'CsmCoreVersion'} ); # # Get the list of binaries to copy # my @csm_bin_file_csm = (@{$Svrpkgdefs{csm_bin_copy_csm}}); my @csm_bin_file_tftpboot = (@{$Svrpkgdefs{csm_bin_copy_tftpboot}}); # Files to copy to /csminstall/csm foreach my $bin_file (@csm_bin_file_csm) { my @temper_val = (); my $temper_file = (); @temper_val = split(/\//, $bin_file); $temper_file = $temper_val[$#temper_val]; $temper_file = $INSTALLDIR_CSM . "\/" . $temper_file; if (-e $temper_file) { my $exception = ©_exceptions_rveg($distro_name, $temper_file); if ($exception == $::OK) { NodeUtils->runcmd("$::RM -rf $temper_file", -2); NodeUtils->runcmd("$::COPY -pr $bin_file $INSTALLDIR_CSM", -2); } } else { my $exception = ©_exceptions_rveg($distro_name, $bin_file); if ($exception == $::OK) { NodeUtils->runcmd("$::COPY -pr $bin_file $INSTALLDIR_CSM", -2); } } } # # copy the files in /opt/csm/install/sample_scripts to /csminstall/csm/scripts # NodeUtils->runcmd( "$::COPY -p /opt/csm/install/sample_scripts/* $::SCRIPTDIR", 0); # Copy updateglibc scripts to /csminstall/csm/scripts if DistributionName is # RedHat #todo: only do copies of scripts with ._ if the nodegrp exists. # if ( $pkginfo{'DistributionName'} eq "RedHat" ) # { # NodeUtils->runcmd("$::COPY -p /opt/csm/install/scripts/installprereboot/updateglibc._RedHat80Nodes $::SCRIPTDIR/installprereboot/.", -2 ); # } if (( $pkginfo{'OSName'} eq "Linux" ) && ( $::PLTFRM ne "AIX" )) { my $MS_Arch = `/bin/uname -m`; if (($MS_Arch =~ /ppc/) && ($pkginfo{'PkgArchitecture'} =~ /i.86/)) { my $rpmdir = InstallUtils->getRPMSDir( $osname, # eg Linux or AIX (case sensitive) $distro_name, # eg RedHat or SuSE (case sensitive) $distro_version, # eg 7.3 or 5.2 $hw_arch, # eg i386, ppc ); #"Linux", $distname, $distvers, $arch); $::FIND = "/usr/bin/find"; $::GREP = "/bin/grep"; my $cmd; if ($distro_name =~ /RedHat/) { $cmd = "$::FIND $rpmdir/ -type f | $::GREP \'syslinux\'"; } else { $cmd = "$::FIND $::INSTALLDIR_CSMPKG -type f | $::GREP \'syslinux\'"; } my $res = `$cmd`; chomp $res; if ($res ne "") { $res = `rm -fr /tmp/dir4syslinux; mkdir -p /tmp/dir4syslinux; cd /tmp/dir4syslinux; $::RPM2CPIO $res | cpio -idu --quiet;`; my $cmd = "$::FIND /tmp/dir4syslinux -type f | $::GREP \'pxelinux\.0\'"; my $res = `$cmd`; chomp $res; @csm_bin_file_tftpboot = ($res); } } # Files to copy to /tftpboot foreach my $bin_file (@csm_bin_file_tftpboot) { NodeUtils->runcmd("$::COPY $bin_file /tftpboot", -2); } # after files are copied, change the permission: InstallUtils->secureFilePermissions('/tftpboot', '0110', '0440'); #files needed for RMC thin client which is used by the nodes to # communicate to the MS during install my $HW_ARCH = $pkginfo{'PkgArchitecture'}; my $MS_ARCH = ArchiveUtils->get_PkgArchitecture(); if ($MS_ARCH =~ /i.86/) { $MS_ARCH = "i386"; } if ($MS_ARCH =~ /ppc64/) { $MS_ARCH = "ppc"; } if ($HW_ARCH =~ /ppc64/) { $HW_ARCH = "ppc"; } if ($HW_ARCH =~ /x86_64/) { $HW_ARCH = "i386"; } #Use i386 RPMs for x86_64 if ($MS_ARCH =~ /x86_64/) { $MS_ARCH = "i386"; } #Use i386 RPMs for x86_64 #print "NODE_ARCH = $HW_ARCH, MS_ARCH = $MS_ARCH\n"; my $extractdir = "/"; if ($HW_ARCH ne $MS_ARCH) { # Extract all the files from the rsct.core and rsct.core.utils rpms # into $extractdir my $rsct_rpm_filename; my $cmd; $extractdir = "/tmp/dir4rsctrpm"; mkpath($extractdir, $::VERBOSE, 0755); $cmd = "$::RM -rf $extractdir/*"; NodeUtils->runcmd($cmd); foreach my $rpm ("rsct.core", "rsct.core.utils") { $rsct_rpm_filename = $::PathVersionName{$HW_ARCH}{$rpm}{"Location"} . "/" . $::PathVersionName{$HW_ARCH}{$rpm}{"Longname"} . ".${HW_ARCH}.rpm"; #print "RPM NAME = $rsct_rpm_filename\n"; if (!-f $rsct_rpm_filename) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E1", "EMsgFILE_NOT_FOUND", $rsct_rpm_filename); } $cmd = "cd $extractdir; $::RPM2CPIO $rsct_rpm_filename | cpio -idu --quiet;"; NodeUtils->runcmd($cmd, 0); } } my @files = ( "/usr/sbin/rsct/lib/libct_mc.so", "/usr/sbin/rsct/lib/libct_cu.so", "/usr/sbin/rsct/lib/libct_tr.so", "/usr/sbin/rsct/lib/libct_pmsg.so", "/usr/sbin/rsct/lib/libct_sec.so", "/usr/sbin/rsct/lib/libct_idm.so", "/usr/sbin/rsct/lib/libct_ffdc.so", "/usr/sbin/rsct/cfg/ctsec.cfg", "/usr/sbin/rsct/bin/runact-api", ); my $targetdir = "/csminstall/csm/$HW_ARCH"; mkpath($targetdir, $::VERBOSE, 0755); foreach my $file (@files) { $file = "$extractdir$file"; if (!-f $file) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", "EMsgNO_CopyFile", $file, $targetdir); } else { NodeUtils->runcmd("$::COPY -p $file $targetdir", -2); } } } # Copies hardware control ucode files on AIX to /csminstall/AIX/ucode if ($pkginfo{'OSName'} eq "AIX") { if (!-e "/csminstall/AIX/ucode") { mkdir "/csminstall/AIX/ucode", 0077; } #NodeUtils->runcmd( "$::COPY -pr /opt/csm/install/ucode/ /csminstall/AIX/", -2); } } #-------------------------------------------------------------------------------- =head3 copy_csm_scripts This function copies customization scripts from /opt/csm/install/scripts/ to /csminstall/csm/scripts. If the extension of the script matches a defined node group or there is no extension, then copy the script. If the $verify parameter is 1, this function checks the target dir if the scripts exist, if no, it will copy the scripts, otherwise, it will do nothing. If the $verify parameter is 0,this function will always copy the scripts. Arguments: $verify - either 1 or 0 Returns: $::OK $::NOK Globals: $::NODEGRP $::PREINSTALLDIR $::POSTINSTALLDIR $::UPDATEDIR Error: csmInstall.cat 'E'_ Example: ServerUtils->copy_csm_scripts(1); Comments: none =cut #-------------------------------------------------------------------------------- sub copy_csm_scripts { my ($class, $verify) = @_; my $INSTALLPREREBOOT = "/opt/csm/install/scripts/installprereboot"; my $INSTALLPOSTREBOOT = "/opt/csm/install/scripts/installpostreboot"; my $UPDATE = "/opt/csm/install/scripts/update"; my @groupname; my $targetdir; my $filename; my $basename; my $extension; my $junk; my $cmd; $cmd = "$::NODEGRP"; @groupname = NodeUtils->runcmd($cmd, -1); if ($::RUNCMD_RC) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgCANT_RUN', $cmd, $::RUNCMD_RC); return $::NOK; } foreach my $dirname ($INSTALLPREREBOOT, $INSTALLPOSTREBOOT, $UPDATE) { if ($dirname eq $INSTALLPREREBOOT) { $targetdir = $::PREINSTALLDIR; } elsif ($dirname eq $INSTALLPOSTREBOOT) { $targetdir = $::POSTINSTALLDIR; } elsif ($dirname eq $UPDATE) { $targetdir = $::UPDATEDIR; } if (-d $dirname) { if (!-d $targetdir) { mkpath($targetdir, $::VERBOSE, 0755); } $cmd = "$::LS $dirname"; my @filelist = NodeUtils->runcmd($cmd, -1); if ($::RUNCMD_RC) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgCANT_RUN', $cmd, $::RUNCMD_RC); return $::NOK; } foreach $filename (sort @filelist) { chomp $filename; if (-d "$dirname/$filename") { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "I", 'IMsgSkipSubDir', "$dirname/$filename"); next; } if (!-x "$dirname/$filename") { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgSkipScript', "$dirname/$filename"); next; } if (-e "$targetdir/$filename") { $cmd = "/usr/bin/diff $dirname/$filename $targetdir/$filename"; my $temp = NodeUtils->runcmd($cmd, -1); if ($temp) { if ($::VERBOSE) { NodeUtils->message('W', 'IMsgScriptUpdate', $filename); } } } ($basename, $extension, $junk) = split(/\._/, $filename); if (defined($junk)) { next; } if (!defined($extension) || grep(/^$extension$/, @groupname)) { if ( (!$verify) || (($verify) && (!-e "$targetdir/$filename"))) { $cmd = "$::COPY -f $dirname/$filename $targetdir"; NodeUtils->runcmd($cmd, -2); } } } } } return $::OK; } #-------------------------------------------------------------------------------- =head3 create_directory_structure Creates the csminstall directory sturctuire on the Managment Server. Globls: Relies on $::PREREQS_ATTR variable for directory names =cut #-------------------------------------------------------------------------------- sub create_directory_structure { NodeUtils->message('I', 'IMsgCreatingDirectories'); mkpath($::INSTALLDIR_CSMVRBIN, $::VERBOSE, 0755); mkpath($::INSTALLDIR_CSMBIN, $::VERBOSE, 0755); mkpath($::PREINSTALLDIR, $::VERBOSE, 0755); mkpath($::POSTINSTALLDIR, $::VERBOSE, 0755); mkpath($::UPDATEDIR, $::VERBOSE, 0755); mkpath($::SCRIPTDATADIR, $::VERBOSE, 0755); mkpath($::INSTALLDIR_CSMPKG, $::VERBOSE, 0755); ArchiveUtils->createRPMSdir( $::PREREQS_ATTR{'OSName'}, $::PREREQS_ATTR{'DistributionName'}, $::PREREQS_ATTR{'DistributionVersion'}, $::PREREQS_ATTR{'PkgArchitecture'} ); # we need the tftpboot directory. But if it is a file then # we need the user to remove it: if (-f "/tftpboot") { NodeUtils->message('E2', 'EMsgNo_Directory', "\/tftpboot"); } else { # now we can create the directory with the appropriate # permissions: mkpath("/tftpboot", $::VERBOSE, 0110); } } #-------------------------------------------------------------------------------- =head3 getBaseDir Get the base directory for the install attribute parameters Arguments: $InstallOSName $InstallDistributionName $InstallDistributionVersion $InstallPkgArchitectur Returns: approparite base directory for parameters Globals: none Error: undefined Example: $::DISTRO_TOP = ServerUtils->getBaseDir("Linux", $::DISTRO_NAME, $::DISTRO_VERSION, $::ARCH); Comments: none =cut #-------------------------------------------------------------------------------- sub getBaseDir { my ($class, $os, $distributor, $version, $arch) = @_; if ($arch =~ /i.86/) { $arch = "i386"; } return "/csminstall/$os/$distributor/$version/$arch"; } #-------------------------------------------------------------------------------- =head3 getInstallDir Returns the install directory path name for the Install Attribute parameters. Arguments: $InstallOSName $InstallDistributionName $InstallDistributionVersion $InstallPkgArchitectur Returns: Appropriate path name Globals: none Error: undefined Example: unused Comments: unused?? =cut #-------------------------------------------------------------------------------- sub getInstallDir { my ($class, $os, $distributor, $version, $arch) = @_; if ($arch =~ /i.86/) { $arch = "i386"; } return "/csminstall/$os/$distributor/$version/$arch/install"; } #-------------------------------------------------------------------------------- =head3 getUpdateDir Returns the update directory for the install attritbute parameters Arguments: $InstallOSName $InstallDistributionName $InstallDistributionVersion $InstallPkgArchitectur Returns: Appropriate path name of the attribute input Globals: none Error: undefined Example: my $updateDir = ServerUtils->getUpdateDir($OS, $dist, $distver, $arch); Comments: none =cut #-------------------------------------------------------------------------------- sub getUpdateDir { my ($class, $os, $distributor, $version, $arch) = @_; if ($arch =~ /i.86/) { $arch = "i386"; } return "/csminstall/$os/$distributor/$version/$arch/updates"; } #-------------------------------------------------------------------------------- =head3 post_csm_copy Post copy function Arguments: None Returns: none Globals: $::PREREQS_ATTR $::ATTRS $::LCSEXT $::INSTALLDIR_CSMPKG Error: E2, EMsgINVALID_OSTYPE Example: ServerUtils->post_csm_copy; Comments: none =cut #-------------------------------------------------------------------------------- sub post_csm_copy { if ( ($::PREREQS_ATTR{'OSName'} eq "Linux") || ($::ATTRS{'InstallOSName'} eq "Linux")) { # Link the packages directory to a location that addlcsext can use with its default -p if ($::LCSEXT eq "true") { my $cmd; if (!-d "/opt/csm/lcsext") { $cmd = "$::MKDIR /opt/csm/lcsext"; NodeUtils->runcmd($cmd, 0); } else { $cmd = "$::RM /opt/csm/lcsext/packages"; NodeUtils->runcmd($cmd, 0); } $cmd = "$::LN -sf $::INSTALLDIR_CSMPKG /opt/csm/lcsext/packages"; NodeUtils->runcmd($cmd, 0); } } elsif ($::PREREQS_ATTR{'OSName'} eq "AIX") { } else { NodeUtils->message('E2', 'EMsgINVALID_OSTYPE'); } } #-------------------------------------------------------------------------------- =head3 returnSubdirectory Returns all the sub directories of the input parameter. Arguments: $directoryName $validDir - (optional) value of 1 if defined Returns: array of subdirectory names Globals: $::PLTFRM Error: undefined Example: push @::PKGPATH, (ServerUtils->returnSubdirectory($p)); Comments: the $validDir parameter, when set to 1 checks if the parent directory to the $directoryName parmeter is valid. =cut #-------------------------------------------------------------------------------- sub returnSubdirectory { my ($class, $dir, $valid_dir) = @_; my $file; my @subdirs = (); my @returndirs = (); my @valid_subdirs = (); #these are ones whose children we can look at if ($::PLTFRM eq "AIX") { if ($dir =~ m/(installp.?\z)|(usr.?\z)|(RPMS.?\z)/) { #check to see if the parent is valid $valid_dir = 1; } } opendir(DIRECTORY, $dir) or return (); while ($file = readdir(DIRECTORY)) { if ($file ne '.' and $file ne '..') { my $filename; if ($dir =~ /\/\z/) { #if it ends with a slash $filename = "$dir$file"; } else { #no slash $filename = "$dir/$file"; } if ((-d "$filename") && ($::PLTFRM eq "AIX")) { if (!$valid_dir) { #the parent wasn't an valid directory if ( ($file eq "installp") || ($file eq "usr") || ($file eq "RPMS")) { push @valid_subdirs, $filename; } } else { #a valid parent, so therefore its children are valid too push @valid_subdirs, $filename; } } } } closedir(DIRECTORY); push @returndirs, @valid_subdirs; push @returndirs, @subdirs; foreach my $sub (@valid_subdirs) { #these are valid children my @tmpdirs = InstallUtils->returnSubdirectory($sub, 1); push @returndirs, @tmpdirs; } return @returndirs; } #-------------------------------------------------------------------------------- =head2 File Layer =cut #-------------------------------------------------------------------------------- =head3 CreateRandomName Create a randome file name. Arguments: Prefix of name Returns: Prefix with 8 random letters appended Error: none Example: $file = ServerUtils->CreateRandomName($namePrefix); Comments: None =cut #-------------------------------------------------------------------------------- sub CreateRandomName { my ($class, $name) = @_; my $nI; for ($nI = 0 ; $nI < 8 ; $nI++) { my $char = ('a' .. 'z', 'A' .. 'Z')[int(rand(52)) + 1]; $name .= $char; } $name; } #-------------------------------------------------------------------------------- =head3 create_nodemap_file Create /csminstall/csm/config/nodemap file that contains a mapping of ManagedNode hostnames as defined in the CSM database, and node hostnames as returned by the hostname command. Arguments: $ref_nodeList $ref_nodeInfo $ref_DestNodeHash Returns: $::OK $::NOK Globals: $::NODE_LIST_FILE Error: $::NOK Example: if( ServerUtils->create_nodemap_file ( \@::NODELIST, \@::LSNODE_INFO, \%::NODEHASH) != 0){ blah; } Comments: File format - csm_hostnamenode_hostname =cut #-------------------------------------------------------------------------------- sub create_nodemap_file { my ($class, $ref_nodelist, $ref_nodeinfo, $ref_DestNodeHash) = @_; my @nodelist = @$ref_nodelist; my @nodeinfo = @$ref_nodeinfo; # DestNodeHash is a hash containing attribute values for each node # that was provided on the command line. my %DestNodeHash = %$ref_DestNodeHash; %main::dsh_failed = (); my ($cmd, @dshout, $rc); my ($csm_nodename, $csmnode, $hostname); my $csmcfgdir = "/csminstall/csm/config"; my $nodemap_file = "/csminstall/csm/config/nodemap"; my $node; my $dshresult = ""; # # Check and/or create the /csminstall/csm/config directory # if (!-d $csmcfgdir) { $cmd = "$::MKDIR -m 755 -p $csmcfgdir"; $rc = system("$cmd"); if ($rc >> 8) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgNO_CreateDir', $csmcfgdir ); return ($::NOK); } } # Remove any old occurences of the nodemap file if (-f $nodemap_file) { $cmd = "$::RM $nodemap_file"; $rc = system("$cmd") >> 8; if ($rc != 0) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgNO_RM', "$nodemap_file" ); # try to continue } } # open the map file unless (open(NODEMAP, ">$nodemap_file")) { # print error message NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgCANT_WRITE_FILE', "$nodemap_file" ); return $::NOK; } my @AIX; my @Linux; my %found = (); my %dups = (); # for each node in the node list foreach $node (keys %DestNodeHash) { # set the correct command based on the InstallOSName if (defined($DestNodeHash{$node}{'InstallOSName'})) { if ($DestNodeHash{$node}{'InstallOSName'} eq "AIX") { #$dshcmd = "$::DSH -n$node hostname"; push @AIX, $node; } elsif ($DestNodeHash{$node}{'InstallOSName'} eq "Linux") { #$dshcmd = "$::DSH -n$node hostname -f"; push @Linux, $node; } } } if (@Linux) { my $node_file = InstallUtils->make_node_list_file(\@Linux) ; #put all dest nodes in tmp file $ENV{'DSH_LIST'} = $node_file; my $dshcmd = "$::DSH hostname -f"; my @dshresult = `$dshcmd`; $rc = $? >> 8; InstallUtils->close_delete_file($::NODE_LIST_FILE, $node_file) ; #delete node file if ($rc != 0) { # print error message NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCMD_FAILED_RC', $dshcmd, $rc ); #$main::dsh_failed{$node}=1; #take these out of target nodes #next; } foreach my $line (@dshresult) { my ($csmnode, $hostname) = split(" ", $line); $hostname =~ s/://g; $csmnode =~ s/://g; if (defined($csmnode) && defined($hostname)) { # make sure the format is consistent with the name that # was used to create the configinfo file #$csm_nodename = NodeUtils->tryHost($csmnode); $found{$csmnode} = 1; $dups{$hostname}{$csmnode} = 1; # put the result in the nodemap file unless (print NODEMAP "$csmnode $hostname\n") { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_WRITEtoFILE', "$nodemap_file"); } } } } if (@AIX) { my $node_file = InstallUtils->make_node_list_file(\@AIX) ; #put all dest nodes in tmp file $ENV{'DSH_LIST'} = $node_file; my $dshcmd = "$::DSH hostname"; my @dshresult = `$dshcmd`; $rc = $? >> 8; InstallUtils->close_delete_file($::NODE_LIST_FILE, $node_file) ; #delete node file if ($rc != 0) { # print error message NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCMD_FAILED_RC', $dshcmd, $rc ); #$main::dsh_failed{$node}=1; #take these out of target nodes #next; } foreach my $line (@dshresult) { my ($csmnode, $hostname) = split(" ", $line); $hostname =~ s/://g; $csmnode =~ s/://g; if (defined($csmnode) && defined($hostname)) { # make sure the format is consistent with the name that # was used to create the configinfo file #$csm_nodename = NodeUtils->tryHost($csmnode); $found{$csmnode} = 1; $dups{$hostname}{$csmnode} = 1; # put the result in the nodemap file unless (print NODEMAP "$csmnode $hostname\n") { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_WRITEtoFILE', "$nodemap_file"); } } } } #foreach my $n (keys %DestNodeHash){ # if(!$found{$n}){ # $main::dsh_failed{$n}=1; # } # } foreach my $n (keys %dups) { #get rid of any nodes that map to the same hostname if (scalar(keys %{$dups{$n}}) > 1) { my @dupNodes = keys %{$dups{$n}}; my $dNstring = join ',', @dupNodes; my $hostname = $n; NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgHostnameMap', $hostname, $dNstring ); foreach my $d (@dupNodes) { $main::dsh_failed{$d} = 1; } } } close(NODEMAP); if (!@AIX && !@Linux) { return $::NOK; } return $::OK; } #-------------------------------------------------------------------------------- =head3 createSMSConfig Put SMS node group info into the file: /csminstall/csm/var/smsupdate.info Arguments: none Returns: reference to a hash of all groups Globals: none Error: NodeUtil message E Example: #create the SMS nodegroup config file ServerUtils->createSMSConfig(); Comments: none =cut #-------------------------------------------------------------------------------- sub createSMSConfig { my %all_groups = (); my %node_index; my @empty_array = (); if (-e "/csminstall") { if (!-e "/csminstall/csm") { mkdir "/csminstall/csm", 0077; mkdir "/csminstall/csm/config", 0077; } } my $ref_nodegrp = NodeUtils->listNodeGroupExpMem(@empty_array); foreach my $row (@$ref_nodegrp) { my ($groupname, $nodelist) = $row =~ /^(.+):\|:\{(.*)\}$/; my @nodes = split(/,/, $nodelist); foreach my $node (@nodes) { push @{$node_index{$node}}, $groupname; push @{$all_groups{$groupname}}, $node; } } system("$::MKDIR -p /csminstall/csm/config/"); open(GROUPFILE, ">/csminstall/csm/config/sms.info") or NodeUtils->message('E', 'EMsgCANT_OpenFile', "/csminstall/csm/config/sms.info", "$? $!"); foreach my $node (keys %node_index) { print GROUPFILE "$node: @{$node_index{$node}} \n"; } close GROUPFILE; return \%all_groups; } #-------------------------------------------------------------------------------- =head3 get_script_list For a given directory get a list of scripts and associated list of nodes to run it on. Arguments: $directoryName @nodeList Returns: $::OK $::NOK Globals: @::scriptlist @{$::scriptnodes{$fname}} Error: $::NOK Example: $rc = ServerUtils->get_script_list($dirname,@nodelist); Comments: none =cut #-------------------------------------------------------------------------------- sub get_script_list { my ($junk, $dirname, @nlist) = @_; my %basename; my $target; my $filename; my @filelist; my $cmd; @::scriptlist = (); if (-d $dirname) { $cmd = "$::LS $dirname"; @filelist = NodeUtils->runcmd($cmd, -1); if ($::RUNCMD_RC) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgCANT_RUN', $cmd, $::RUNCMD_RC ); return $::NOK; } } else { # msg - Warning: The \'$dirname\' does not exist. # Skipping to the next directory. NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgSkipDir', $dirname); return $::NOK; } # check each script name in this directory # - add the filename to the script list # - get the initial list of node to run the script on # - save the basename for each script foreach $filename (sort @filelist) { chomp $filename; # make sure this is not a subdir if (-d "$dirname/$filename") { # error - Skipping subdirectory $dirname/$filename. NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "I", 'IMsgSkipSubDir', "$dirname/$filename" ); next; } # figure out what nodes to run the script on by # deciphering the script name @{$::scriptnodes{$filename}} = InstallUtils->name2list($dirname, $filename, @nlist); if (${$::scriptnodes{$filename}}[0] eq $::NOK) { # msg - Skipping to the next script name. NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgSkipScript'); next; } push @::scriptlist, $filename; (@basename{$filename}, $target) = split(/\._/, $filename); } # now check each script that has no extension (target) and see # if there are any scripts with the same basename that have targets # if there are - remove any nodes in the targeted script list from the # list of nodes for the script with no extensions(target) # ex. say script foo goes to all nodes and script foo._grpa goes # to node1 & node2. In this case I need to remove node1 & node2 # from the list of nodes for the script foo. foreach my $fname (sort @::scriptlist) { chomp $fname; # if the script name is the same as the basename then # the list is all the nodes passed in on the command line. if ($fname eq @basename{$fname}) { # check the rest of the scripts to see if any # have the same basename - if we find one then redo # the list for the basename-only script foreach my $file (@::scriptlist) { chomp $file; # see if the basenames are the same if (@basename{$fname} eq @basename{$file}) { # don't remove itself if ($file ne $fname) { my @tmplist = (); foreach my $node (@{$::scriptnodes{$fname}}) { # if the node is not in the list for $file # then add it to a temp list if (!grep /^$node/, @{$::scriptnodes{$file}}) { push @tmplist, $node; } } @{$::scriptnodes{$fname}} = @tmplist; } } } } } return $::OK; } #-------------------------------------------------------------------------------- =head3 make_config_file Create configuration information files for each node provided in the nodelist reference argument. Arguments: $ref_nodeList $ref_nodeinfo $ref_DestinationNodeHash Returns: $::OK $::NOK Globals: $::SETUP_REMOTE_SHELL $::NOSMS Error: $::NOK Example: if(ServerUtils->make_config_file( \@DestNode, \@lsnode_info, \%DestNodeHash) != 0) { blah; } Comments: Requires $::REMOTE_SHELL and $::SETUP_REMOTE_SHELL to be set optionally, $::NOSMS can be set to instruct makenode to not perform software maintenance on Linux nodes =cut #-------------------------------------------------------------------------------- sub make_config_file { my ($class, $ref_nl, $ref_nodeinfo, $ref_DestNodeHash) = @_; my @nl = @$ref_nl; my @nodeinfo = @$ref_nodeinfo; # DestNodeHash is a hash containing attribute values for each node # that was provided on the command line. my %DestNodeHash = %$ref_DestNodeHash; my ($hname, $short, $rc); my $csmcfgdir = "/csminstall/csm/config"; my $cmd; my $output; my $DirectorInstalled = 0; my ($host, $ipaddr, $shorthost); # # Check and/or create the /csminstall/csm/config directory # if (!-d $csmcfgdir) { $cmd = "$::MKDIR -m 755 -p $csmcfgdir"; $rc = system("$cmd"); if ($rc >> 8) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgNO_CreateDir', $csmcfgdir ); return ($::NOK); } } # If this is a Linux management server, check if csm.director.agent # is installed. if (NodeUtils->isLinux() == 1) { $cmd = "$::RPMCMD -q csm.director.agent"; $output = NodeUtils->runcmd($cmd, -1); if ($::RUNCMD_RC == 0) { $DirectorInstalled = 1; } } # get the lists of user-provided cstomization script # that we need to run on the nodes if (InstallUtils->make_script_lists(@nl)) { # msg -Could not get lists of customization scripts NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgNoCustScripts'); # continue } # # create the config_info file # # go through each node in the list # (the keys are the hostnames as returned from tryHost() !!) foreach $hname (keys %DestNodeHash) { # remove the old config file if any if (-e "$csmcfgdir/$hname.config_info") { $cmd = "$::RM $csmcfgdir/$hname.config_info"; $rc = system("$cmd"); if ($rc >> 8) { my $fn = "$csmcfgdir/$hname.config_info"; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgNO_RM', "$fn"); # try to continue ??return $::NOK; } } # create the new file unless (open(CONFIG_OUT, ">$csmcfgdir/$hname.config_info")) { my $fn = "$csmcfgdir/$hname.config_info"; NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgCANT_WRITE_FILE', "$fn" ); return $::NOK; } # Add cluster-wide configuration information to the file if (defined($::REMOTE_SHELL)) { print CONFIG_OUT "RemoteShell=$::REMOTE_SHELL\n"; } if (defined($::SETUP_REMOTE_SHELL)) { print CONFIG_OUT "SetupRemoteShell=$::SETUP_REMOTE_SHELL\n"; } # add the node configuration information to the file if (defined($hname)) { print CONFIG_OUT "Hostname=$hname\n"; } if (defined($DestNodeHash{$hname}{'ManagementServer'})) { print CONFIG_OUT "ManagementServer=$DestNodeHash{$hname}{'ManagementServer'}\n"; print CONFIG_OUT "ManagementServerIP=" . NetworkUtils->validate_ip( $DestNodeHash{$hname}{'ManagementServer'}) . "\n"; } if (defined($DestNodeHash{$hname}{'InstallOSName'})) { print CONFIG_OUT "InstallOSName=$DestNodeHash{$hname}{'InstallOSName'}\n"; } if (defined($DestNodeHash{$hname}{'InstallCSMVersion'})) { print CONFIG_OUT "InstallCSMVersion=$DestNodeHash{$hname}{'InstallCSMVersion'}\n"; } if (defined($DestNodeHash{$hname}{'InstallDistributionVersion'})) { print CONFIG_OUT "InstallDistributionVersion=$DestNodeHash{$hname}{'InstallDistributionVersion'}\n"; } if (defined($DestNodeHash{$hname}{'InstallDistributionName'})) { print CONFIG_OUT "InstallDistributionName=$DestNodeHash{$hname}{'InstallDistributionName'}\n"; } if (defined($DestNodeHash{$hname}{'InstallPkgArchitecture'})) { print CONFIG_OUT "InstallPkgArchitecture=$DestNodeHash{$hname}{'InstallPkgArchitecture'}\n"; } if (defined($DestNodeHash{$hname}{'Mode'})) { print CONFIG_OUT "Mode=$DestNodeHash{$hname}{'Mode'}\n"; } if (defined($DestNodeHash{$hname}{'ConsoleSerialDevice'})) { print CONFIG_OUT "ConsoleSerialDevice=$DestNodeHash{$hname}{'ConsoleSerialDevice'}\n"; } if (defined($DestNodeHash{$hname}{'InstallServer'}) && ($DestNodeHash{$hname}{'InstallServer'} ne "")) { my $progname = NodeUtils->programName(); if ($progname =~ m/installnode/) { #make sure a machine is not an install server of itself my ($node_hostname, $node_ip) = NodeUtils->getHost($hname); my ($server, $rep_dir) = split ':', $DestNodeHash{$hname}{'InstallServer'}; my ($isvr_hostname, $isvr_ip) = NodeUtils->getHost($server); if ($node_hostname ne $isvr_hostname) { print CONFIG_OUT "InstallServer=$DestNodeHash{$hname}{'InstallServer'}\n"; } } elsif ($DestNodeHash{$hname}{'InstallServer'} ne $DestNodeHash{$hname}{'ManagementServer'}) { #not using the ms as the install server print CONFIG_OUT "InstallServer=$DestNodeHash{$hname}{'InstallServer'}\n"; } } if (defined($DestNodeHash{$hname}{'PowerMethod'})) { print CONFIG_OUT "PowerMethod=$DestNodeHash{$hname}{'PowerMethod'}\n"; } if (defined($DestNodeHash{$hname}{'InstallAdapterMacaddr'})) { print CONFIG_OUT "InstallAdapterMacaddr=$DestNodeHash{$hname}{'InstallAdapterMacaddr'}\n"; } # Handle Linux-specific attributes. if ($DestNodeHash{$hname}{'InstallOSName'} eq "Linux") { # If csm.director.agent is installed on the management server, # then install it on the Linux nodes. print CONFIG_OUT "InstallDirector=$DirectorInstalled\n"; # if $::NOSMS isn't set then perform software maintenance if (!$::NOSMS) { print CONFIG_OUT "SMS=1\n"; } } if (defined($DestNodeHash{$hname}{'ConsoleSerialSpeed'})) { print CONFIG_OUT "ConsoleSerialSpeed=$DestNodeHash{$hname}{'ConsoleSerialSpeed'}\n"; } if (defined($DestNodeHash{$hname}{'InstallMethod'})) { print CONFIG_OUT "InstallMethod=$DestNodeHash{$hname}{'InstallMethod'}\n"; } # put in the SetupKRB5 attribute value if (!defined $::KRB5SETUP) { $::KRB5SETUP = InstallUtils->getSetupKRB5; } print CONFIG_OUT "SetupKRB5=$::KRB5SETUP\n"; # put in what would be the KRB5 principal name for ManagementServer if (!defined $::MSNAME) { $::MSNAME = NodeUtils->getRSCThostname; } my $msnamelower = lc($::MSNAME); print CONFIG_OUT "CSMKRB5Principal=ctsrcmdp.$msnamelower"; # put in what would be the KRB5 principal name for HA ManagementServer if (!defined $::HAMODE) { my $outref = NodeUtils->runrmccmd('lsrsrc-api', "-i", "-s IBM.DmsCtrl::::HAMode"); $::HAMODE = $$outref[0]; } if ($::HAMODE == 1) { #on an active HAMS management server require HAMS; my $inactivems = HAMS->getInactiveRSCTHostname(); # get HA name my $inactivemslower = lc($inactivems); print CONFIG_OUT ",ctsrcmdp.$inactivemslower\n"; } else { print CONFIG_OUT "\n"; } if (($::SETUP_REMOTE_SHELL == 1) && ($::REMOTE_SHELL =~ m/rsh/)) { if (!defined $::HAMODE) { my $outref = NodeUtils->runrmccmd('lsrsrc-api', "-i", "-s IBM.DmsCtrl::::HAMode"); $::HAMODE = $$outref[0]; } if ($::HAMODE == 1) { #on an active HAMS management server #get management server attribute for node on other ms require HAMS; my $other_ms = HAMS->getManagementServerAttr($hname); if ($other_ms) { print CONFIG_OUT "InActiveMSAttr=$other_ms\n"; } } } # # add the /etc/hosts info for the management server - just AIX for now # if ($DestNodeHash{$hname}{'InstallOSName'} eq "AIX") { ($host, $ipaddr) = NodeUtils->getHost($DestNodeHash{$hname}{'ManagementServer'}); ($shorthost = $host) =~ s/\..*$//; print CONFIG_OUT "ETCHOSTSMS=$ipaddr $host $shorthost\n"; } # add lists of scripts to run on the node if (defined(@{$::PREINSTSCRIPTS{$hname}})) { print CONFIG_OUT "PREINSTSCRIPTS=@{$::PREINSTSCRIPTS{$hname}}\n"; } if (defined(@{$::POSTINSTSCRIPTS{$hname}})) { print CONFIG_OUT "POSTINSTSCRIPTS=@{$::POSTINSTSCRIPTS{$hname}}\n"; } if (defined(@{$::UPDATESCRIPTS{$hname}})) { print CONFIG_OUT "UPDATESCRIPTS=@{$::UPDATESCRIPTS{$hname}}\n"; } close(CONFIG_OUT); $cmd = "$::CHMOD 644 $csmcfgdir/$hname.config_info"; $rc = system("$cmd"); if ($rc >> 8) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCMD_FAILED_RC', $::CHMOD, $rc ); # try to continue } #Add symbol link short_hostname.config_info to long_hostname.config_info my ($short_hname) = split('\.', $hname); # this symbolic link will be done only when the short name is not the # same as the long name if ($short_hname ne $hname) { $cmd = "cd $csmcfgdir; $::LN -fs $hname.config_info $short_hname.config_info"; $rc = system("$cmd"); if ($rc >> 8) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCMD_FAILED_RC', $::LN, $rc); } } } # go do the next node return $::OK; } #-------------------------------------------------------------------------------- =head3 make_node_list_file Makes a node list file. Arguments: (\@list_of_nodes) - reference to an arrary of nodes. Returns: $file_name and sets the global var: $::NODE_LIST_FILE Globals: the ENV vars: DSH_LIST, RPOWER_LIST, RCONSOLE_LIST Error: None documented Example: ServerUtils->make_node_list_file(\@nodelist); Comments: IMPORTANT: Make sure to cleanup afterwards with: ServerUtils->close_delete_file($file_handle, $file_name) =cut #-------------------------------------------------------------------------------- sub make_node_list_file { my ($class, $ref_node_list) = @_; my @node_list = @$ref_node_list; srand(time | $$); #random number generator start my $file = "/tmp/csm_$$"; while (-e $file) { $file = InstallUtils->CreateRandomName($file); } open($::NODE_LIST_FILE, ">$file") or NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgCANT_WRITE_FILE', "$file"); foreach my $node (@node_list) { print $::NODE_LIST_FILE "$node\n"; } return $file; } #-------------------------------------------------------------------------------- =head3 make_script_lists Create lists of pre-install, post-install and update scrips for each node and put them in the following global hashes: %::PREINSTSCRIPTS - scripts get run from csmprereboot during full install before the first reboot. %::POSTINSTSCRIPTS - scripts get run from csmfirstboot after the first reboot of the system. %::UPDATESCRIPTS - scripts get run from updatenode.client after a node has been updated. Arguments: @nodelist Returns: $::OK - on success 1 - on error Globals: %::PREINSTSCRIPTS %::POSTINSTSCRIPTS %::UPDATESCRIPTS Example: if( ServerUtils->make_script_lists(@nodelist) ) { blah; }_ Comments: none =cut #-------------------------------------------------------------------------------- sub make_script_lists { my ($junk, @nodel) = @_; # the list of nodes passed in on the command line my $dirname; # directory to check for scripts my $script; # unique script name my $cmd; my $rc; @::scriptlist; # list of scripts found in a directory %::scriptnodes; # lists of nodes to run each script on # get the list of all nodes so we can check # for valid node names later $cmd = "$::LSNODE"; @::allnodes = NodeUtils->runcmd($cmd, -1); if ($::RUNCMD_RC) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $::RUNCMD_RC); return $::NOK; } my @scriptdirlist; if ($::UPDATESCRIPTSONLY) { @scriptdirlist = ($::UPDATEDIR); } else { @scriptdirlist = ($::PREINSTALLDIR, $::POSTINSTALLDIR); } # check each subdirectory for user scripts foreach $dirname (@scriptdirlist) { $rc = InstallUtils->get_script_list($dirname, @nodel); if ($rc == $::NOK) { next; } # check each script name in this directory foreach $script (sort @::scriptlist) { chomp $script; # see if there are any nodes in the list if (@{$::scriptnodes{$script}}[0] eq $::NOK) { # msg - Skipping to the next script name. NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgSkipScript'); next; } # see if the script is executable if (!(-x "$dirname/$script")) { # msg - Script $script is not executable. NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgExecScript', "$dirname/$script"); # msg - Skipping to the next script name. NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgSkipScript'); next; } # add the file to the correct script list for the node foreach my $node (@{$::scriptnodes{$script}}) { chomp $node; if ($dirname eq $::PREINSTALLDIR) { push @{$::PREINSTSCRIPTS{$node}}, $script; } elsif ($dirname eq $::POSTINSTALLDIR) { push @{$::POSTINSTSCRIPTS{$node}}, $script; } elsif ($dirname eq $::UPDATEDIR) { push @{$::UPDATESCRIPTS{$node}}, $script; } } } } return $::OK; } #-------------------------------------------------------------------------------- =head3 name2list Convert a script file name to a list of nodes that the script can be run on. Arguments: $dirname, $filename @nlist Returns: array of node names. Error: 1 - An error occured. # Globals: Requires @::allnodes be set by caller Example: @{$::scriptnodes{$filename}}= ServerUtils->name2list($dirname,$filename,@nlist);_ Comments: The file name format is ._. If there is just a basename then it applies to all nodes. If there is a node name then it just applies to that node. If there is a group name then it applies to the members of the group. =cut #-------------------------------------------------------------------------------- sub name2list { my ($junk, $dirname, $filename, @nlist) = @_; my @nodelist = (); my ($base, $name, @glist); my ($short, $target, $cmd); my $junk2; chomp $filename; # the second part of the file name tells us # what nodes to run it on # also check if additional target was used - error ($base, $target, $junk2) = split(/\._/, $filename); if (defined($junk2)) { # \'$filename\' is not a valid customization script name. NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgBadScriptName', "$dirname/$filename" ); return $::NOK; } if (!defined($target)) { # do on all nodes the calling # command was asked to process return @nlist; } else { # see if the target is a valid node name my ($hostname, $ipaddr) = NodeUtils->tryHost($target); if (grep(/^$hostname/, @::allnodes)) { # see if the target is one of the nodes # specified on the command line if (grep(/^$hostname/, @nlist)) { chomp(@nodelist = ($hostname)); } return @nodelist; } # see if target is a valid group name $cmd = "$::NODEGRP -p $target"; @glist = NodeUtils->runcmd($cmd, -1); if ($::RUNCMD_RC) { # msg - An incorrect file name format was used for the script $filename. '$target' is neither a node name nor a group name. NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgBadScript', "$dirname/$filename", $target ); return $::NOK; } else { foreach $name (@glist) { # we only need a node if it was specified # on the command line if (grep(/^$name/, @nlist)) { push(@nodelist, $name); } } return @nodelist; } } return $::NOK; } #-------------------------------------------------------------------------------- =head2 PkgDefs Support =cut #-------------------------------------------------------------------------------- =head3 get_OSDefs Determine which definition files need to be loaded and load them. Read the set of OSDefs variables into a hash and assigns them each to global variables. Calls get_osdefs_files to read the files in /opt/csm/install/defs. The correct file(s) are chosen based on the parameters passed in to get_OSDefs. If no parameters are provided, default values based on the current machine's configuration are filled in. Arguments: $argsProvided. Returns: Array of defintion file names Globals: none Error: undefined Example: my %osdefs = ServerUtils->get_OSDefs(); # Get defs for this host print "CHMOD = $osdefs{'CHMOD'}\n"; # You can also use a global variable: my %osdefs = ServerUtils->get_OSDefs(); # Get for current machine print "CHMOD = $::CHMOD\n"; Comments: The pathnames must be defined in CSMDefs.pm. =cut #-------------------------------------------------------------------------------- sub get_OSDefs { my $class = shift; my $args_provided = (@_); my ( $osname, # eg Linux or AIX (case sensitive) $distro_name, # eg RedHat or SuSE (case sensitive) $distro_version, # eg 7.3 or 5.2 $hw_arch, # eg i386, ppc $csm_version, # eg 1.3.0 $no_globals, # Don't set global variables if set to 1 ) = @_; # Default to setting global variables $no_globals = 0 if (!$no_globals); # Set defaults if no arguments were provided # Note below that some of these require command pathnames to be defined. # Therefore, the pathnames must be defined in CSMDefs.pm. if (!$args_provided) { $osname = $::PLTFRM; $distro_name = NodeUtils->get_DistributionName; #requires no cmds $distro_version = NodeUtils->get_DistributionVersion; #requires LSLPP $hw_arch = InstallUtils->get_PkgArchitecture; #requires UNAME for Linux $csm_version = InstallUtils->get_CSMVersion("csm.core"); #requires RPMCMD and LSLPP } my $munge = join( "|::|", ( $osname, $distro_name, $distro_version, $hw_arch, $csm_version ) ); if ($::all_OSDefs{$munge}) { ($::DEBUG) && print "Found $munge in OSDefs hash\n"; return (%{$::all_OSDefs{$munge}}); } InstallUtils->get_osdefs_files($osname, $distro_name, $distro_version, $hw_arch, $csm_version); # Assign each hash element to a global variable unless $no_globals is set unless ($no_globals) { foreach my $key (keys %::OSDefs) { my $value = $::OSDefs{$key}; # Display the key and the value #print "$key : $value\n"; # Assign each hash element to a global variable. # For example, the following has the effect of setting # $::GREP = $value # In order for this to work, we need to temporarily turn off # strict type checking, until the end of this block. no strict 'refs'; ${"main::$key"} = $value; } } # Store the attributes that were used to obtain this OSdefs $::OSDefs{OSDefs_osname} = $osname; $::OSDefs{OSDefs_distro_name} = $distro_name; $::OSDefs{OSDefs_distro_version} = $distro_version; $::OSDefs{OSDefs_hw_arch} = $hw_arch; $::OSDefs{OSDefs_csm_version} = $csm_version; # Make a local copy of OSDefs my %OSDefs = %::OSDefs; # Add it to all_pkgdefs $::all_OSDefs{$munge} = \%OSDefs; return %OSDefs; } #-------------------------------------------------------------------------------- =head3 get_osdefs_files Determine which definition files need to be loaded and load them. Arguments: $class, $osname, $distro_name, $distro_version, $hw_arch, $csm_version Returns: Array of defintion file names Globals: none Error: undefined Example: ServerUtils->get_osdefs_files($osname, $distro_name, $distro_version, $hw_arch, $csm_version); Comments: Search order on Linux Linux-RedHat7.3-i386.pm, Linux-RedHat7.3.pm, Linux-RedHat.pm, Linux.pm Search order on AIX: AIX-5.2.pm, AIX.pm Search for the files in either /defs or $OSDEFS =cut #-------------------------------------------------------------------------------- sub get_osdefs_files { my ($class, $osname, $distro_name, $distro_version, $hw_arch, $csm_version,) = @_; my $isAIX = ($osname eq "AIX"); # Set these global variables to load the correct values from osdefs. $::csm_version = $csm_version; my $distro = "${distro_name}${distro_version}"; my $osdistro = "${osname}-${distro}"; my @defsfiles; push(@defsfiles, "${osdistro}-${hw_arch}.pm") if (${hw_arch}); push(@defsfiles, "${osdistro}.0-${hw_arch}.pm") if (${hw_arch} and $isAIX); push(@defsfiles, "${osdistro}.pm"); push(@defsfiles, "${osdistro}.0.pm") if ($isAIX); push(@defsfiles, "${osname}-${distro_name}.pm") if (${distro_name}); push(@defsfiles, "${osname}.pm"); my $progdir = dirname($0); foreach my $file (@defsfiles) { foreach my $dir ("$progdir/defs", $::OSDEFS) { my $defsfile = "$dir/$file"; ($::DEBUG) && NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgChecking_For', $defsfile); if (-f $defsfile) { # Using "do" rather than "require" because require only loads # a file once. We might need to load it again with a different # value for csm_version. #require "$defsfile"; do "$defsfile"; return $defsfile; } } } # If we get here, then there was nothing loaded. NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgNoDefsFiles', $::OSDEFS); #die "Error: No OS Definition files to load in $::OSDEFS\n"; } #-------------------------------------------------------------------------------- =head3 get_pkgdefs Read the set of pkgdefs variables into a hash. Calls get_pkgdefs_files to read the files in /opt/csm/install/pkgdefs. The correct file(s) are chosen based on the parameters passed in to get_pkgdefs. If no parameters are provided, default values based on the current machine's configuration are filled in. Arguments: - optional $osname, # eg Linux or AIX (case sensitive) $distro_name, # eg RedHat or SuSE (case sensitive) $distro_version, # eg 7.3 or 5.2 $hw_arch, # eg i386, ppc $mgmt_type, # Either MgmtServer or MgdNode $csm_version, Returns: Hash of pkgdef values by pkgdef variable name Globals: $::all_pkgdefs $::pkgdefs $::mgmt_type $::csm_version Error: undefined Example: my %pkgdefs = ServerUtils->get_pkgdefs(); # Get for current machine print "DISTRO_NAME = $pkgdefs{'DISTRO_NAME'}\n"; # string example print "opensrc_prereqs = " . # array example join(" ", @{$pkgdefs{'opensrc_prereqs'}}) ."\n"; Comments: none =cut #-------------------------------------------------------------------------------- sub get_pkgdefs { my $class = shift; my $args_provided = (@_); my ( $osname, # eg Linux or AIX (case sensitive) $distro_name, # eg RedHat or SuSE (case sensitive) $distro_version, # eg 7.3 or 5.2 $hw_arch, # eg i386, ppc $mgmt_type, # Either MgmtServer or MgdNode $csm_version, # eg 1.3.0 ) = @_; # Set defaults if no arguments were provided # Note below that some of these require command pathnames to be defined. # Therefore, the pathnames must be defined in CSMDefs.pm. if (!$args_provided) { $osname = $::PLTFRM; $distro_name = NodeUtils->get_DistributionName; #requires no cmds $distro_version = NodeUtils->get_DistributionVersion; #requires LSLPP $hw_arch = InstallUtils->get_PkgArchitecture; #requires UNAME for Linux $mgmt_type = "MgmtServer"; $csm_version = InstallUtils->get_CSMVersion("csm.core"); #requires RPMCMD and LSLPP } my $munge = join( "|::|", ( $osname, $distro_name, $distro_version, $hw_arch, $mgmt_type, $csm_version ) ); if ($::all_pkgdefs{$munge}) { ($::DEBUG) && print "Found $munge in pkgdefs hash\n"; return (%{$::all_pkgdefs{$munge}}); } # Set these global variables to load the correct values from pkgdefs. $::mgmt_type = $mgmt_type; $::csm_version = $csm_version; InstallUtils->get_pkgdefs_files($osname, $distro_name, $distro_version, $hw_arch, $mgmt_type, $csm_version); # Store the attributes that were used to obtain this pkgdefs $::pkgdefs{pkgdefs_osname} = $osname; $::pkgdefs{pkgdefs_distro_name} = $distro_name; $::pkgdefs{pkgdefs_distro_version} = $distro_version; $::pkgdefs{pkgdefs_hw_arch} = $hw_arch; $::pkgdefs{pkgdefs_mgmt_type} = $mgmt_type; $::pkgdefs{pkgdefs_csm_version} = $csm_version; # Make a local copy of pkgdefs my %pkgdefs = %::pkgdefs; # Add it to all_pkgdefs $::all_pkgdefs{$munge} = \%pkgdefs; return %pkgdefs; } #-------------------------------------------------------------------------------- =head3 get_pkgdefs_files Determine which definition files need to be loaded and load them. Arguments: $osname, $distro_name, $distro_version, $hw_arch, $mgmt_type, $csm_version Returns: Array of defintion file names Globals: $::mgmt_type $::csm_version Error: csmInstallCat E1 Example: ServerUtils->get_pkgdefs_files($osname, $distro_name, $distro_version, $hw_arch, $csm_version); Comments: Search order on Linux Linux-RedHat7.3-i386.pm, Linux-RedHat7.3.pm, Linux-RedHat.pm, Linux.pm Search order on AIX: AIX-5.2.pm, AIX.pm Search for the files in either /pkgdefs or $PKGDEFS =cut #-------------------------------------------------------------------------------- sub get_pkgdefs_files { my ($class, $osname, $distro_name, $distro_version, $hw_arch, $mgmt_type, $csm_version,) = @_; my $isAIX = ($osname eq "AIX"); # Set these global variables to load the correct values from pkgdefs. $::mgmt_type = $mgmt_type; $::csm_version = $csm_version; my $distro = "${distro_name}${distro_version}"; my $osdistro = "${osname}-${distro}"; my @defsfiles; push(@defsfiles, "${osdistro}-${hw_arch}.pm") if (${hw_arch}); push(@defsfiles, "${osdistro}.0-${hw_arch}.pm") if (${hw_arch} and $isAIX); push(@defsfiles, "${osdistro}.pm"); push(@defsfiles, "${osdistro}.0.pm") if ($isAIX); push(@defsfiles, "${osname}-${distro_name}.pm") if (${distro_name}); push(@defsfiles, "${osname}.pm"); my $progdir = dirname($0); foreach my $file (@defsfiles) { foreach my $dir ("$progdir/pkgdefs", $::PKGDEFS) { my $defsfile = "$dir/$file"; ($::DEBUG) && NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'V', 'IMsgChecking_For', $defsfile); if (-f $defsfile) { # Using "do" rather than "require" because require only loads # a file once. We might need to load it again with different # values for mgmt_type or csm_version. #require "$defsfile"; do "$defsfile"; return $defsfile; } } } # If we get here, then there was nothing loaded. NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E1', 'EMsgNoDefsFiles', $::PKGDEFS); } #-------------------------------------------------------------------------------- 1; k ---------------------- sub CreateRandomName { my ($class, $name) = @_; my $nI; for ($nI = 0 ; $nI < 8 ; $nI++) { my $char = ('a' .. 'z', 'A' .. 'Z')[int(rand(52)) + 1]; $name .= $char; } $name; } #-------------------------------------------------------------------------------- =head3 create_nodemap_file Create /csminstall/csm/config/nodemap file that contains a mapping of ManagedNode hostnames as defined in the CSM database, and node hostnames as returned by the hostname command. Arguments: $ref_nodeList $ref_nodeInfo $ref_DestNodeHash Returns: $::OK $::NOK Globals: $::NODE_LIST_FILE Error: $::NOK Example: if( ServerUtils->create_nodemap_file ( \@::NODELIST, \@::LSNODE_INFO, \%::NODEHASH) != 0){ blah; } Comments: File format - csm_hostnamenode_hostname =cut #-------------------------------------------------------------------------------- sub create_nodemap_file { my ($class, $ref_nodelist, $ref_nodeinfo, $ref_DestNodeHash) = @_; my @nodelist = @$ref_nodelist; my @nodeinfo = @$ref_nodeinfo; # DestNodeHash is a hash containing attribute values for each node # that was provided on the command line. my %DestNodeHash = %$ref_DestNodeHash; %main::dsh_failed = (); my ($cmd, @dshout, $rc); my ($csm_nodename, $csmnode, $hostname); my $csmcfgdir = "/csminstall/csm/config"; my $nodemap_file = "/csminstall/csm/config/nodemap"; my $node; my $dshresult = ""; # # Check and/or create the /csminstall/csm/config directory # if (!-d $csmcfgdir) { $cmd = "$::MKDIR -m 755 -p $csmcfgdir"; $rc = system("$cmd"); if ($rc >> 8) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgNO_CreateDir', $csmcfgdir ); return ($::NOK); } } # Remove any old occurences of the nodemap file if (-f $nodemap_file) { $cmd = "$::RM $nodemap_file"; $rc = system("$cmd") >> 8; if ($rc != 0) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgNO_RM', "$nodemap_file" ); # try to continue } } # open the map file unless (open(NODEMAP, ">$nodemap_file")) { # print error message NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgCANT_WRITE_FILE', "$nodemap_file" ); return $::NOK; } my @AIX; my @Linux; my %found = (); my %dups = (); # for each node in the node list foreach $node (keys %DestNodeHash) { # set the correct command based on the InstallOSName if (defined($DestNodeHash{$node}{'InstallOSName'})) { if ($DestNodeHash{$node}{'InstallOSName'} eq "AIX") { #$dshcmd = "$::DSH -n$node hostname"; push @AIX, $node; } elsif ($DestNodeHash{$node}{'InstallOSName'} eq "Linux") { #$dshcmd = "$::DSH -n$node hostname -f"; push @Linux, $node; } } } if (@Linux) { my $node_file = InstallUtils->make_node_list_file(\@Linux) ; #put all dest nodes in tmp file $ENV{'DSH_LIST'} = $node_file; my $dshcmd = "$::DSH hostname -f"; my @dshresult = `$dshcmd`; $rc = $? >> 8; InstallUtils->close_delete_file($::NODE_LIST_FILE, $node_file) ; #delete node file if ($rc != 0) { # print error message NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCMD_FAILED_RC', $dshcmd, $rc ); #$main::dsh_failed{$node}=1; #take these out of target nodes #next; } foreach my $line (@dshresult) { my ($csmnode, $hostname) = split(" ", $line); $hostname =~ s/://g; $csmnode =~ s/://g; if (defined($csmnode) && defined($hostname)) { # make sure the format is consistent with the name that # was used to create the configinfo file #$csm_nodename = NodeUtils->tryHost($csmnode); $found{$csmnode} = 1; $dups{$hostname}{$csmnode} = 1; # put the result in the nodemap file unless (print NODEMAP "$csmnode $hostname\n") { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_WRITEtoFILE', "$nodemap_file"); } } } } if (@AIX) { my $node_file = InstallUtils->make_node_list_file(\@AIX) ; #put all dest nodes in tmp file $ENV{'DSH_LIST'} = $node_file; my $dshcmd = "$::DSH hostname"; my @dshresult = `$dshcmd`; $rc = $? >> 8; InstallUtils->close_delete_file($::NODE_LIST_FILE, $node_file) ; #delete node file if ($rc != 0) { # print error message NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCMD_FAILED_RC', $dshcmd, $rc ); #$main::dsh_failed{$node}=1; #take these out of target nodes #next; } foreach my $line (@dshresult) { my ($csmnode, $hostname) = split(" ", $line); $hostname =~ s/://g; $csmnode =~ s/://g; if (defined($csmnode) && defined($hostname)) { # make sure the format is consistent with the name that # was used to create the configinfo file #$csm_nodename = NodeUtils->tryHost($csmnode); $found{$csmnode} = 1; $dups{$hostname}{$csmnode} = 1; # put the result in the nodemap file unless (print NODEMAP "$csmnode $hostname\n") { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_WRITEtoFILE', "$nodemap_file"); } } } } #foreach my $n (keys %DestNodeHash){ # if(!$found{$n}){ # $main::dsh_failed{$n}=1; # } # } foreach my $n (keys %dups) { #get rid of any nodes that map to the same hostname if (scalar(keys %{$dups{$n}}) > 1) { my @dupNodes = keys %{$dups{$n}}; my $dNstring = join ',', @dupNodes; my $hostname = $n; NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgHostnameMap', $hostname, $dNstring ); foreach my $d (@dupNodes) { $main::dsh_failed{$d} = 1; } } } close(NODEMAP); if (!@AIX && !@Linux) { return $::NOK; } return $::OK; } #-------------------------------------------------------------------------------- =head3 createSMSConfig Put SMS node group info into the file: /csminstall/csm/var/smsupdate.info Arguments: none Returns: reference to a hash of all groups Globals: none Error: NodeUtil message E Example: #create the SMS nodegroup config file ServerUtils->createSMSConfig(); Comments: none =cut #-------------------------------------------------------------------------------- sub createSMSConfig { my %all_groups = (); my %node_index; my @empty_array = (); if (-e "/csminstall") { if (!-e "/csminstall/csm") { mkdir "/csminstall/csm", 0077; mkdir "/csminstall/csm/config", 0077; } } my $ref_nodegrp = NodeUtils->listNodeGroupExpMem(@empty_array); foreach my $row (@$ref_nodegrp) { my ($groupname, $nodelist) = $row =~ /^(.+):\|:\{(.*)\}$/; my @nodes = split(/,/, $nodelist); foreach my $node (@nodes) { push @{$node_index{$node}}, $groupname; push @{$all_groups{$groupname}}, $node; } } system("$::MKDIR -p /csminstall/csm/config/"); open(GROUPFILE, ">/csminstall/csm/config/sms.info") or NodeUtils->message('E', 'EMsgCANT_OpenFile', "/csminstall/csm/config/sms.info", "$? $!"); foreach my $node (keys %node_index) { print GROUPFILE "$node: @{$node_index{$node}} \n"; } close GROUPFILE; return \%all_groups; } #-------------------------------------------------------------------------------- =head3 get_script_list For a given directory get a list of scripts and associated list of nodes to run it on. Arguments: $directoryName @nodeList Returns: $::OK $::NOK Globals: @::scriptlist @{$::scriptnodes{$fname}} Error: $::NOK Example: $rc = ServerUtils->get_script_list($dirname,@nodelist); Comments: none =cut #-------------------------------------------------------------------------------- sub get_script_list { my ($junk, $dirname, @nlist) = @_; my %basename; my $target; my $filename; my @filelist; my $cmd; @::scriptlist = (); if (-d $dirname) { $cmd = "$::LS $dirname"; @filelist = NodeUtils->runcmd($cmd, -1); if ($::RUNCMD_RC) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgCANT_RUN', $cmd, $::RUNCMD_RC ); return $::NOK; } } else { # msg - Warning: The \'$dirname\' does not exist. # Skipping to the next directory. NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgSkipDir', $dirname); return $::NOK; } # check each script name in this directory # - add the filename to the script list # - get the initial list of node to run the script on # - save the basename for each script foreach $filename (sort @filelist) { chomp $filename; # make sure this is not a subdir if (-d "$dirname/$filename") { # error - Skipping subdirectory $dirname/$filename. NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "I", 'IMsgSkipSubDir', "$dirname/$filename" ); next; } # figure out what nodes to run the script on by # deciphering the script name @{$::scriptnodes{$filename}} = InstallUtils->name2list($dirname, $filename, @nlist); if (${$::scriptnodes{$filename}}[0] eq $::NOK) { # msg - Skipping to the next script name. NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgSkipScript'); next; } push @::scriptlist, $filename; (@basename{$filename}, $target) = split(/\._/, $filename); } # now check each script that has no extension (target) and see # if there are any scripts with the same basename that have targets # if there are - remove any nodes in the targeted script list from the # list of nodes for the script with no extensions(target) # ex. say script foo goes to all nodes and script foo._grpa goes # to node1 & node2. In this case I need to remove node1 & node2 # from the list of nodes for the script foo. foreach my $fname (sort @::scriptlist) { chomp $fname; # if the script name is the same as the basename then # the list is all the nodes passed in on the command line. if ($fname eq @basename{$fname}) { # check the rest of the scripts to see if any # have the same basename - if we find one then redo # the list for the basename-only script foreach my $file (@::scriptlist) { chomp $file; # see if the basenames are the same if (@basename{$fname} eq @basename{$file}) { # don't remove itself if ($file ne $fname) { my @tmplist = (); foreach my $node (@{$::scriptnodes{$fname}}) { # if the node is not in the list for $file # then add it to a temp list if (!grep /^$node/, @{$::scriptnodes{$file}}) { push @tmplist, $node; } } @{$::scriptnodes{$fname}} = @tmplist; } } } } } return $::OK; } #-------------------------------------------------------------------------------- =head3 make_config_file Create configuration information files for each node provided in the nodelist reference argument. Arguments: $ref_nodeList $ref_nodeinfo $ref_DestinationNodeHash Returns: $::OK $::NOK Globals: $::SETUP_REMOTE_SHELL $::NOSMS Error: $::NOK Example: if(ServerUtils->make_config_file( \@DestNode, \@lsnode_info, \%DestNodeHash) != 0) { blah; } Comments: Requires $::REMOTE_SHELL and $::SETUP_REMOTE_SHELL to be set optionally, $::NOSMS can be set to instruct makenode to not perform software maintenance on Linux nodes =cut #-------------------------------------------------------------------------------- sub make_config_file { my ($class, $ref_nl, $ref_nodeinfo, $ref_DestNodeHash) = @_; my @nl = @$ref_nl; my @nodeinfo = @$ref_nodeinfo; # DestNodeHash is a hash containing attribute values for each node # that was provided on the command line. my %DestNodeHash = %$ref_DestNodeHash; my ($hname, $short, $rc); my $csmcfgdir = "/csminstall/csm/config"; my $cmd; my $output; my $DirectorInstalled = 0; my ($host, $ipaddr, $shorthost); # # Check and/or create the /csminstall/csm/config directory # if (!-d $csmcfgdir) { $cmd = "$::MKDIR -m 755 -p $csmcfgdir"; $rc = system("$cmd"); if ($rc >> 8) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgNO_CreateDir', $csmcfgdir ); return ($::NOK); } } # If this is a Linux management server, check if csm.director.agent # is installed. if (NodeUtils->isLinux() == 1) { $cmd = "$::RPMCMD -q csm.director.agent"; $output = NodeUtils->runcmd($cmd, -1); if ($::RUNCMD_RC == 0) { $DirectorInstalled = 1; } } # get the lists of user-provided cstomization script # that we need to run on the nodes if (InstallUtils->make_script_lists(@nl)) { # msg -Could not get lists of customization scripts NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgNoCustScripts'); # continue } # # create the config_info file # # go through each node in the list # (the keys are the hostnames as returned from tryHost() !!) foreach $hname (keys %DestNodeHash) { # remove the old config file if any if (-e "$csmcfgdir/$hname.config_info") { $cmd = "$::RM $csmcfgdir/$hname.config_info"; $rc = system("$cmd"); if ($rc >> 8) { my $fn = "$csmcfgdir/$hname.config_info"; NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgNO_RM', "$fn"); # try to continue ??return $::NOK; } } # create the new file unless (open(CONFIG_OUT, ">$csmcfgdir/$hname.config_info")) { my $fn = "$csmcfgdir/$hname.config_info"; NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgCANT_WRITE_FILE', "$fn" ); return $::NOK; } # Add cluster-wide configuration information to the file if (defined($::REMOTE_SHELL)) { print CONFIG_OUT "RemoteShell=$::REMOTE_SHELL\n"; } if (defined($::SETUP_REMOTE_SHELL)) { print CONFIG_OUT "SetupRemoteShell=$::SETUP_REMOTE_SHELL\n"; } # add the node configuration information to the file if (defined($hname)) { print CONFIG_OUT "Hostname=$hname\n"; } if (defined($DestNodeHash{$hname}{'ManagementServer'})) { print CONFIG_OUT "ManagementServer=$DestNodeHash{$hname}{'ManagementServer'}\n"; print CONFIG_OUT "ManagementServerIP=" . NetworkUtils->validate_ip( $DestNodeHash{$hname}{'ManagementServer'}) . "\n"; } if (defined($DestNodeHash{$hname}{'InstallOSName'})) { print CONFIG_OUT "InstallOSName=$DestNodeHash{$hname}{'InstallOSName'}\n"; } if (defined($DestNodeHash{$hname}{'InstallCSMVersion'})) { print CONFIG_OUT "InstallCSMVersion=$DestNodeHash{$hname}{'InstallCSMVersion'}\n"; } if (defined($DestNodeHash{$hname}{'InstallDistributionVersion'})) { print CONFIG_OUT "InstallDistributionVersion=$DestNodeHash{$hname}{'InstallDistributionVersion'}\n"; } if (defined($DestNodeHash{$hname}{'InstallDistributionName'})) { print CONFIG_OUT "InstallDistributionName=$DestNodeHash{$hname}{'InstallDistributionName'}\n"; } if (defined($DestNodeHash{$hname}{'InstallPkgArchitecture'})) { print CONFIG_OUT "InstallPkgArchitecture=$DestNodeHash{$hname}{'InstallPkgArchitecture'}\n"; } if (defined($DestNodeHash{$hname}{'Mode'})) { print CONFIG_OUT "Mode=$DestNodeHash{$hname}{'Mode'}\n"; } if (defined($DestNodeHash{$hname}{'ConsoleSerialDevice'})) { print CONFIG_OUT "ConsoleSerialDevice=$DestNodeHash{$hname}{'ConsoleSerialDevice'}\n"; } if (defined($DestNodeHash{$hname}{'InstallServer'}) && ($DestNodeHash{$hname}{'InstallServer'} ne "")) { my $progname = NodeUtils->programName(); if ($progname =~ m/installnode/) { #make sure a machine is not an install server of itself my ($node_hostname, $node_ip) = NodeUtils->getHost($hname); my ($server, $rep_dir) = split ':', $DestNodeHash{$hname}{'InstallServer'}; my ($isvr_hostname, $isvr_ip) = NodeUtils->getHost($server); if ($node_hostname ne $isvr_hostname) { print CONFIG_OUT "InstallServer=$DestNodeHash{$hname}{'InstallServer'}\n"; } } elsif ($DestNodeHash{$hname}{'InstallServer'} ne $DestNodeHash{$hname}{'ManagementServer'}) { #not using the ms as the install server print CONFIG_OUT "InstallServer=$DestNodeHash{$hname}{'InstallServer'}\n"; } } if (defined($DestNodeHash{$hname}{'PowerMethod'})) { print CONFIG_OUT "PowerMethod=$DestNodeHash{$hname}{'PowerMethod'}\n"; } if (defined($DestNodeHash{$hname}{'InstallAdapterMacaddr'})) { print CONFIG_OUT "InstallAdapterMacaddr=$DestNodeHash{$hname}{'InstallAdapterMacaddr'}\n"; } # Handle Linux-specific attributes. if ($DestNodeHash{$hname}{'InstallOSName'} eq "Linux") { # If csm.director.agent is installed on the management server, # then install it on the Linux nodes. print CONFIG_OUT "InstallDirector=$DirectorInstalled\n"; # if $::NOSMS isn't set then perform software maintenance if (!$::NOSMS) { print CONFIG_OUT "SMS=1\n"; } } if (defined($DestNodeHash{$hname}{'ConsoleSerialSpeed'})) { print CONFIG_OUT "ConsoleSerialSpeed=$DestNodeHash{$hname}{'ConsoleSerialSpeed'}\n"; } if (defined($DestNodeHash{$hname}{'InstallMethod'})) { print CONFIG_OUT "InstallMethod=$DestNodeHash{$hname}{'InstallMethod'}\n"; } # put in the SetupKRB5 attribute value if (!defined $::KRB5SETUP) { $::KRB5SETUP = InstallUtils->getSetupKRB5; } print CONFIG_OUT "SetupKRB5=$::KRB5SETUP\n"; # put in what would be the KRB5 principal name for ManagementServer if (!defined $::MSNAME) { $::MSNAME = NodeUtils->getRSCThostname; } my $msnamelower = lc($::MSNAME); print CONFIG_OUT "CSMKRB5Principal=ctsrcmdp.$msnamelower"; # put in what would be the KRB5 principal name for HA ManagementServer if (!defined $::HAMODE) { my $outref = NodeUtils->runrmccmd('lsrsrc-api', "-i", "-s IBM.DmsCtrl::::HAMode"); $::HAMODE = $$outref[0]; } if ($::HAMODE == 1) { #on an active HAMS management server require HAMS; my $inactivems = HAMS->getInactiveRSCTHostname(); # get HA name my $inactivemslower = lc($inactivems); print CONFIG_OUT ",ctsrcmdp.$inactivemslower\n"; } else { print CONFIG_OUT "\n"; } if (($::SETUP_REMOTE_SHELL == 1) && ($::REMOTE_SHELL =~ m/rsh/)) { if (!defined $::HAMODE) { my $outref = NodeUtils->runrmccmd('lsrsrc-api', "-i", "-s IBM.DmsCtrl::::HAMode"); $::HAMODE = $$outref[0]; } if ($::HAMODE == 1) { #on an active HAMS management server #get management server attribute for node on other ms require HAMS; my $other_ms = HAMS->getManagementServerAttr($hname); if ($other_ms) { print CONFIG_OUT "InActiveMSAttr=$other_ms\n"; } } } # # add the /etc/hosts info for the management server - just AIX for now # if ($DestNodeHash{$hname}{'InstallOSName'} eq "AIX") { ($host, $ipaddr) = NodeUtils->getHost($DestNodeHash{$hname}{'ManagementServer'}); ($shorthost = $host) =~ s/\..*$//; print CONFIG_OUT "ETCHOSTSMS=$ipaddr $host $shorthost\n"; } # add lists of scripts to run on the node if (defined(@{$::PREINSTSCRIPTS{$hname}})) { print CONFIG_OUT "PREINSTSCRIPTS=@{$::PREINSTSCRIPTS{$hname}}\n"; } if (defined(@{$::POSTINSTSCRIPTS{$hname}})) { print CONFIG_OUT "POSTINSTSCRIPTS=@{$::POSTINSTSCRIPTS{$hname}}\n"; } if (defined(@{$::UPDATESCRIPTS{$hname}})) { print CONFIG_OUT "UPDATESCRIPTS=@{$::UPDATESCRIPTS{$hname}}\n"; } close(CONFIG_OUT); $cmd = "$::CHMOD 644 $csmcfgdir/$hname.config_info"; $rc = system("$cmd"); if ($rc >> 8) { NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCMD_FAILED_RC', $::CHMOD, $rc ); # try to continue } #Add symbol link short_hostname.config_info to long_hostname.config_info my ($short_hname) = split('\.', $hname); # this symbolic link will be done only when the short name is not the # same as the long name if ($short_hname ne $hname) { $cmd = "cd $csmcfgdir; $::LN -fs $hname.config_info $short_hname.config_info"; $rc = system("$cmd"); if ($rc >> 8) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCMD_FAILED_RC', $::LN, $rc); } } } # go do the next node return $::OK; } #-------------------------------------------------------------------------------- =head3 make_node_list_file Makes a node list file. Arguments: (\@list_of_nodes) - reference to an arrary of nodes. Returns: $file_name and sets the global var: $::NODE_LIST_FILE Globals: the ENV vars: DSH_LIST, RPOWER_LIST, RCONSOLE_LIST Error: None documented Example: ServerUtils->make_node_list_file(\@nodelist); Comments: IMPORTANT: Make sure to cleanup afterwards with: ServerUtils->close_delete_file($file_handle, $file_name) =cut #-------------------------------------------------------------------------------- sub make_node_list_file { my ($class, $ref_node_list) = @_; my @node_list = @$ref_node_list; srand(time | $$); #random number generator start my $file = "/tmp/csm_$$"; while (-e $file) { $file = InstallUtils->CreateRandomName($file); } open($::NODE_LIST_FILE, ">$file") or NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgCANT_WRITE_FILE', "$file"); foreach my $node (@node_list) { print $::NODE_LIST_FILE "$node\n"; } return $file; } #-------------------------------------------------------------------------------- =head3 make_script_lists Create lists of pre-install, post-install and update scrips for each node and put them in the following global hashes: %::PREINSTSCRIPTS - scripts get run from csmprereboot during full install before the first reboot. %::POSTINSTSCRIPTS - scripts get run from csmfirstboot after the first reboot of the system. %::UPDATESCRIPTS - scripts get run from updatenode.client after a node has been updated. Arguments: @nodelist Returns: $::OK - on success 1 - on error Globals: %::PREINSTSCRIPTS %::POSTINSTSCRIPTS %::UPDATESCRIPTS Example: if( ServerUtils->make_script_lists(@nodelist) ) { blah; }_ Comments: none =cut #-------------------------------------------------------------------------------- sub make_script_lists { my ($junk, @nodel) = @_; # the list of nodes passed in on the command line my $dirname; # directory to check for scripts my $script; # unique script name my $cmd; my $rc; @::scriptlist; # list of scripts found in a directory %::scriptnodes; # lists of nodes to run each script on # get the list of all nodes so we can check # for valid node names later $cmd = "$::LSNODE"; @::allnodes = NodeUtils->runcmd($cmd, -1); if ($::RUNCMD_RC) { NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', 'E', 'EMsgCANT_RUN', $cmd, $::RUNCMD_RC); return $::NOK; } my @scriptdirlist; if ($::UPDATESCRIPTSONLY) { @scriptdirlist = ($::UPDATEDIR); } else { @scriptdirlist = ($::PREINSTALLDIR, $::POSTINSTALLDIR); } # check each subdirectory for user scripts foreach $dirname (@scriptdirlist) { $rc = InstallUtils->get_script_list($dirname, @nodel); if ($rc == $::NOK) { next; } # check each script name in this directory foreach $script (sort @::scriptlist) { chomp $script; # see if there are any nodes in the list if (@{$::scriptnodes{$script}}[0] eq $::NOK) { # msg - Skipping to the next script name. NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgSkipScript'); next; } # see if the script is executable if (!(-x "$dirname/$script")) { # msg - Script $script is not executable. NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgExecScript', "$dirname/$script"); # msg - Skipping to the next script name. NodeUtils->messageFromCat('csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgSkipScript'); next; } # add the file to the correct script list for the node foreach my $node (@{$::scriptnodes{$script}}) { chomp $node; if ($dirname eq $::PREINSTALLDIR) { push @{$::PREINSTSCRIPTS{$node}}, $script; } elsif ($dirname eq $::POSTINSTALLDIR) { push @{$::POSTINSTSCRIPTS{$node}}, $script; } elsif ($dirname eq $::UPDATEDIR) { push @{$::UPDATESCRIPTS{$node}}, $script; } } } } return $::OK; } #-------------------------------------------------------------------------------- =head3 name2list Convert a script file name to a list of nodes that the script can be run on. Arguments: $dirname, $filename @nlist Returns: array of node names. Error: 1 - An error occured. # Globals: Requires @::allnodes be set by caller Example: @{$::scriptnodes{$filename}}= ServerUtils->name2list($dirname,$filename,@nlist);_ Comments: The file name format is ._. If there is just a basename then it applies to all nodes. If there is a node name then it just applies to that node. If there is a group name then it applies to the members of the group. =cut #-------------------------------------------------------------------------------- sub name2list { my ($junk, $dirname, $filename, @nlist) = @_; my @nodelist = (); my ($base, $name, @glist); my ($short, $target, $cmd); my $junk2; chomp $filename; # the second part of the file name tells us # what nodes to run it on # also check if additional target was used - error ($base, $target, $junk2) = split(/\._/, $filename); if (defined($junk2)) { # \'$filename\' is not a valid customization script name. NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgBadScriptName', "$dirname/$filename" ); return $::NOK; } if (!defined($target)) { # do on all nodes the calling # command was asked to process return @nlist; } else { # see if the target is a valid node name my ($hostname, $ipaddr) = NodeUtils->tryHost($target); if (grep(/^$hostname/, @::allnodes)) { # see if the target is one of the nodes # specified on the command line if (grep(/^$hostname/, @nlist)) { chomp(@nodelist = ($hostname)); } return @nodelist; } # see if target is a valid group name $cmd = "$::NODEGRP -p $target"; @glist = NodeUtils->runcmd($cmd, -1); if ($::RUNCMD_RC) { # msg - An incorrect file name format was used for the script $filename. '$target' is neither a node name nor a group name. NodeUtils->messageFromCat( 'csmInstall.cat', $::MSGMAPPATH, 'csminstall', "E", 'EMsgBadScript', "$dirname/$filename", $target ); return $::NOK; } else { foreach $name (@glist) { # we only need a node if it was specified # on the command line if (grep(/^$name/, @nlist)) { push(@nodelist, $name); } } return @nodelist; } } return $::NOK; } #-------------------------------------------------------------------------------- =head2 PkgDefs Support =cut #-------------------------------------------------------------------------------- =head3 get_OSDefs Determine which definition files need to be loaded and load them. Read the set of OSDefs variables into a hash and assigns them each to global variables. Calls get_osdefs_files to read the files in /opt/csm/install/defs. The correct file(s) are chosen based on the parameters passed in to get_OSDefs. If no parameters are provided, default values based on the current machine's configuration are filled in. Arguments: $argsProvided. Returns: Array of defintion file names Globals: none Error: undefined Example: my %osdefs = ServerUtils->get_OSDefs(); # Get defs for this host print "CHMOD = $osdefs{'CHMOD'}\n"; # You can also use a global variable: my %osdefs = ServerUtils->get_OSDefs(); # Get for current machine print "CHMOD = $::CHMOD\n"; Comments: The pathnames must be defined in CSMDefs.pm. =cut #-------------------------------------------------------------------------------- sub get_OSDefs { my $class = shift; my $args_provided = (@_); my ( $osname, # eg Linux or AIX (case sensitive) $distro_name, # eg RedHat or SuSE (case sensitive) $distro_version, # eg 7.3 or 5.2 $hw_arch, # eg i386, ppc $csm_version, # eg 1.3.0 $no_globals, # Don't set global variables if set to 1 ) = @_; # Default to setting global variables $no_globals = 0 if (!$no_globals); # Set defaults if no arguments were provided # Note below that some of these require command pathnames to be defined. # Therefore, the pathnames must be defined in CSMDefs.pm. if (!$args_provided) { $osname = $::PLTFRM; $distro_name = NodeUtils->get_DistributionName; #requires no cmds $distro_version = NodeUtils->get_DistributionVersion; #requires LSLPP $hw_arch = InstallUtils->get_PkgArchitecture; #requires UNAME for Linux $csm_version = InstallUtils->get_CSMVersion("csm.core"); #requires RPMCMD and LSLPP } my $munge = join( "|::|", ( $osname, $distro_name, $distro_version, $hw_arch, $csm_version ) ); if ($::all_OSDefs{$munge}) { ($::DEBUG) && print "Found $munge in OSDefs hash\n"; return (%{$::all_OSDefs{$munge}}); } InstallUtils->get_osdefs_files($osname, $distro_name, $distro_version, $hw_arch, $csm_version); # Assign each hash element to a global variable unless $no_globals is set unless ($no_globals) { foreach my $key (keys %::OSDefs) { my $value = $::OSDefs{$key}; # Display the key and the value #print "$key : $value\n"; # Assign each hash element to a global variable. # For example, the following has the effect of setting # $::GREP = $value # In order for this to work, we need to temporarily turn off # strict type checking, until the end of this block. no strict 'refs'; ${"main::$key"} = $value; } } # Store the attributes that were used to obtain this OSdefs $::OSDefs{OSDefs_osname} = $osname; $::OSDefs{OSDefs_distro_name} = $distro_name; $::OSDefs{OSDefs_distro_version} = $distro_version; $::OSDefs{OSDefs_hw_arch} = $hw_arch; $::OSDefs{OSDefs_csm_version} = $csm_version; # Make a local copy of OSDefs my %OSDefs = %::OSDefs; # Add it to all_pkgdefs $::all_OSDefs{$munge} = \%OSDefs; return %OSDefs; } #-------------------------------------------------------------------------------- =head3 get_osdefs_files Determine which definition files need to be loaded and load them. Arguments: $class, $osname, $distro_name, $distro_version, $hw_arch, $csm_version Returns: Array of defintion file names Globals: none Error: undefined Example: ServerUtils->get_osdefs_files($osname, $distro_name, $distro_version, $hw_arch, $csm_version); Comments: Search order on Linux Linux-RedHat7.3-i386.pm, Linux-RedHat7.3.pm, Linux-RedHat.pm, Linux.pm Search order on AIX: AIX-5.2.pm, AIX.pm Search for the files in either /defs or $OSDEFS =cut #-------------------------------------------------------------------------------- sub get_osdefs_files { my ($class, $osname, $distro_name, $distro_version, $hw_arch, $csm_version,) = @_; my $isAIX = ($osname eq "AIX"); # Set these global variables to load the correct values from osdefs. $::csm_version = $csm_version; my $distro = "${distro_name}${distro_version}"; my $osdistro = "${osname}-${distro}"; my @defsfiles; push(@defsfiles, "${osdistro}-${hw_arch}.pm") if (${hw_arch}); push(@defsfiles, "${osdistro}.0-${hw_arch}.pm") if (${hw_arch} and $isAIX); push(@defsfiles, "${osdistro}.pm"); push(@defsfiles, "${osdistro}.0.pm") if ($isAIX); push(@defsfiles, "${osname}-${distro_name}.pm") if (${distro_name}); push(@defsfiles, "${osname}.pm"); my $progdir = dirname($0); foreach